PSIBLAST alignment of GI: 254780151 and protein with PDB id: 1gpm

gi|1310841|pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525
>gi|1310842|pdb|1GPM|B Chain B, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525
 Score = 58.2 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 64/194 (32%), Gaps = 27/194 (13%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           D +V++ +SGGVDSSV A LL R  G ++  V +                    + +A +
Sbjct: 227 DDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDN--------------GLLRLNEAEQ 272

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D     H+  +          +   +           +     V+  D     +    
Sbjct: 273 VLDMFG-DHFGLNIVHVPAEDRFLSALAG-ENDPEAKRKIIGRVFVEVFD-EEALKLEDV 329

Query: 139 DVLATGH-YIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
             LA G  Y            +  ++    ++            ++    L  PL ++ K
Sbjct: 330 KWLAQGTIYPDVIESAASATGKAHVIKSHHNVG--------GLPKEMKMGLVEPLKELFK 381

Query: 198 ESVRDLAREMGLDI 211
           + VR +  E+GL  
Sbjct: 382 DEVRKIGLELGLPY 395