PSIBLAST alignment of GI: 254780151 and protein with PDB id: 2dpl

gi|119389212|pdb|2DPL|A Chain A, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308
>gi|119389213|pdb|2DPL|B Chain B, Crystal Structure Of The Gmp Synthase From Pyrococcus Horikoshii Ot3 Length = 308
 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 70/200 (35%), Gaps = 33/200 (16%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           ++ +   D + ++A+SGGVDSS  A L  +  G  +  V +     RK            
Sbjct: 13  EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFV------ 66

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
                +   D   ++ +  D ++RF +A+                 +     +       
Sbjct: 67  ----VKTFRDEFGMNLHYVDAQDRFFSALKGVTDPE------EKRKIIGRVFI--EVFEE 114

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           V +++GA+ L  G      +      K                  +    ++    L  P
Sbjct: 115 VAKKIGAEYLIQGTIAPDWIESQGKIKSHH--------------NVGGLPEKLNLKLIEP 160

Query: 192 LGDMKKESVRDLAREMGLDI 211
           L D+ K+ VR+LA+ +GL  
Sbjct: 161 LRDLYKDEVRELAKFLGLPE 180