PSIBLAST alignment of GI: 254780151 and protein with PDB id: 2ywb

gi|159795609|pdb|2YWB|A Chain A, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503
>gi|159795610|pdb|2YWB|B Chain B, Crystal Structure Of Gmp Synthetase From Thermus Thermophilus Length = 503
 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 49/128 (38%), Gaps = 14/128 (10%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV++A+SGGVDSS +A LL + G D + V +   +       +      ++V  A R 
Sbjct: 209 KDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFV---DHGLLRLGER-----EEVEGALR- 259

Query: 80  CDTINVSHYVFDYEERF---RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
              + V+  V D +ERF      V  P       G   +         +          L
Sbjct: 260 --ALGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTL 317

Query: 137 GADVLATG 144
             DV+ + 
Sbjct: 318 YPDVIESA 325