BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase
MnmA [Candidatus Liberibacter asiaticus str. psy62]
         (408 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039828|gb|ACT56624.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|255957544|dbj|BAH96607.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957840|dbj|BAH96814.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957850|dbj|BAH96823.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957860|dbj|BAH96832.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957870|dbj|BAH96841.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957880|dbj|BAH96850.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957890|dbj|BAH96859.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957900|dbj|BAH96868.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957910|dbj|BAH96877.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957920|dbj|BAH96886.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957930|dbj|BAH96895.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957940|dbj|BAH96904.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957950|dbj|BAH96913.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957960|dbj|BAH96922.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957970|dbj|BAH96931.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957980|dbj|BAH96940.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957990|dbj|BAH96949.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958000|dbj|BAH96958.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958010|dbj|BAH96967.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958020|dbj|BAH96976.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958030|dbj|BAH96985.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958040|dbj|BAH96994.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958050|dbj|BAH97003.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958060|dbj|BAH97012.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958070|dbj|BAH97021.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958080|dbj|BAH97030.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958090|dbj|BAH97039.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958100|dbj|BAH97048.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958110|dbj|BAH97057.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958120|dbj|BAH97066.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|283362130|dbj|BAI65917.1| predicted tRNA (5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Candidatus Liberibacter asiaticus]
 gi|283362140|dbj|BAI65926.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362150|dbj|BAI65935.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362160|dbj|BAI65944.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362170|dbj|BAI65953.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362180|dbj|BAI65962.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362190|dbj|BAI65971.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362200|dbj|BAI65980.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362210|dbj|BAI65989.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362220|dbj|BAI65998.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362230|dbj|BAI66007.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
          Length = 408

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 408/408 (100%), Positives = 408/408 (100%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA
Sbjct: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC
Sbjct: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT
Sbjct: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA
Sbjct: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV
Sbjct: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA
Sbjct: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408


>gi|140063954|gb|ABO82466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Liberibacter asiaticus]
          Length = 408

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 407/408 (99%), Positives = 408/408 (100%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVT+QLYNSRKA
Sbjct: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTVQLYNSRKA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC
Sbjct: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT
Sbjct: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA
Sbjct: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV
Sbjct: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA
Sbjct: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408


>gi|222149632|ref|YP_002550589.1| tRNA-specific 2-thiouridylase MnmA [Agrobacterium vitis S4]
 gi|221736614|gb|ACM37577.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium vitis S4]
          Length = 402

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 237/397 (59%), Positives = 295/397 (74%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
               +N+LD DK P+D RVVVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R 
Sbjct: 1   MTRPVNTLDFDKRPEDTRVVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRA 60

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           GSCCAGQD+ DARRVC+T+ + HYV DYE+RFR+ VI PF  SY AGETP+PCV CN+TV
Sbjct: 61  GSCCAGQDIDDARRVCETLGIPHYVLDYEQRFRDTVINPFMDSYIAGETPIPCVACNQTV 120

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF+DLL+  R+LGAD LATGHYIRSR     +    R + RP+D ERDQSYFLFATTQ+Q
Sbjct: 121 KFADLLATARELGADALATGHYIRSRATPLPNDPGHRALFRPIDSERDQSYFLFATTQEQ 180

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           +  LRFPLG + K   R LA +MGL +A K+DSQDICFV QGKY D++ ++    AL GD
Sbjct: 181 IDYLRFPLGGLSKAETRKLAEDMGLVVAQKADSQDICFVPQGKYADIINKLKPNAALSGD 240

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IVHL+G++LG+H GI++YTIGQR+GLGVA GEPL+VVYLD  S RVIVGPRE+LE  R+Y
Sbjct: 241 IVHLDGRVLGQHEGILHYTIGQRKGLGVATGEPLYVVYLDARSRRVIVGPREALETRRVY 300

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR+INWLGD   ED    GF CF K+RS++ P P  +  ++ G+YVD +  E GVA GQA
Sbjct: 301 LRDINWLGDRAIEDEASGGFACFAKVRSTRPPAPAHLHADETGIYVDLDMGEAGVAPGQA 360

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIG 401
           CV Y+ +  +ARV GGG I  S+R    E  L +++ 
Sbjct: 361 CVLYSGEGADARVYGGGFIERSERQAEAETFLKALLA 397


>gi|315122753|ref|YP_004063242.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496155|gb|ADR52754.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 398

 Score =  401 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 326/392 (83%), Positives = 360/392 (91%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD DKNPKDMRVVVAMSGGVDSS+VAALLKRDGYDV+GVTLQLYN  K SKRKGSCC
Sbjct: 1   MNSLDFDKNPKDMRVVVAMSGGVDSSIVAALLKRDGYDVVGVTLQLYNGGKESKRKGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQDVYDARRVCD I+V HYVFDYEERF NAVIVPFA++Y AGETPLPCVDCNRTVKF D
Sbjct: 61  AGQDVYDARRVCDAIDVPHYVFDYEERFHNAVIVPFANAYIAGETPLPCVDCNRTVKFLD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLSV R+LGADVLATGHYIRSR +VG DG RRRIMCRP+D ERDQSYFLFATTQQQLCDL
Sbjct: 121 LLSVMRRLGADVLATGHYIRSRFHVGADGVRRRIMCRPVDSERDQSYFLFATTQQQLCDL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+MKKESVRDLAREM L++ADKSDSQDICFVQ+GKYFD+VK++++ I+LEG+IVHL
Sbjct: 181 RFPLGEMKKESVRDLAREMKLEVADKSDSQDICFVQKGKYFDIVKKLSSDISLEGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LGRHNGIINYTIGQRRGLG+A  +PLFVVYLDK  SRVIVGPRE+LEV RIYLREI
Sbjct: 241 SGQVLGRHNGIINYTIGQRRGLGIAASDPLFVVYLDKQGSRVIVGPREALEVRRIYLREI 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG FED VVDGFKCF KIRSSQDPV VFV+R+D GVYVDFE SE GVA+GQACVFY
Sbjct: 301 NWLGDGSFEDVVVDGFKCFAKIRSSQDPVSVFVKRDDSGVYVDFENSEEGVAAGQACVFY 360

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           +SDSN+AR+LGGG IS SKRSD VE+SL S++
Sbjct: 361 SSDSNDARILGGGFISCSKRSDKVEKSLFSIM 392


>gi|190893264|ref|YP_001979806.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CIAT 652]
 gi|229486418|sp|B3PYW4|MNMA_RHIE6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|190698543|gb|ACE92628.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CIAT 652]
          Length = 408

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 233/403 (57%), Positives = 296/403 (73%), Gaps = 1/403 (0%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
             + A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A 
Sbjct: 3   AQNLAPPLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAV 62

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
            R GSCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN
Sbjct: 63  HRAGSCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCN 122

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
           +TVKF+DLL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATT
Sbjct: 123 QTVKFADLLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATT 182

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           Q+Q+  LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL
Sbjct: 183 QEQIDYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAAL 242

Query: 242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVH 301
            G+IVHL+G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE H
Sbjct: 243 AGEIVHLDGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETH 302

Query: 302 RIYLREINWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           R+YLR++NWLGD    +A   +GF C+ K+RS++ P P  +  +  G YVD    E G+A
Sbjct: 303 RVYLRDVNWLGDETLGEAASGEGFACYAKVRSTRAPAPAVLHVDATGTYVDLTVGEAGIA 362

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
            GQAC  Y++  ++ARV GGG I  S+R  A E SL +++   
Sbjct: 363 PGQACALYSAPGDDARVFGGGFIERSEREPAAEASLKALLASP 405


>gi|163758747|ref|ZP_02165834.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hoeflea phototrophica DFL-43]
 gi|162284037|gb|EDQ34321.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hoeflea phototrophica DFL-43]
          Length = 401

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 230/392 (58%), Positives = 297/392 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD+DK+P+D RVVVAMSGGVDSSVVA LL R+GYDV+GVTLQLY+   A  R G+CC
Sbjct: 6   VNSLDIDKDPRDTRVVVAMSGGVDSSVVAGLLAREGYDVLGVTLQLYDHGAAVHRAGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+ + + HYV DYE+RF+ AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 66  AGQDIDDARRVCEVLGIPHYVLDYEKRFQEAVINPFAESYVAGETPIPCVACNQTVKFAD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHYIRSR     D   RR + RP+D ERDQSYFLFATTQ QL  +
Sbjct: 126 LLATARDLGADALATGHYIRSRANPSADNPGRRALYRPIDSERDQSYFLFATTQDQLDYV 185

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K   R+LA EMGL +A K+DSQDICFV  GKY +V++++    AL G+IVH+
Sbjct: 186 RFPLGELPKIRTRELAEEMGLTVAQKADSQDICFVPHGKYANVIEKLRPNSALAGEIVHI 245

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+GVA+G+PL+VV+LD  S RVIVGPRE+L+  R+ LR++
Sbjct: 246 DGRVLGEHPGIVHFTIGQRRGIGVAVGDPLYVVHLDARSKRVIVGPREALDTRRLILRDM 305

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   +D   +G  CF K+RS++ P P  ++  +  + V+  + E GVA GQACV Y
Sbjct: 306 NWLGDFALDDLGPEGLSCFAKVRSTRPPRPAVLRYENGEISVELVEGESGVAPGQACVLY 365

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           ++  +EARV GGG I  S+RS A E  L +++
Sbjct: 366 SAPGDEARVFGGGFIDRSERSAAAEAMLANLL 397


>gi|222086955|ref|YP_002545489.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Agrobacterium radiobacter K84]
 gi|254811443|sp|B9J9F7|MNMA_AGRRK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|221724403|gb|ACM27559.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Agrobacterium radiobacter K84]
          Length = 399

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 238/396 (60%), Positives = 297/396 (75%), Gaps = 1/396 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D RVVVAMSGGVDSSVVA +LKR GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEDTRVVVAMSGGVDSSVVAGILKRQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     D   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSADHPGRRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G+IVHL
Sbjct: 181 RFPLGGMPKAETRALAEEMGLVVAKKADSQDICFVPQGKYSDVIAKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI++YTIGQRRG+GVA G+PL+VV+LD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGRHEGILHYTIGQRRGIGVATGDPLYVVFLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD    +A   +GF C+ K+RS++ P P  ++ + DG+YVD    E GVA GQAC  
Sbjct: 301 NWLGDEPLLEAASGEGFACYAKVRSTRPPEPAVLRADKDGIYVDLTIGEAGVAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           Y++  ++ARV GGG I  S+R    E SL +++   
Sbjct: 361 YSAPGDDARVYGGGFIERSEREPMAEASLKALLASP 396


>gi|327192984|gb|EGE59899.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CNPAF512]
          Length = 399

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 234/396 (59%), Positives = 295/396 (74%), Gaps = 1/396 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDG-LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD  L E A  DGF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLAEAASGDGFACYAKVRSTRAPAPAVLHVDATGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           Y++  ++ARV GGG I  S+R  A E SL +++   
Sbjct: 361 YSAPGDDARVFGGGFIERSEREPAAEASLKALLAGP 396


>gi|218675488|ref|ZP_03525157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli GR56]
          Length = 399

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 231/396 (58%), Positives = 294/396 (74%), Gaps = 1/396 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSLEHPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD    DA   +GF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLADAASGEGFACYAKVRSTRAPAPAVLHVDSTGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           Y++  ++ARV GGG I  S+R  + E SL +++   
Sbjct: 361 YSAPGDDARVFGGGFIERSEREPSAEASLKALLASP 396


>gi|209550765|ref|YP_002282682.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226704775|sp|B5ZNK8|MNMA_RHILW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209536521|gb|ACI56456.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 399

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 231/396 (58%), Positives = 294/396 (74%), Gaps = 1/396 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKQPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSPEHPGRRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDG-LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD  L + A  DGF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLAQAATGDGFACYAKVRSTRAPAPAVLHIDATGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           Y++  + ARV GGG I  S+R  + E SL +++   
Sbjct: 361 YSAPGDNARVFGGGFIERSEREPSAEASLKALLASP 396


>gi|254470572|ref|ZP_05083976.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudovibrio sp. JE062]
 gi|211960883|gb|EEA96079.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudovibrio sp. JE062]
          Length = 400

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 222/396 (56%), Positives = 291/396 (73%), Gaps = 5/396 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L   P+D RVVVAMSGGVDSSVVA L+KR+GYDV+GVTLQLY+  +A +RKG+CC
Sbjct: 2   LNSLGLPGRPEDTRVVVAMSGGVDSSVVAGLMKREGYDVVGVTLQLYDHGEAIQRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + + + HYV DYE RF+  VI  FA SY  GETP+PCV CN+TVKF D
Sbjct: 62  AGQDIHDARRVAEKLGIPHYVLDYESRFKEQVIERFADSYINGETPIPCVTCNQTVKFKD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + LGADVL TGHY+R+ +        +  M RP+DL+RDQSYFLFATTQ+QL  L
Sbjct: 122 LLETAKDLGADVLVTGHYVRTGM-----EGNQLAMFRPVDLDRDQSYFLFATTQEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR+LARE  L IADK DSQDICFV QG+Y DV+ ++    A  GDIVH+
Sbjct: 177 RFPLGGMTKPEVRELAREFDLAIADKHDSQDICFVPQGRYTDVIAKLRPHAAEPGDIVHV 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+HNGII+YTIGQRRG+GVA G+PL+VV+LD +  RVIVGP+E+L  H + LRE+
Sbjct: 237 DGRVLGKHNGIIHYTIGQRRGIGVATGDPLYVVHLDADGRRVIVGPKEALATHNLLLREV 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+G G  +D   +G   + K+RS++ P    +++N + + V+    E+GVA GQACVF+
Sbjct: 297 NWIGPGALDDLPEEGITVYAKVRSTRPPTEAVLRKNGENIQVELVAGEMGVAPGQACVFF 356

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEF 404
             +  EARVLGGG I  +++ +  E +L +++G  +
Sbjct: 357 DKEGQEARVLGGGWIQRAEKQEGAEAALKALLGKSW 392


>gi|86359043|ref|YP_470935.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli CFN 42]
 gi|123510891|sp|Q2K4M8|MNMA_RHIEC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|86283145|gb|ABC92208.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferaseprotein
           [Rhizobium etli CFN 42]
          Length = 408

 Score =  395 bits (1014), Expect = e-108,   Method: Composition-based stats.
 Identities = 233/403 (57%), Positives = 296/403 (73%), Gaps = 1/403 (0%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
             + A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A 
Sbjct: 3   AQNLAPPLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAV 62

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
            R GSCCAGQD+ DAR VC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN
Sbjct: 63  HRAGSCCAGQDIDDARHVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCN 122

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
           +TVKF+DLL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATT
Sbjct: 123 QTVKFADLLATAKELGADALATGHYIRSRPNPSSEHPGRRALFRPADADRDQSYFLFATT 182

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           Q+Q+  LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL
Sbjct: 183 QEQIDYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAAL 242

Query: 242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVH 301
            G+IVHL+G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE H
Sbjct: 243 AGEIVHLDGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETH 302

Query: 302 RIYLREINWLGDG-LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           R+YLR++NWLGD  L E A  +GF C+ K+RS++ P P  +  +  G YVD    E G+A
Sbjct: 303 RVYLRDVNWLGDETLAEAASGEGFACYAKVRSTRAPAPAVLHVDATGTYVDLTIGEAGIA 362

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
            GQAC  Y++  ++ARV GGG I  S+R  + E SL +++   
Sbjct: 363 PGQACALYSAPGDDARVFGGGFIERSEREPSAEASLKALLASP 405


>gi|239832470|ref|ZP_04680799.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824737|gb|EEQ96305.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 411

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 230/401 (57%), Positives = 291/401 (72%), Gaps = 5/401 (1%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
           +     LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  
Sbjct: 10  LESIMSLNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVH 69

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
           R GSCCAGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+
Sbjct: 70  RAGSCCAGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQ 129

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
           TVKF+DLL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ
Sbjct: 130 TVKFADLLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQ 184

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           +Q+  LRFPLG + K  VR++A EMGL +A K DSQDICFV QGKY D++ ++    A  
Sbjct: 185 EQIDYLRFPLGHLPKAQVREIAEEMGLTVAKKQDSQDICFVPQGKYSDIISKLKPEAANP 244

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           GDIVH++G+ LGRH+GI++YT+GQRRG+GVA GEPL+VV+LD  ++RVIVGPRE+LE H+
Sbjct: 245 GDIVHIDGRTLGRHDGIVHYTVGQRRGIGVATGEPLYVVHLDAANARVIVGPREALETHK 304

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASG 362
           ++LR+INWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A G
Sbjct: 305 VFLRDINWLGDAPIGDLPEGGIEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPG 364

Query: 363 QACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           QACV Y+ +SN ARV GGG I  S+R    EE L  ++ + 
Sbjct: 365 QACVLYSDESNTARVFGGGFIGRSEREPQAEEMLRRLVANT 405


>gi|296446642|ref|ZP_06888583.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylosinus trichosporium OB3b]
 gi|296255870|gb|EFH02956.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylosinus trichosporium OB3b]
          Length = 411

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 220/403 (54%), Positives = 276/403 (68%), Gaps = 12/403 (2%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
           V + T LNSL L K  +D RVVVAMSGGVDSSVVAALL   GYDV+GVTLQLY+  +A  
Sbjct: 8   VPDETELNSLGLPKPAQDTRVVVAMSGGVDSSVVAALLAEQGYDVVGVTLQLYDHGEAVH 67

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
           RKGSCCAGQD++DARRV   + + HYV D+E RFR  VI  FA SYA+GETP+PCV CN+
Sbjct: 68  RKGSCCAGQDIHDARRVAARLGIPHYVLDFETRFRETVIDTFAQSYASGETPVPCVACNQ 127

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
            VKF DL    + LGAD LATGHYI SR      G+  R + R MD  RDQSYFLFATT+
Sbjct: 128 FVKFVDLFETAKDLGADALATGHYIASRP-----GRGGRGLYRAMDAARDQSYFLFATTR 182

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
            QL  LRFPLG+  K  VR+LAR   LD+A+K DSQDICFV  G Y D+V+R++ G A+ 
Sbjct: 183 PQLDMLRFPLGEYAKPDVRELARRFDLDVAEKPDSQDICFVPSGHYSDIVERLSPGAAVP 242

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIVGPRE 296
           G+IVH++G++LGRH G+I+YTIGQRRGLG+         +PL+VV LD   +RVIVGPRE
Sbjct: 243 GEIVHVDGRVLGRHAGVIHYTIGQRRGLGLGAAVAGRASDPLYVVRLDAARARVIVGPRE 302

Query: 297 SLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKS 355
           +LE   + LR++NW+G+G   D    G +   ++RS++ P P  +      G  V FE  
Sbjct: 303 ALETRSVRLRDVNWIGEGELADLPEGGLEIEARVRSTRPPTPARLLPLAGGGAQVLFETG 362

Query: 356 EVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           E GV+ GQACVFY  D   ARVLGGG I+ ++ +    E +L+
Sbjct: 363 EFGVSPGQACVFYDRDGARARVLGGGFIAAAEHAAEPTEPILA 405


>gi|153008906|ref|YP_001370121.1| tRNA-specific 2-thiouridylase MnmA [Ochrobactrum anthropi ATCC
           49188]
 gi|166235072|sp|A6WZ88|MNMA_OCHA4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|151560794|gb|ABS14292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 398

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 230/395 (58%), Positives = 290/395 (73%), Gaps = 5/395 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEEMGLTVAKKQDSQDICFVPQGKYSDIISKLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GEPL+VV+LD  ++RVIVGPRE+LE H+++LR+I
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEPLYVVHLDAANARVIVGPREALETHKVFLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDAPISDLPEGGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           + +SN ARV GGG I  S+R    EE L  ++ + 
Sbjct: 358 SDESNTARVFGGGFIGRSEREPQAEEMLRRLVANT 392


>gi|24638313|sp|Q8U9M5|MNMA_AGRT5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 233/395 (58%), Positives = 294/395 (74%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D R+VVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKRPEDTRIVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         RR + RP+D +RDQS+FLFATTQ+Q+  L
Sbjct: 121 LLATAQELGADALATGHYIRSRPNPVSGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL
Sbjct: 181 RFPLGGLSKAETRALAEEMGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH+GI++YTIGQRRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR++
Sbjct: 241 DGRVLGRHDGIVHYTIGQRRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDM 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG        GF CF K+RS++ P    +  +++G+YVD    E GVA GQACV Y
Sbjct: 301 NWLGDGALAADAGQGFTCFAKVRSTRPPTEAVLHADENGIYVDLMTGEAGVAPGQACVLY 360

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           ++   +ARV GGG I  S+RS   E SL +++   
Sbjct: 361 SAPGPDARVYGGGFIDRSERSVDAEASLKALLEKP 395


>gi|325063117|gb|ADY66807.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Agrobacterium sp. H13-3]
          Length = 402

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 233/397 (58%), Positives = 295/397 (74%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
             +N+LD DK P+D R+VVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GS
Sbjct: 3   KNVNTLDFDKRPEDTRIVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGS 62

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF
Sbjct: 63  CCAGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKF 122

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
           +DLL+  ++LGAD LATGHYIRSR         RR + RP+D +RDQS+FLFATTQ+Q+ 
Sbjct: 123 ADLLATAQELGADALATGHYIRSRPNPVAGQPGRRALYRPIDSDRDQSWFLFATTQEQID 182

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG + K   R LA +MGL +A K+DSQDICFV QGKY D++ ++    AL GDIV
Sbjct: 183 YLRFPLGGLSKAETRALAEDMGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIV 242

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           HL+G++LGRH+GI++YTIGQRRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR
Sbjct: 243 HLDGRVLGRHDGIVHYTIGQRRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLR 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++NWLGDG   D    GF CF K+RS++ P    +  +++G+YVD    E GVA GQACV
Sbjct: 303 DMNWLGDGALADEAGQGFACFAKVRSTRPPTEAMLHADENGIYVDLMTGEAGVAPGQACV 362

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
            Y++   +ARV GGG I  S+RS   E SL +++   
Sbjct: 363 LYSAPGADARVYGGGFIERSERSVDAEASLKALLEKP 399


>gi|116253697|ref|YP_769535.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|205816894|sp|Q1MC84|MNMA_RHIL3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|115258345|emb|CAK09447.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 408

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 232/401 (57%), Positives = 292/401 (72%), Gaps = 1/401 (0%)

Query: 4   SEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR 63
             A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R
Sbjct: 5   ELAPSLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHR 64

Query: 64  KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT 123
            GSCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+T
Sbjct: 65  AGSCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQT 124

Query: 124 VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQ 183
           VKF+DLL+  ++LGAD LATGHYIRS      +   RR + RP D +RDQSYFLFATTQ+
Sbjct: 125 VKFADLLATAKELGADALATGHYIRSGRNPSPENPGRRALFRPADADRDQSYFLFATTQE 184

Query: 184 QLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEG 243
           Q+  LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G
Sbjct: 185 QIDYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDVITKLKPNAALAG 244

Query: 244 DIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +IVHL+G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+
Sbjct: 245 EIVHLDGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRV 304

Query: 304 YLREINWLGDG-LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASG 362
           YLR++NWLGD  L E A   GF C+ K+RS++ P P  +  +  G YVD    E G+A G
Sbjct: 305 YLRDVNWLGDETLAEAAAGKGFACYAKVRSTRAPAPAVLHIDATGTYVDLTVGEAGIAPG 364

Query: 363 QACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           QAC  Y++  + ARV GGG I  S+R  + E  L +++   
Sbjct: 365 QACALYSAPGDNARVFGGGFIERSEREPSAEACLKALLASP 405


>gi|319408925|emb|CBI82582.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella schoenbuchensis R1]
          Length = 409

 Score =  390 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 237/392 (60%), Positives = 292/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R GSCC
Sbjct: 3   LNSLDLPGQPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGVATHRVGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARR+ +T+N+ HYV DYEERFR AVI PF  SY  GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRIAETLNIPHYVLDYEERFREAVIDPFTESYTHGETPVPCVACNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR          R + RP+D ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSRSC-----GAHRALFRPLDAERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +ADK DSQDICFV QGKY DV+ ++       G I+H+
Sbjct: 178 RFPLGDLPKARVREIAAEMGFVVADKHDSQDICFVPQGKYSDVITKLRPESTNPGIIMHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NGQILG H+GIINYT+GQRRG+G+A GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 NGQILGEHSGIINYTVGQRRGIGIATGEALYVVYLDAENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++   +G    VKIRS++ P P  +   +    VD  +SE GVA GQACVFY
Sbjct: 298 NWLGDEQLDNFPPNGIDVVVKIRSTRPPRPARLHYQNGVFSVDLLESESGVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +SNEARVLGGG I+ S+RS   E  L  V+
Sbjct: 358 NENSNEARVLGGGFITHSERSAGAEAMLKQVL 389


>gi|241206171|ref|YP_002977267.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860061|gb|ACS57728.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 403

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 233/400 (58%), Positives = 292/400 (73%), Gaps = 1/400 (0%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
            A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R 
Sbjct: 1   MAPSLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRA 60

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           GSCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TV
Sbjct: 61  GSCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTV 120

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF+DLL+  ++LGAD LATGHYIRS      D   RR + RP D +RDQSYFLFATTQ+Q
Sbjct: 121 KFADLLATAKELGADALATGHYIRSGRNPSPDNPGRRALFRPADADRDQSYFLFATTQEQ 180

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           +  LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G+
Sbjct: 181 IDYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDVITKLKPNAALAGE 240

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IVHL+G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+Y
Sbjct: 241 IVHLDGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRVY 300

Query: 305 LREINWLGDG-LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQ 363
           LR++NWLGD  L E A   GF C+ K+RS++ P P  +  +  G YVD    E G+A GQ
Sbjct: 301 LRDVNWLGDETLAEAAAGKGFACYAKVRSTRAPAPAVLHIDAIGTYVDLTVGEAGIAPGQ 360

Query: 364 ACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           AC  Y++  + ARV GGG I  S+R  + E  L +++   
Sbjct: 361 ACALYSAPGDNARVFGGGFIERSEREPSAEACLKALLASP 400


>gi|306844591|ref|ZP_07477178.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO1]
 gi|306275035|gb|EFM56798.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO1]
          Length = 398

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 230/394 (58%), Positives = 290/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+DMRVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDMRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|307300497|ref|ZP_07580277.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|307318362|ref|ZP_07597797.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306896044|gb|EFN26795.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306904663|gb|EFN35247.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 398

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 234/381 (61%), Positives = 287/381 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  ++ + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAAGQGFECFAKVRSTRRPAPAVLKSDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKRS 389
           +    +ARV GGG I  S+R 
Sbjct: 361 SGTGEDARVYGGGFIRRSERE 381


>gi|217978097|ref|YP_002362244.1| tRNA-specific 2-thiouridylase MnmA [Methylocella silvestris BL2]
 gi|217503473|gb|ACK50882.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocella silvestris BL2]
          Length = 415

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 222/408 (54%), Positives = 279/408 (68%), Gaps = 8/408 (1%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
                  LNSL L K P   RVVVAMSGGVDSSVVAAL+K  GYDVI VT+QLY+  +A 
Sbjct: 11  AAEGRRELNSLGLPKPPAQTRVVVAMSGGVDSSVVAALMKEQGYDVIAVTMQLYDHGEAI 70

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
            RKG+CCAGQD+ DAR V   +++ HYV DYEERFR  VI PF+ SYA GETP+PCV CN
Sbjct: 71  HRKGACCAGQDIQDARLVAARLDIPHYVLDYEERFREKVINPFSHSYATGETPIPCVSCN 130

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
             +KF+DL      LGADVLATGHY+ +R     D    R++ R  D  RDQSYFLFATT
Sbjct: 131 SEIKFADLFDTALDLGADVLATGHYVSTR----SDEAGERVLHRAFDGARDQSYFLFATT 186

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           ++QL  LRFPLGDM K  VR LAR  GL +ADK+DSQDICFV +GKY D+++R++ G A+
Sbjct: 187 RRQLQMLRFPLGDMTKTDVRALARRFGLIVADKADSQDICFVPKGKYSDLIERLSPGAAV 246

Query: 242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESL 298
            G+IVH++G++LGRH G+I+YTIGQRRGLG+     GEPLFV+ LD   +RV+VGPRE+L
Sbjct: 247 PGEIVHIDGRVLGRHAGVIHYTIGQRRGLGLGDANAGEPLFVIKLDAAGARVVVGPREAL 306

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVG 358
              R +LR +NW+GDG   D   +G   FV++RS++ PV   +   D G +V+F   E  
Sbjct: 307 ATRRAHLRAVNWIGDGELGDLPREGADIFVQVRSTRPPVAGRLYARDGGAHVEFVHDEDS 366

Query: 359 VASGQACVFYTSDSNEARVLGGGIISGSKRS-DAVEESLLSVIGDEFP 405
           V+ GQACVFY SD   ARVLGGG IS ++ + D    +  +      P
Sbjct: 367 VSPGQACVFYASDQPRARVLGGGFISSTESAIDVCPATSRAAEAASVP 414


>gi|15966466|ref|NP_386819.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti 1021]
 gi|24638324|sp|Q92MB5|MNMA_RHIME RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|15075737|emb|CAC47292.1| Putative tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Sinorhizobium meliloti 1021]
          Length = 398

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 234/381 (61%), Positives = 287/381 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDSRSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  ++ + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAAGQGFECFAKVRSTRRPAPAVLKSDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKRS 389
           +    +ARV GGG I  S+R 
Sbjct: 361 SGTGEDARVYGGGFIRRSERE 381


>gi|254719618|ref|ZP_05181429.1| tRNA-specific 2-thiouridylase MnmA [Brucella sp. 83/13]
 gi|265984628|ref|ZP_06097363.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. 83/13]
 gi|306837544|ref|ZP_07470417.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella sp. NF 2653]
 gi|264663220|gb|EEZ33481.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. 83/13]
 gi|306407370|gb|EFM63576.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella sp. NF 2653]
          Length = 398

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 230/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQAARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F KIRS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKIRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|23502454|ref|NP_698581.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis 1330]
 gi|62290471|ref|YP_222264.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 1 str.
           9-941]
 gi|82700395|ref|YP_414969.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis biovar
           Abortus 2308]
 gi|148559837|ref|YP_001259458.1| tRNA-specific 2-thiouridylase MnmA [Brucella ovis ATCC 25840]
 gi|189024699|ref|YP_001935467.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus S19]
 gi|225628026|ref|ZP_03786062.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ceti str. Cudo]
 gi|225853065|ref|YP_002733298.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis ATCC 23457]
 gi|237815980|ref|ZP_04594977.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus str. 2308 A]
 gi|254689772|ref|ZP_05153026.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 6 str.
           870]
 gi|254694261|ref|ZP_05156089.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697916|ref|ZP_05159744.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254702309|ref|ZP_05164137.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis bv. 5 str. 513]
 gi|254704837|ref|ZP_05166665.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis bv. 3 str. 686]
 gi|254708251|ref|ZP_05170079.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis
           M163/99/10]
 gi|254710623|ref|ZP_05172434.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis B2/94]
 gi|254714807|ref|ZP_05176618.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M644/93/1]
 gi|254717867|ref|ZP_05179678.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M13/05/1]
 gi|254730806|ref|ZP_05189384.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 4 str.
           292]
 gi|256032116|ref|ZP_05445730.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis
           M292/94/1]
 gi|256061638|ref|ZP_05451777.1| tRNA-specific 2-thiouridylase MnmA [Brucella neotomae 5K33]
 gi|256114160|ref|ZP_05454914.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160312|ref|ZP_05458006.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M490/95/1]
 gi|256255517|ref|ZP_05461053.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti B1/94]
 gi|256258024|ref|ZP_05463560.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 9 str.
           C68]
 gi|256263452|ref|ZP_05465984.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370004|ref|YP_003107515.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella microti CCM 4915]
 gi|260169251|ref|ZP_05756062.1| tRNA-specific 2-thiouridylase MnmA [Brucella sp. F5/99]
 gi|260547004|ref|ZP_05822743.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus NCTC 8038]
 gi|260755305|ref|ZP_05867653.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 6 str.
           870]
 gi|260758526|ref|ZP_05870874.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 4 str.
           292]
 gi|260762350|ref|ZP_05874693.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884320|ref|ZP_05895934.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 9 str.
           C68]
 gi|261214569|ref|ZP_05928850.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219714|ref|ZP_05933995.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M13/05/1]
 gi|261222726|ref|ZP_05937007.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti B1/94]
 gi|261315753|ref|ZP_05954950.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M163/99/10]
 gi|261318196|ref|ZP_05957393.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis B2/94]
 gi|261322603|ref|ZP_05961800.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M644/93/1]
 gi|261325648|ref|ZP_05964845.1| tRNA-specific 2-thiouridylase mnmA [Brucella neotomae 5K33]
 gi|261752876|ref|ZP_05996585.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 5 str. 513]
 gi|261755533|ref|ZP_05999242.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 3 str. 686]
 gi|261758765|ref|ZP_06002474.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. F5/99]
 gi|265989227|ref|ZP_06101784.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M292/94/1]
 gi|265995479|ref|ZP_06108036.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998689|ref|ZP_06111246.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M490/95/1]
 gi|294852904|ref|ZP_06793577.1| tRNA methyl transferase [Brucella sp. NVSL 07-0026]
 gi|297248856|ref|ZP_06932574.1| tRNA methyl transferase [Brucella abortus bv. 5 str. B3196]
 gi|306843064|ref|ZP_07475687.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO2]
 gi|38258585|sp|Q8CY38|MNMA_BRUSU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71658011|sp|Q57BT1|MNMA_BRUAB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|123547133|sp|Q2YQB2|MNMA_BRUA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166234846|sp|A5VRW1|MNMA_BRUO2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|229486334|sp|B2S746|MNMA_BRUA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|254811446|sp|C0REM2|MNMA_BRUMB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|23348445|gb|AAN30496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis 1330]
 gi|62196603|gb|AAX74903.1| TrmU, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616496|emb|CAJ11563.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|148371094|gb|ABQ61073.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ovis ATCC 25840]
 gi|189020271|gb|ACD72993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus S19]
 gi|225617189|gb|EEH14235.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ceti str. Cudo]
 gi|225641430|gb|ACO01344.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis ATCC 23457]
 gi|237789278|gb|EEP63489.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus str. 2308 A]
 gi|256000167|gb|ACU48566.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella microti CCM 4915]
 gi|260096054|gb|EEW79931.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus NCTC 8038]
 gi|260668844|gb|EEX55784.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 4 str.
           292]
 gi|260672782|gb|EEX59603.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675413|gb|EEX62234.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 6 str.
           870]
 gi|260873848|gb|EEX80917.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 9 str.
           C68]
 gi|260916176|gb|EEX83037.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|260921310|gb|EEX87963.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti B1/94]
 gi|260924803|gb|EEX91371.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M13/05/1]
 gi|261295293|gb|EEX98789.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M644/93/1]
 gi|261297419|gb|EEY00916.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis B2/94]
 gi|261301628|gb|EEY05125.1| tRNA-specific 2-thiouridylase mnmA [Brucella neotomae 5K33]
 gi|261304779|gb|EEY08276.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M163/99/10]
 gi|261738749|gb|EEY26745.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. F5/99]
 gi|261742629|gb|EEY30555.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 5 str. 513]
 gi|261745286|gb|EEY33212.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 3 str. 686]
 gi|262553313|gb|EEZ09147.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M490/95/1]
 gi|262766592|gb|EEZ12381.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093459|gb|EEZ17509.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661424|gb|EEZ31685.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M292/94/1]
 gi|294821493|gb|EFG38492.1| tRNA methyl transferase [Brucella sp. NVSL 07-0026]
 gi|297176025|gb|EFH35372.1| tRNA methyl transferase [Brucella abortus bv. 5 str. B3196]
 gi|306286743|gb|EFM58293.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO2]
 gi|326409608|gb|ADZ66673.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis M28]
 gi|326539311|gb|ADZ87526.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis M5-90]
          Length = 398

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|150397798|ref|YP_001328265.1| tRNA-specific 2-thiouridylase MnmA [Sinorhizobium medicae WSM419]
 gi|205828972|sp|A6UCQ0|MNMA_SINMW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|150029313|gb|ABR61430.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 398

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 232/381 (60%), Positives = 286/381 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPMPRYPGQRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RV+VGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVVVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  +  + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAARSGFECFAKVRSTRRPAPAVLSCDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKRS 389
           +    +ARV GGG I  S+R 
Sbjct: 361 SGIGEDARVYGGGFIRRSERE 381


>gi|163843840|ref|YP_001628244.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis ATCC 23445]
 gi|189036219|sp|B0CI68|MNMA_BRUSI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|163674563|gb|ABY38674.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis ATCC 23445]
          Length = 398

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHSAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|110634566|ref|YP_674774.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium sp. BNC1]
 gi|123353475|sp|Q11G66|MNMA_MESSB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110285550|gb|ABG63609.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Chelativorans sp. BNC1]
          Length = 391

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 230/391 (58%), Positives = 284/391 (72%), Gaps = 5/391 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P+  RVVVAMSGGVDSSVVA LL R+GY+V+GVTLQLY+   A  R GSCC
Sbjct: 1   MNSLDLPGRPEATRVVVAMSGGVDSSVVAGLLAREGYEVVGVTLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ ++HYV DYEERFR AVI PFA SY  GETP+PCV CN+TVKFSD
Sbjct: 61  AGQDIDDARRVAETLGIAHYVLDYEERFRKAVIDPFAESYVTGETPIPCVACNQTVKFSD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLETARELGADALATGHYIRSRA-----NGAHRALYRPVDADRDQSYFLFATTQEQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR +A EMGL +A K DSQDICFV +GKY DV+ ++  G A  GDIVH+
Sbjct: 176 RFPLGGMSKPQVRAIAEEMGLSVAAKHDSQDICFVPRGKYSDVITKLKPGAASPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI++YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE  R+ LR++
Sbjct: 236 DGRVLGRHEGILHYTIGQRRGIGIAAGEPLYVVHLDAEHARVVVGPREALETRRLILRQV 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E+   +G   F K+RS++ P P  +   D   +V+  + E GVA GQACV Y
Sbjct: 296 NWLGDFPLEELPANGMDLFAKVRSTRPPTPATLHNRDGSTWVELHEGETGVAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSV 399
           + D N+ARV GGG I  S+R    E  L  +
Sbjct: 356 SDDRNDARVFGGGFIERSERCADAEALLSRL 386


>gi|24638328|sp|Q98HL0|MNMA_RHILO RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 396

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 231/395 (58%), Positives = 286/395 (72%), Gaps = 5/395 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G  R  + RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAHR-ALYRPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICFVPQGKYSDIIAKLKPAAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE H+IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDAERARVVVGPREALETHKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  ++       V+    E G+A GQACV Y
Sbjct: 296 NWLGDGPLGDIPEGGLELFAKVRSTRPPRPAVLRYVAGVTSVELADGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           + D NEARV GGG I  S+R    E  L  +    
Sbjct: 356 SDDGNEARVFGGGFIERSERGAEAEAMLTKLAARP 390


>gi|49475921|ref|YP_033962.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella henselae str. Houston-1]
 gi|81647713|sp|Q6G2J9|MNMA_BARHE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|49238729|emb|CAF27985.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella henselae str. Houston-1]
          Length = 409

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 224/392 (57%), Positives = 291/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDVIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPENSRIVVAMSGGVDSSVVAGLLKKEGYDVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DAR V +T+ + HYV DYEERFR AVI PFA+SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARCVAETLGIPHYVLDYEERFREAVIDPFAASYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+L AD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELDADALATGHYIRSR-----SHGAHRALFRPLDSDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +A+K DSQDICFV QGKY D++ ++       G IVH+
Sbjct: 178 RFPLGDLPKARVREMATEMGFVVANKHDSQDICFVPQGKYSDIITKLRPEAVNPGVIVHV 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LG+H+GI++YT+GQRRG+GVA GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGQVLGKHSGIVHYTVGQRRGIGVATGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++   DG +  VK+RS++ P    +   +    VDF + E  VA GQACVFY
Sbjct: 298 NWLGDERLDNFPPDGIEMAVKVRSTRPPHLARLHYQEGVFSVDFLECENSVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+ ARVLGGG ++ S+R+   E  L  V+
Sbjct: 358 DGNSDGARVLGGGFVTHSERAAETEMMLKRVL 389


>gi|161619531|ref|YP_001593418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella canis ATCC 23365]
 gi|260565920|ref|ZP_05836390.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 4 str. 40]
 gi|189036218|sp|A9M700|MNMA_BRUC2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161336342|gb|ABX62647.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella canis ATCC 23365]
 gi|260155438|gb|EEW90518.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 4 str. 40]
          Length = 398

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 228/394 (57%), Positives = 288/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL    +D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKSEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|17986711|ref|NP_539345.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|256045209|ref|ZP_05448107.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565193|ref|ZP_05835677.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|265991642|ref|ZP_06104199.1| tRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|24638318|sp|Q8YIL6|MNMA_BRUME RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|17982334|gb|AAL51609.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260151261|gb|EEW86355.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|263002426|gb|EEZ15001.1| tRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 398

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 228/394 (57%), Positives = 288/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN A V GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAACVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|260462497|ref|ZP_05810704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259031693|gb|EEW32962.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 396

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 230/395 (58%), Positives = 285/395 (72%), Gaps = 5/395 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G  R  + RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAHR-ALYRPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICFVPQGKYSDIIAKLKPSAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE  +IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDAERARVVVGPREALETRKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  ++       V+    E G+A GQACV Y
Sbjct: 296 NWLGDGQLTDIPAGGIELFAKVRSTRPPRPAVLRHEAGVTSVELADGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           + D NEARV GGG I  S+R    E  L  +    
Sbjct: 356 SDDGNEARVFGGGFIERSERGAEAEAMLSRLAAKP 390


>gi|319781789|ref|YP_004141265.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167677|gb|ADV11215.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 396

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 231/395 (58%), Positives = 288/395 (72%), Gaps = 5/395 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G +R  + RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAQR-ALYRPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLAVAAKQDSQDICFVPQGKYSDIIAKLKPTAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD + +RV+VGPRE+LE H+IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDADRARVVVGPREALETHKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  +       +V+    E G+A GQACV Y
Sbjct: 296 NWLGDGPLTDVPAGGLELFAKVRSTRPPRPAVLHHRAGATWVELVDGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           + D NEARV GGG I  S+R    E  L  +    
Sbjct: 356 SDDGNEARVFGGGFIERSERGAEAEAMLTRLAARP 390


>gi|121602707|ref|YP_989294.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella bacilliformis KC583]
 gi|166234845|sp|A1UTJ1|MNMA_BARBK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|120614884|gb|ABM45485.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella bacilliformis KC583]
          Length = 391

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 234/392 (59%), Positives = 290/392 (73%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGPPENSRVVVAMSGGVDSSVVAGLLKREGYDVVGITLQLYDHGAATHRAGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + +YV DYE RFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLRIPYYVLDYESRFREAVIDPFAESYARGETPIPCVACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGAD LATGHYIRS  Y        R + RP+D ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLVTARELGADALATGHYIRSVSY-----GTHRALFRPLDSERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K  VR++A+EMGL +ADK DSQDICFV QGKY DV+ ++    +  GDIVH+
Sbjct: 178 RFPLGNLPKARVREIAKEMGLTVADKHDSQDICFVPQGKYSDVIAKLRPEASNPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NGQILG+H+GIINYT+GQRRG+GVA GE L+V++LD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 NGQILGQHSGIINYTVGQRRGIGVATGEALYVIFLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E+   D      KIRS++ P P  +   +    VD  + E  VA GQACVFY
Sbjct: 298 NWLGDERLENFPSDCIDVAAKIRSTRPPRPARLYYKEGIFSVDLLEGESSVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
               + ARVLGGG I+ S+RS   EE L  V+
Sbjct: 358 NESGDGARVLGGGFITHSERSTDAEERLQRVL 389


>gi|227823283|ref|YP_002827255.1| tRNA-specific 2-thiouridylase MnmA [Sinorhizobium fredii NGR234]
 gi|254811457|sp|C3MI00|MNMA_RHISN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|227342284|gb|ACP26502.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium fredii NGR234]
          Length = 398

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 233/380 (61%), Positives = 287/380 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR       + +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYQGQRALYRPTDAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGNLSKPETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALGGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGTHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   + A   GF CF K+RS++ P P  ++ + DG+YV+    E GVA GQAC  Y
Sbjct: 301 NWLGDEEIDAAASRGFACFAKVRSTRQPAPAEMKCDADGIYVELVDGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKR 388
           +    +ARV GGG I  S+R
Sbjct: 361 SGTGEDARVYGGGFIRKSER 380


>gi|90419040|ref|ZP_01226951.1| tRNA methyl transferase
           ((5-methylaminomethyl-2-thiouridylate)-
           methyltransferase) [Aurantimonas manganoxydans SI85-9A1]
 gi|90337120|gb|EAS50825.1| tRNA methyl transferase
           ((5-methylaminomethyl-2-thiouridylate)-
           methyltransferase) [Aurantimonas manganoxydans SI85-9A1]
          Length = 425

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 216/400 (54%), Positives = 280/400 (70%), Gaps = 5/400 (1%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
           + E    NSLDL K P D RVVVAMSGGVDSSVVAA+LK  GYDV+G+TLQLY++ + ++
Sbjct: 31  LPEWPMSNSLDLPKPPADTRVVVAMSGGVDSSVVAAILKEQGYDVVGITLQLYDAGEGAR 90

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
           R GSCCAGQD++DARRV +T+ + HYV DYE+RFR AVI PFA+SY AGETP+PCV CN+
Sbjct: 91  RAGSCCAGQDIHDARRVAETLGIHHYVLDYEDRFRKAVINPFAASYLAGETPIPCVACNQ 150

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
           TVKF DLL+  + LGAD LATGHYI SR          R + RP DL+RDQSYFL+ TTQ
Sbjct: 151 TVKFRDLLATAQDLGADALATGHYIESRQ-----NGAHRSLYRPADLDRDQSYFLYGTTQ 205

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           +QL  LRFPLG + K   R+LA   GL +A K DSQDICFV +G+Y DV++++    +  
Sbjct: 206 EQLDFLRFPLGGLTKPQTRELAERHGLVVAAKPDSQDICFVAKGRYSDVIRKLRPEASEP 265

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           GDIVHL+G+ LGRH GI++YTIGQRRGLG+A  +PL+VV LD  +++V+VGPRE+L   R
Sbjct: 266 GDIVHLDGRHLGRHAGIVHYTIGQRRGLGIAAADPLYVVALDPATAQVVVGPREALATRR 325

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASG 362
           + LR++NWLG     D      + FV++RS++ P P  +Q  +    V+    E GVA G
Sbjct: 326 LTLRDVNWLGRTDPADMAAADEEIFVRVRSTRPPAPARIQVENGVWTVELASGEDGVAPG 385

Query: 363 QACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           QACVFY  +   A VLGGG+IS + R    + +   +  +
Sbjct: 386 QACVFYRGEGVGAEVLGGGVISVTDRPQRAQRAAPVLAAE 425


>gi|304394517|ref|ZP_07376438.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ahrensia sp. R2A130]
 gi|303293427|gb|EFL87806.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ahrensia sp. R2A130]
          Length = 406

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 213/397 (53%), Positives = 284/397 (71%), Gaps = 4/397 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL  DK P D RVVVAMSGGVDSSVVA LLK  GY+V+G+TLQLY+   A ++KG+CC
Sbjct: 3   LNSLGFDKAPADTRVVVAMSGGVDSSVVACLLKEQGYEVLGMTLQLYDHGAAVQKKGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + +   HYV DYE++FR  VI PFA +Y  GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIHDARRVSEQMGFPHYVLDYEQKFREQVIDPFAKAYINGETPIPCVACNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGK-RRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           LL+  R+LGAD LATGHY       GDDG  + R + RP D ++DQSYFLFATTQ+QL  
Sbjct: 123 LLTTARELGADCLATGHY--IISKPGDDGPLKNRQLFRPADADKDQSYFLFATTQEQLDF 180

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLGD+ K   R++A+EM L +A+KSDSQDICFV QGKY D++ +I     + GDIVH
Sbjct: 181 LRFPLGDVPKSRTREMAQEMDLIVAEKSDSQDICFVPQGKYADIIAKIRPDAGVAGDIVH 240

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           L+G++LGRH+GI N+TIGQRRG+G+A G+P++V+ +D  ++ V VGPRE+L   RI LR+
Sbjct: 241 LDGRVLGRHDGIFNFTIGQRRGIGIATGDPVYVISIDAKTATVTVGPREALATRRIALRD 300

Query: 308 INWLGDGLFEDAV-VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           +NWLGD   EDAV  +G    V++RS++ P P  +   D   ++     E G++ GQACV
Sbjct: 301 VNWLGDETLEDAVSEEGIDLHVRVRSTRPPRPARLTLEDGTAFITLTDGEDGISPGQACV 360

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           FY  ++ + RVLGGG I+ +  +    ++ ++    +
Sbjct: 361 FYVDENPQTRVLGGGWIAKTWSAAGAVDAAVTAPPSQ 397


>gi|319406809|emb|CBI80442.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella sp. 1-1C]
          Length = 409

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 229/392 (58%), Positives = 296/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +PK+ RVVVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPKNSRVVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVSCNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR++        R + R +D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLTTAYELGADALATGHYIRSRVH-----GAHRALFRSLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY D++ ++    A  G IVH+
Sbjct: 178 RFPLGDLSKERVREIATEMGLVVANKHDSQDICFVPQGKYSDIITKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYTIGQRRG+GV+ GE L+V+YLD  ++ VIVGPRE LE  +++LR++
Sbjct: 238 DGQILGEHSGIVNYTIGQRRGIGVSTGEALYVIYLDVENACVIVGPREMLETRKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG +  VK+RS++ P    +       +VD  +SE GVA GQACV Y
Sbjct: 298 NWLGDEQLDNFPLDGIEVAVKVRSTRPPRSARLHYKQGSFFVDLLESESGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+EAR+LGGG I+ ++R+   E+ L  V+
Sbjct: 358 NDNSHEARILGGGFITCAERAADTEKMLKRVL 389


>gi|319403803|emb|CBI77387.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 409

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 228/392 (58%), Positives = 295/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +PK+ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPKNSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVSCNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR +        R + R +D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLTTAYELGADALATGHYIRSRAH-----GAHRALFRSLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY D++ ++    A  G IVH+
Sbjct: 178 RFPLGDLSKERVREIATEMGLVVANKHDSQDICFVPQGKYSDIITKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYTIGQRRG+GV+ GE L+V+YLD  ++ VIVGPRE LE  +++LR++
Sbjct: 238 DGQILGEHSGIVNYTIGQRRGIGVSTGEALYVIYLDVENACVIVGPREMLETRKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG +  VK+RS++ P    +       +VD  +SE GVA GQACV Y
Sbjct: 298 NWLGDEQLDNFPLDGIEVAVKVRSTRPPRSARLHYKQGSFFVDLLESESGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+EAR+LGGG I+ ++R+   E+ L  V+
Sbjct: 358 NDNSHEARILGGGFITCAERAADTEKMLKKVL 389


>gi|85713551|ref|ZP_01044541.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter sp. Nb-311A]
 gi|85699455|gb|EAQ37322.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter sp. Nb-311A]
          Length = 433

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 218/403 (54%), Positives = 284/403 (70%), Gaps = 5/403 (1%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           + LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+
Sbjct: 33  SMLNSLDLEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGA 92

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD++DAR V + + V HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF
Sbjct: 93  CCAGQDIHDARNVAERLGVPHYVLDYESRFRETVIENFADSYASGETPVPCIECNRLVKF 152

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL+  R+LGA  LATGHY+ SR   G      R +    D +RDQSYFLFATT++QL 
Sbjct: 153 RDLLATARELGAAALATGHYVASRRSPG----GSRTLLCAADADRDQSYFLFATTREQLD 208

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLGDM K   R+LAR  GL +ADK DSQDICFV  G Y D++ ++     L GDIV
Sbjct: 209 FLRFPLGDMTKAQTRELARRFGLPVADKHDSQDICFVPTGHYTDIISQLKPNAMLSGDIV 268

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            L+G+++G H GI+N+T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR
Sbjct: 269 DLDGRVIGHHEGIVNFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIVLR 328

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++NW+GDG  + A+  G + FV++RS++ P P +++  D G  V+    E GV+ GQACV
Sbjct: 329 DVNWIGDGALDLAIGAGLELFVRVRSTRKPQPAWLRVVDGGYEVELVAGEEGVSPGQACV 388

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVE-ESLLSVIGDEFPYKM 408
           FY     +ARVLGGG I+ +    A E  +  S     F  ++
Sbjct: 389 FYDGPEGQARVLGGGFIARAMAQRANEGAARNSTPAQSFAAEL 431


>gi|307944132|ref|ZP_07659473.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseibium sp. TrichSKD4]
 gi|307772478|gb|EFO31698.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseibium sp. TrichSKD4]
          Length = 390

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 218/382 (57%), Positives = 275/382 (71%), Gaps = 7/382 (1%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           NSLDL   P+D RVVVAMSGGVDSSVVAAL+K +GYDVIGVTLQLY+   A  R  SCCA
Sbjct: 3   NSLDLPGRPEDTRVVVAMSGGVDSSVVAALMKEEGYDVIGVTLQLYDHGAAVSRAKSCCA 62

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           G D++DARR  + I + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+DL
Sbjct: 63  GVDIHDARRAAEKIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTDL 122

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   + LGADVLATGHY+RSR     DG +R  + RP+DL+RDQSYFLFATTQ+QL  +R
Sbjct: 123 LKTAKDLGADVLATGHYVRSRP----DGNKR-ALFRPVDLDRDQSYFLFATTQEQLDFIR 177

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG   K  VR LA + GL +A+K DSQDICFV  G Y +V++++    A  GDIVH++
Sbjct: 178 FPLGGRPKSEVRQLAEKFGLSVANKPDSQDICFVPNGDYTEVIRKLRPNAAEPGDIVHMD 237

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG+H G+I+YT+GQRRGLGVA GEPL+VV LD +  RV+VGPRE+L  + I LRE+N
Sbjct: 238 GRVLGQHEGVIHYTVGQRRGLGVATGEPLYVVRLDADEKRVVVGPREALTTNTIILREVN 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           WLGD   ++        F K+RS++ P P  ++   +   V+    E GVA GQACVF+ 
Sbjct: 298 WLGDMPLDEGA--ELDLFAKVRSTRPPAPAILRHTAEKTTVELVTGEAGVAPGQACVFFD 355

Query: 370 SDSNEARVLGGGIISGSKRSDA 391
           S+   ARVLGGG I+ ++RS A
Sbjct: 356 SEDETARVLGGGWIARTERSGA 377


>gi|295399328|ref|ZP_06809310.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978794|gb|EFG54390.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus thermoglucosidasius C56-YS93]
          Length = 371

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/382 (37%), Positives = 204/382 (53%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKPPKDTRVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       + R +D ++DQ+YFL    Q+QL  + FPLG
Sbjct: 118 LSIGADYVATGHYARIEYRDGE-----YKLLRGVDQKKDQTYFLNQLGQEQLSKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A++ GL  A K DS  ICF+ +  +   +       A  G +  L+G++ 
Sbjct: 173 HLEKAQVRQIAKDAGLATATKKDSTGICFIGERDFKKFLSSYLP--AQPGIMQTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  +   + + V      E L    +    +N
Sbjct: 231 GKHDGVMYYTIGQRHGLGIGGNGEPWFVVGKNVKENILYVAQGFNNEYLYSTSLIATNVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ D          F+C  K R  Q  + V V   +DD V V F++    V  GQA VFY
Sbjct: 291 WVSDR----KPPKSFRCTAKFRYRQPDIGVTVHVMDDDKVEVIFDEPVRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDKVFRNG 364


>gi|312110111|ref|YP_003988427.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. Y4.1MC1]
 gi|311215212|gb|ADP73816.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. Y4.1MC1]
          Length = 371

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/382 (37%), Positives = 204/382 (53%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKPPKDTRVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       + R +D ++DQ+YFL    Q+QL  + FPLG
Sbjct: 118 LSIGADYVATGHYARIEYRDGE-----YKLLRGVDQKKDQTYFLNQLGQEQLSKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A++ GL  A K DS  ICF+ +  +   +       A  G +  L+G++ 
Sbjct: 173 HLEKAQVRQIAKDAGLATATKKDSTGICFIGERDFKKFLSSYLP--AQPGIMQTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  +   + + V      E L    +    +N
Sbjct: 231 GKHDGVMYYTIGQRHGLGIGGNGEPWFVVGKNVKENILYVAQGFNNEYLYSTSLIATNVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ D          F+C  K R  Q  + V V   +DD V V F++    V  GQA VFY
Sbjct: 291 WVSDR----KPPKSFRCTAKFRYRQPDIGVTVHVMDDDKVEVVFDEPVRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDKVFRNG 364


>gi|319405239|emb|CBI78844.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella sp. AR 15-3]
          Length = 409

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 230/393 (58%), Positives = 293/393 (74%), Gaps = 5/393 (1%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           RLNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+C
Sbjct: 2   RLNSLDLPGYPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGAC 61

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           CAGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKF+
Sbjct: 62  CAGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVACNQTVKFA 121

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+   +LGAD LATGHYIRSRL+        R + R +D +RDQSYFLFATTQ+Q+  
Sbjct: 122 DLLTTAYELGADALATGHYIRSRLH-----GAHRALFRSLDADRDQSYFLFATTQEQIDY 176

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY DV+ ++    A  G IVH
Sbjct: 177 LRFPLGDLSKEHVREIAAEMGLVVANKHDSQDICFVPQGKYSDVITKLRPEAANPGVIVH 236

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           ++GQILG H+GI+NYT+GQRRG+GVA GE L+V+YLD  ++ VIVGPRE LE  +++LR+
Sbjct: 237 IDGQILGEHSGIVNYTVGQRRGIGVATGEALYVIYLDVENACVIVGPREMLETRKLFLRD 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +NWLGD   ++  +DG    VK+RS+  P    +       +VD  +SE GVA GQACV 
Sbjct: 297 VNWLGDEQLDNFPLDGIDVAVKVRSTCPPRSARLHYKQGLFFVDLLESESGVAPGQACVL 356

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y   S+EARVLGGG I+ ++R+   E+ L  V+
Sbjct: 357 YNDSSHEARVLGGGFITCAERAADTEKMLKRVL 389


>gi|163868748|ref|YP_001609965.1| tRNA-specific 2-thiouridylase MnmA [Bartonella tribocorum CIP
           105476]
 gi|205812594|sp|A9IWH0|MNMA_BART1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161018412|emb|CAK01970.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella tribocorum CIP 105476]
          Length = 407

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 225/392 (57%), Positives = 292/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D R+VVAMSGGVDSSVVA LLKR+GY+VIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPEDSRIVVAMSGGVDSSVVAGLLKREGYNVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV + + + HYV DYE+RFR AVI PFA SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAEMLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSR-----SHGAHRALFRPLDNDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMGL +A+K DSQDICFV QGKY DV+ ++    A  G IVH+
Sbjct: 178 RFPLGDLPKARVREIAAEMGLVVANKHDSQDICFVPQGKYSDVIAKLRPEAANPGFIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ILG+H+GI+NYT+GQRRG+GV+ GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGKILGKHSGIVNYTVGQRRGIGVSTGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++    G +  VK+RS++ P    +   +    VD  + E GVA GQACV Y
Sbjct: 298 NWLGDESLDNFPSQGIEVAVKVRSTRPPHLACLHYKEGVFSVDLLECENGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             + +EAR+LGGG ++ S+R+  +E  L  V+
Sbjct: 358 DGNGHEARILGGGFVTHSERAADIEVMLKRVL 389


>gi|240850925|ref|YP_002972325.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella grahamii as4aup]
 gi|240268048|gb|ACS51636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella grahamii as4aup]
          Length = 409

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/392 (57%), Positives = 290/392 (73%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D R+VVAMSGGVDSSVVA LLK++GY+VIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPEDSRIVVAMSGGVDSSVVAGLLKKEGYNVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYE+RFR AVI PFA SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSR-----SHGAHRALFRPLDNDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +A+K DSQDICFV QGKY DV+ ++    A  G IVH+
Sbjct: 178 RFPLGDLPKARVREMAAEMGFVVANKHDSQDICFVPQGKYSDVIAKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ILG+H+GI+NYT+GQRRG+GV+ GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGKILGKHSGIVNYTVGQRRGIGVSTGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   +     G +  VK+RS++ P    +   +    VD  + E GVA GQACV Y
Sbjct: 298 NWLGDESLDKFPSQGIEVAVKVRSTRPPHLARLHYKEGIFSVDLLECENGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             + +EAR+LGGG ++ S+R+   E  L  V+
Sbjct: 358 DGNGHEARILGGGFVTHSERAADTEMMLKRVL 389


>gi|328542757|ref|YP_004302866.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Polymorphum gilvum SL003B-26A1]
 gi|326412503|gb|ADZ69566.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Polymorphum gilvum SL003B-26A1]
          Length = 393

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 226/381 (59%), Positives = 279/381 (73%), Gaps = 8/381 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL + P+D RVVVAMSGGVDSSVVA L+K++GYDV+GVTLQLY+   A +R G+CC
Sbjct: 2   LNSLDLPRRPQDTRVVVAMSGGVDSSVVAGLMKQEGYDVVGVTLQLYDHGAAVQRAGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + + + HYV DYE RF+ AVI  FA SY AGETP+PCV CN+TVKFSD
Sbjct: 62  AGQDIHDARRVAERLGIPHYVLDYERRFKEAVIDRFAESYMAGETPIPCVACNQTVKFSD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGADVLATGHY+RS          RR + RP DL+RDQSYFLFATTQ+QL  L
Sbjct: 122 LLETARTLGADVLATGHYVRSAPA-----GNRRALYRPADLDRDQSYFLFATTQEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG   K  VR LAR  GL +ADK DSQDICFV +G+Y DV+ R+    A  GDIVH+
Sbjct: 177 RFPLGGRPKAEVRALARRFGLAVADKQDSQDICFVPKGRYADVIARLRPDAAEPGDIVHV 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH+GII+YT+GQRRGLG+A GEPL+VV LD  + RV+VGPR++L   R+ LR++
Sbjct: 237 DGRVLGRHDGIIHYTVGQRRGLGIAAGEPLYVVRLDAAARRVVVGPRDALATRRLSLRDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVF 367
           NWLG    +         F K+RS++ PVP  + R+ DG + V+    E GVA GQACVF
Sbjct: 297 NWLGAEPLD--PGAPVALFAKVRSTRPPVPAVLTRHADGAIEVELADGETGVAPGQACVF 354

Query: 368 YTSDSNEARVLGGGIISGSKR 388
           Y +D  EARVLGGG I+ +  
Sbjct: 355 YDADGAEARVLGGGWIARAVP 375


>gi|319898474|ref|YP_004158567.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella clarridgeiae 73]
 gi|319402438|emb|CBI75979.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella clarridgeiae 73]
          Length = 409

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 228/392 (58%), Positives = 296/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPVPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR++        R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATAYELGADALATGHYIRSRVH-----GAHRALFRPLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K+ VR++A EMGL +A+K DSQDICFV QG+Y DV+ ++   +A  G IVH+
Sbjct: 178 RFPLGDLSKDRVREIATEMGLVVANKHDSQDICFVPQGRYSDVITKLRPEVANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYT+GQRRG+GVA GE L+V+YLD  ++RVIVGPRE LE  R++LR++
Sbjct: 238 DGQILGEHSGIVNYTVGQRRGIGVATGEALYVIYLDVENARVIVGPREMLETRRLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG    VK+RS++ P P  +        VD  +SE G+A GQACV Y
Sbjct: 298 NWLGDERLDNFPLDGIDVAVKVRSTRPPRPARLHYKQGLFSVDLLESESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S EAR+LGGG I+ S+ +   E+ L  V+
Sbjct: 358 NENSYEARILGGGFITRSEHAADTEKMLKQVL 389


>gi|49474501|ref|YP_032543.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella quintana str. Toulouse]
 gi|81646912|sp|Q6FZ46|MNMA_BARQU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|49240005|emb|CAF26420.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella quintana str. Toulouse]
          Length = 408

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 228/395 (57%), Positives = 292/395 (73%), Gaps = 5/395 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P + R+VVAMSGGVDSSVVA LLK++GYDVIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPDNSRIVVAMSGGVDSSVVAGLLKKEGYDVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYE+RFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCVACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR +        R + RP D+ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSRPH-----GAHRALFRPFDVERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +ADK DSQDICFV QGKY DV+ ++       G IVH+
Sbjct: 178 RFPLGDLPKAHVREIATEMGFVVADKHDSQDICFVPQGKYSDVITKLRPEAVNPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LG+H+GI+NYT+GQRRG+GVA GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGQVLGKHSGIVNYTVGQRRGIGVATGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++   DG +  VK+RS++      +   +    VDF + E  VA GQACVFY
Sbjct: 298 NWLGDERLDNFPSDGLEMAVKVRSTRPSHLARLHYQEGVFSVDFLECENSVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
             + + AR+LGGG ++ S+R+  VE  L  V+ + 
Sbjct: 358 DGNGDGARILGGGFVTHSQRAVGVEMMLRRVLCNP 392


>gi|75674801|ref|YP_317222.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter winogradskyi Nb-255]
 gi|123614062|sp|Q3SV21|MNMA_NITWN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|74419671|gb|ABA03870.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 400

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 214/401 (53%), Positives = 282/401 (70%), Gaps = 5/401 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V   + V HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF D
Sbjct: 62  AGQDIHDARNVAARLGVPHYVLDYESRFRETVIENFADSYASGETPVPCIECNRQVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGAAALATGHYVSSRRLAD----GSRALLCAADTDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K+  R+LAR  GL +ADK DSQDICFV  G+Y D++ R+     + GDIV L
Sbjct: 178 RFPLGDMTKQQTRELARRFGLSVADKHDSQDICFVPTGRYTDIISRLKPNAMVSGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G ++G H GI+++T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGHVIGHHEGIVHFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + A+  G + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAIGAGLELFVRVRSTRRPQPAWLRVVDGRYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLS-VIGDEFPYKM 408
                ++RVLGGG I+ +    A E +  S  +   F  ++
Sbjct: 358 DGAEGQSRVLGGGFIARAMAQRANEAAAQSGTLAQSFAAEL 398


>gi|146342725|ref|YP_001207773.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium sp. ORS278]
 gi|205811327|sp|A4Z082|MNMA_BRASO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146195531|emb|CAL79558.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bradyrhizobium sp. ORS278]
          Length = 397

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 218/390 (55%), Positives = 278/390 (71%), Gaps = 4/390 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPEDTRVVVAMSGGVDSSVTAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE+RFR +VI  FA+SYA+GETP+PC++CNR +KF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYEDRFRESVIDNFAASYASGETPVPCIECNRAIKFGD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA VLATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLKTARELGASVLATGHYVASRRLPD----GSRALTCAADADRDQSYFLFATTREQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K  VR+LAR   L++ADK DSQDICFV  G+Y D++ ++       G+IV L
Sbjct: 178 RFPLGDMTKPEVRELARRFELEVADKHDSQDICFVPTGRYTDIIGKLRPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI NYTIGQR+GLG+A G PL+VV LD  + RV+VGPRE+L  HRI LRE+
Sbjct: 238 NGRVLGAHQGIANYTIGQRKGLGIAAGAPLYVVKLDVTTRRVVVGPREALRTHRITLREV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDAAVRDGLELFVRVRSTRAPQPAWLRGADGSYEVELVGGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLS 398
            + S  ARVLGGG I  +    +    L+ 
Sbjct: 358 DAASGRARVLGGGFIQSAVAESSATAGLVR 387


>gi|239827834|ref|YP_002950458.1| tRNA-specific 2-thiouridylase MnmA [Geobacillus sp. WCH70]
 gi|239808127|gb|ACS25192.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. WCH70]
          Length = 371

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/382 (36%), Positives = 202/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPKDTRVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       M R +D  +DQ+YFL    Q  L  + FP+G
Sbjct: 118 LSIGADYVATGHYARVEYRDGE-----YKMLRGVDQNKDQTYFLNQLGQSVLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A++ GL  A K DS  ICF+ +  + + +       A  G +  L+G++ 
Sbjct: 173 HLEKAQVRQIAKDAGLVTATKKDSTGICFIGERDFKEFLSNYLP--AKPGIMQTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  +   + + V      E L    +    +N
Sbjct: 231 GKHDGVMYYTIGQRHGLGIGGSGEPWFVVGKNVKENILYVAQGFNNEYLYSTSLIATNVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFY 368
           W+ D        + F+C  K R  Q    V V   +DD V V F++    V  GQA VFY
Sbjct: 291 WVSDR----KPTNSFQCTAKFRYRQPDTGVTVHIIDDDKVEVVFDEPVRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDEVFRNG 364


>gi|148253403|ref|YP_001237988.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium sp. BTAi1]
 gi|205811320|sp|A5ED38|MNMA_BRASB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146405576|gb|ABQ34082.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bradyrhizobium sp. BTAi1]
          Length = 397

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 218/378 (57%), Positives = 278/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPEDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE+RFR +VI  FA+SYA+GETP+PC++CNR +KF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYEDRFRESVIDNFAASYASGETPVPCIECNRAIKFGD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA VLATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLKTARELGASVLATGHYVASRRLAD----GSRALVCAADADRDQSYFLFATTREQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K  VR+LAR  GL++ADK DSQDICFV  G+Y D++ ++       G+IV L
Sbjct: 178 RFPLGDMTKPEVRELARRFGLEVADKHDSQDICFVPTGRYTDIIGKLRPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI NYTIGQR+GLG+A G PL+VV LD  + RV+VGPRE+L  HRI LRE+
Sbjct: 238 NGRVLGAHQGIANYTIGQRKGLGIAAGAPLYVVKLDVATRRVVVGPREALRTHRITLREV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG+ + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGVLDAAVRDGLELFVRVRSTRPPQPAWLRGADGQYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            + S  ARVLGGG I  +
Sbjct: 358 DAASGRARVLGGGFIQSA 375


>gi|92116313|ref|YP_576042.1| tRNA-specific 2-thiouridylase MnmA [Nitrobacter hamburgensis X14]
 gi|122418585|sp|Q1QQB5|MNMA_NITHX RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|91799207|gb|ABE61582.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 400

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 209/389 (53%), Positives = 280/389 (71%), Gaps = 6/389 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL+L+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLELEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYENRFRETVIENFADSYASGETPVPCIECNRLVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ S    G      R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGAAALATGHYVASHRMAG----GSRALLCAADADRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y D++ ++     + GDIV L
Sbjct: 178 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPTGRYTDIISQLKPNAMVSGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G ++G H+GI+++T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGHVIGHHDGIVHFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIILRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV  G + FV++RS++ P P +++  D    ++    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAVGAGLELFVRVRSTRKPQPAWLRAIDGRYEIELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISG--SKRSDAVEES 395
                +ARVLGGG I+   ++R++ +   
Sbjct: 358 DGLEGQARVLGGGFIARAMARRANEIAAQ 386


>gi|149376379|ref|ZP_01894142.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marinobacter algicola DG893]
 gi|149359393|gb|EDM47854.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marinobacter algicola DG893]
          Length = 386

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 131/390 (33%), Positives = 201/390 (51%), Gaps = 23/390 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K P++ RV+V MSGGVDSSV A LLK  GY V G+ ++ ++    ++    C A  D+
Sbjct: 1   MTKAPENTRVIVGMSGGVDSSVAAWLLKDQGYQVEGLFMKNWDEDDGTE---YCTAMTDL 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            DAR V +TI ++ +   +   + + V   F S Y AG TP P + CN+ VKF   L   
Sbjct: 58  ADARAVAETIGITLHTASFAAEYWDRVFEHFLSEYKAGRTPNPDILCNKEVKFRAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R R    DDG     + + +D  +DQSYFL A + +++    FP+G
Sbjct: 118 ITLGADYIATGHYTRQRPL--DDGSGGAELLKGLDPNKDQSYFLHAVSGERIARTLFPVG 175

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR +A E G    DK DS  ICF+ + K+ D +K+     A  G+I   +GQ++
Sbjct: 176 ELEKPEVRRIAAEQGFITHDKKDSTGICFIGERKFRDFLKQYIP--AQPGNIETPDGQVI 233

Query: 254 GRHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYL 305
           GRH G++ +TIGQR+GLG+        EP +V   D + + ++    +         +  
Sbjct: 234 GRHQGLMYHTIGQRQGLGIGGLSEFGDEPWYVAEKDLSRNVLVAVQGKHHPLLFSRGLIS 293

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             ++W+      +A    F+C  K R  Q      V    +G  V F+ ++  V  GQ+ 
Sbjct: 294 GPVDWIAG----EAPAAEFRCKAKTRYRQPDQDCTVTVLGNGFRVVFDDAQRAVTPGQSV 349

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAVEES 395
           VFY  +      LGGG+I  + R      +
Sbjct: 350 VFYRDEV----CLGGGVIEQTWRDGEQAPT 375


>gi|261418420|ref|YP_003252102.1| tRNA-specific 2-thiouridylase MnmA [Geobacillus sp. Y412MC61]
 gi|319767620|ref|YP_004133121.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. Y412MC52]
 gi|261374877|gb|ACX77620.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. Y412MC61]
 gi|317112486|gb|ADU94978.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. Y412MC52]
          Length = 371

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/382 (37%), Positives = 201/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPHETRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       M R  D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MSIGADYIATGHYARVEFRDGE-----YKMLRGADPNKDQTYFLNQLGQAQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A+E GL  A K DS  ICF+ +  + + +       A  G +  L+G++ 
Sbjct: 173 HLQKADVRRIAKEAGLATAGKKDSTGICFIGERDFKEFLSHYLP--AQPGVMKTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +   ++N
Sbjct: 231 GRHDGVMYYTIGQRHGLGIGGSGEPWFVVGKDVRENVLYVAQGFENEYLYSTSLKAVDVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFY 368
           W+ D   E      F+C  K R  Q  V V V    D GV V F+     V  GQA VFY
Sbjct: 291 WVSDRKPE----APFRCTAKFRYRQPDVGVTVHPLADGGVEVVFDAPARAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDEVFRNG 364


>gi|56421098|ref|YP_148416.1| tRNA-specific 2-thiouridylase MnmA [Geobacillus kaustophilus
           HTA426]
 gi|81557817|sp|Q5KWT8|MNMA2_GEOKA RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|56380940|dbj|BAD76848.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Geobacillus kaustophilus HTA426]
          Length = 371

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/382 (37%), Positives = 200/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPHETRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       M R  D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MSIGADYIATGHYARVEFRDGE-----YKMLRGADPNKDQTYFLNQLGQAQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A+E GL  A K DS  ICF+ +  + + +       A  G +  L+G++ 
Sbjct: 173 HLQKADVRRIAKEAGLATAGKKDSTGICFIGERDFKEFLSHYLP--AQPGVMKTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +   ++N
Sbjct: 231 GRHDGVMYYTIGQRHGLGIGGSGEPWFVVGKDVRENVLYVAQGFENEYLYSTSLKAVDVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFY 368
           W+ D   E      F+C  K R  Q  V V V    D G  V F+     V  GQA VFY
Sbjct: 291 WVSDRKPE----APFRCTAKFRYRQPDVGVTVHPLADGGAEVVFDAPARAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDEVFRNG 364


>gi|89100972|ref|ZP_01173817.1| TrmU [Bacillus sp. NRRL B-14911]
 gi|89084308|gb|EAR63464.1| TrmU [Bacillus sp. NRRL B-14911]
          Length = 370

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/383 (36%), Positives = 202/383 (52%), Gaps = 24/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K+PKD RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MAKSPKDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R        G+    M R +D  +DQ+YFL   T++QL  + FP+G
Sbjct: 118 MSLGADYLATGHYARVEH-----GENGVKMLRGLDENKDQTYFLNQLTEEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A++ GL  A K DS  ICF+ +  + + +       A  G +  + G+ +
Sbjct: 173 SIEKSEVREIAKKAGLATAAKKDSTGICFIGERNFKEFLGNYLP--AQPGSMETMEGETV 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   G+P FV+  D   + + V      E L    I   +++
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGAGDPWFVIGKDLKRNVLYVGQGFDNEKLYSDSIIADKVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+       A  + F+C  K R  Q    V V   ++G   + F      V  GQA VFY
Sbjct: 291 WVS-----KAPGETFECTAKFRYRQPDNSVTVTLLENGQAKITFHSPIRAVTPGQAVVFY 345

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             +      LGGG I     ++ 
Sbjct: 346 DGEV----CLGGGTIDRVFNNEQ 364


>gi|297529272|ref|YP_003670547.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. C56-T3]
 gi|297252524|gb|ADI25970.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. C56-T3]
          Length = 371

 Score =  375 bits (962), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/382 (37%), Positives = 200/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPHETRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       M R  D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MSIGADYIATGHYARVEFRDGE-----YKMLRGADPNKDQTYFLNQLGQAQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A+E GL  A K DS  ICF+ +  + + +       A  G +  L+G++ 
Sbjct: 173 HLQKADVRRIAKEAGLATAGKKDSTGICFIGERDFKEFLSHYLP--ARPGVMKTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +   ++N
Sbjct: 231 GRHDGVMYYTIGQRHGLGIGGSGEPWFVVGKDVRENVLYVAQGFENEYLYSTSLKAVDVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFY 368
           W+ D   E      F+C  K R  Q  V V V    D G  V F+     V  GQA VFY
Sbjct: 291 WVSDRKPE----APFRCTAKFRYRQPDVGVTVHPLADGGAEVVFDAPARAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    R+ 
Sbjct: 347 NGE----ECLGGGTIDEVFRNG 364


>gi|254503485|ref|ZP_05115636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Labrenzia alexandrii DFL-11]
 gi|222439556|gb|EEE46235.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Labrenzia alexandrii DFL-11]
          Length = 449

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 216/382 (56%), Positives = 270/382 (70%), Gaps = 7/382 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVAA++  +GYDVIGVTLQLY+   A  +  SCC
Sbjct: 59  LNSLDLPGRPEDTRVVVAMSGGVDSSVVAAMMHAEGYDVIGVTLQLYDHGAAVAKTKSCC 118

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARR  + I + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+D
Sbjct: 119 AGVDIHDARRAAEKIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTD 178

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHY+RS          +R + RP DL+RDQSYFLFATTQ+QL  +
Sbjct: 179 LLKTARDLGADALATGHYVRSATK-----GNKRALFRPADLDRDQSYFLFATTQEQLDFV 233

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR LA E GL +A+K DSQDICFV  G Y  V++++    A  G+IVH+
Sbjct: 234 RFPLGGMPKSQVRTLAEEFGLSVANKPDSQDICFVPNGDYAAVIRKLRPNAAEPGEIVHM 293

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG HNGII++TIGQRRG+GVA GEPL+VV LD +  RVIVGPRE+L    I LRE+
Sbjct: 294 DGRVLGEHNGIIHFTIGQRRGIGVATGEPLYVVRLDADERRVIVGPREALATRTILLREM 353

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   ++   D  + F K+RS++ P P  ++  +   +VD    E GVA GQACVF+
Sbjct: 354 NWIGDQPLDEG--DEIEVFAKVRSTRPPAPAALRILNGKAFVDLANGETGVAPGQACVFF 411

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
            SD   ARVLGGG I  ++R+ 
Sbjct: 412 DSDDETARVLGGGWIHKTERTG 433


>gi|311031538|ref|ZP_07709628.1| tRNA-specific 2-thiouridylase MnmA [Bacillus sp. m3-13]
          Length = 371

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 137/381 (35%), Positives = 203/381 (53%), Gaps = 23/381 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K PKD RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTKAPKDTRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIRVCNQIGIPYYAVNFEKQYWDKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY +     G+       M R +D  +DQ+YFL    Q+QL  + FP+G
Sbjct: 118 LDLGADYLATGHYAQVEFRDGE-----YKMLRGLDENKDQTYFLNQLGQEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+  GL  A K DS  ICF+ +  + + +       A  G+++ ++G++ 
Sbjct: 173 NIEKSEVREIAKRAGLATATKKDSTGICFIGERNFKEFLSGYLP--AQPGNMLTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVI---VGPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P FV+  D   + +        E L    I   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGSGDPWFVIGKDLEKNVLYVGQSFHNELLYSDSITATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +   DG  C  K R  Q    V +    D+ V V F++    +  GQA VFY
Sbjct: 291 WVS----NNPPADGTVCTAKFRYRQADNKVTIQHLEDNKVKVIFDEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRS 389
             D      LGGG I    ++
Sbjct: 347 NGD----ECLGGGTIDHVFKN 363


>gi|118593646|ref|ZP_01551022.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Stappia aggregata IAM 12614]
 gi|118433757|gb|EAV40418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Stappia aggregata IAM 12614]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 215/381 (56%), Positives = 272/381 (71%), Gaps = 7/381 (1%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           NSLDL   P+D RVVVAMSGGVDSSVVAAL+K +GYDVIGVTLQLY+   A  +  SCCA
Sbjct: 3   NSLDLPGRPEDTRVVVAMSGGVDSSVVAALMKAEGYDVIGVTLQLYDHGAAVSKAKSCCA 62

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           G D++DARR  +TI + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+DL
Sbjct: 63  GVDIHDARRAAETIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTDL 122

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   + LGAD LATGHY+RS          +R + RP DL+RDQSYFLFATTQ QL  +R
Sbjct: 123 LKTAKDLGADALATGHYVRSTQQ-----GNKRALFRPADLDRDQSYFLFATTQDQLDFIR 177

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG M K  VR+LA E GL +A+K DSQDICFV  G Y +V++++    A  G+IVH++
Sbjct: 178 FPLGGMPKSKVRELAAEFGLTVANKPDSQDICFVPNGDYAEVIRKLRPNAAEPGEIVHMD 237

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG H+GII+YTIGQRRGLGVA G+PL+VV LD +  RV+VGPRE+L    I LRE+N
Sbjct: 238 GRVLGEHDGIIHYTIGQRRGLGVATGDPLYVVRLDPDERRVVVGPREALATRTILLREMN 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+GD   ++   D  + F K+RS++ P P  ++  +   +VD    E GVA GQACVF+ 
Sbjct: 298 WIGDQPLDEG--DEIELFAKVRSTRPPAPATLRILNGKGFVDLANGETGVAPGQACVFFD 355

Query: 370 SDSNEARVLGGGIISGSKRSD 390
           +D   ARVLGGG I  ++R+ 
Sbjct: 356 TDDETARVLGGGWIHKTERTG 376


>gi|209964264|ref|YP_002297179.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum centenum SW]
 gi|259495835|sp|B6ISD0|MNMA_RHOCS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209957730|gb|ACI98366.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum centenum SW]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 205/400 (51%), Positives = 256/400 (64%), Gaps = 23/400 (5%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL  DK P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+      RKG+CC
Sbjct: 1   MNSLGFDKAPQDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGLTVGRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+YDAR+V D I++ HYV DYE RF  +VI  FA SY  GETP+PCV CN+ VKF D
Sbjct: 61  AGQDIYDARQVADRIDIPHYVLDYESRFGQSVIDDFADSYLRGETPIPCVRCNQRVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHY R        G     + R  D  RDQSYFLFATT  QL  L
Sbjct: 121 LLAQARDLGADCLATGHYARRVA-----GPTGPALHRGADPARDQSYFLFATTPAQLDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFP+G + K   R LA  +GL +ADK DSQDICFV  G Y  VV+++  G    G+IVHL
Sbjct: 176 RFPIGHLPKSETRALAERLGLAVADKPDSQDICFVPAGNYAQVVEKLRPGAVEPGEIVHL 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMG--------EPLFVVYLDKNSSRVIVGPRESLEV 300
           +G++LGRH+G+I YT+GQRRGLG+           +PL+VV ++  + RV+VGPR +L  
Sbjct: 236 DGRVLGRHDGVIRYTVGQRRGLGIGGRRTPEGEELDPLYVVRVEPETRRVVVGPRTALAR 295

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGV 359
            R+ +RE+NWLG     D         VK+RS+Q  +P  V    D G  V   + + GV
Sbjct: 296 DRVLVREVNWLGGTDTADVP-----VTVKLRSAQPALPARVSLTADGGAVVTLTQPQYGV 350

Query: 360 ASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSV 399
           A GQA VFY  D    RVLGGG I  ++ S A+ ++ +  
Sbjct: 351 APGQAAVFYQGD----RVLGGGWIVRAEASPALADAPIPA 386


>gi|323137322|ref|ZP_08072400.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocystis sp. ATCC 49242]
 gi|322397309|gb|EFX99832.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocystis sp. ATCC 49242]
          Length = 412

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 214/407 (52%), Positives = 272/407 (66%), Gaps = 15/407 (3%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           + L L  +P D RVVVAMSGGVDSSVVAALLK  GYDV+GVTLQLY+  +A+ RKG+CCA
Sbjct: 9   DPLILPASPGDTRVVVAMSGGVDSSVVAALLKEQGYDVVGVTLQLYDHGEATHRKGACCA 68

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           GQD+ DAR V   + + H+V DYE RFR  VI  FA+SYA+GETP+PCV CN+ +KF+DL
Sbjct: 69  GQDIQDARAVAARLGIPHFVLDYERRFREKVIDEFAASYASGETPVPCVACNQFIKFADL 128

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
               + LGA VLATGHYI SR    DDG+  R + R  D  RDQSYFLFATT++QL  LR
Sbjct: 129 FETAKDLGAHVLATGHYISSR----DDGEGGRALYRAKDASRDQSYFLFATTREQLRMLR 184

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLGD  K  VR++AR  GL++ADK DSQDICFV  G+Y DVV+R+     + GDIVH++
Sbjct: 185 FPLGDYTKAEVREMARNYGLEVADKPDSQDICFVPSGRYTDVVERLAPDAVVPGDIVHVD 244

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMG------EPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           G++LGRH G+++YTIGQRRGLG+         EPLFVV LD   + V+VGPRE+LE   +
Sbjct: 245 GRVLGRHAGVVHYTIGQRRGLGLGASVAGRDAEPLFVVRLDAARAEVVVGPREALETRAV 304

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASG 362
            LR++NW+G G F D    G     ++RS++ PVP  +   +D    V F  SE GV+ G
Sbjct: 305 ALRDVNWIGSGEFNDMPPQGIDIMARVRSTRPPVPARLIAREDSSATVVFAASEFGVSPG 364

Query: 363 QACVFYTSDSNEARVLGGGIISGSKRS----DAVEESLLSVIGDEFP 405
           QACVFY    + ARVLGGG I+  + +      +     +      P
Sbjct: 365 QACVFYDRADDAARVLGGGFIAAVEPARTTIAPMAPPRRAATAQGAP 411


>gi|120554680|ref|YP_959031.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marinobacter aquaeolei VT8]
 gi|205816919|sp|A1U1H5|MNMA_MARAV RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|120324529|gb|ABM18844.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marinobacter aquaeolei VT8]
          Length = 392

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 130/397 (32%), Positives = 200/397 (50%), Gaps = 23/397 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
            ++P   RV+V MSGGVDSSV A LLK  GY V G+ ++ ++    ++    C A  D+ 
Sbjct: 7   PQSPAHTRVIVGMSGGVDSSVAAWLLKDQGYQVEGLFMKNWDEDDGTE---YCTAMTDLA 63

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ V D I +  +   +   + + V   F S Y+AG TP P + CN+ VKF   L    
Sbjct: 64  DAQAVADAIGIKLHTASFAAEYWDRVFEHFLSEYSAGRTPNPDILCNKEVKFRAFLDYAV 123

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY R R    +DG  +  + + +D  +DQSYFL A + +++    FP+G+
Sbjct: 124 TLGADYIATGHYTRQRPL--NDGSGKAQLLKGLDPNKDQSYFLHAVSGERIARTLFPVGE 181

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A E G    DK DS  ICF+ + K+ D +K+     A  G+I   +G ++G
Sbjct: 182 LEKPEVRRIAEEQGFVTHDKKDSTGICFIGERKFTDFLKQYLP--AQPGNIETPDGTVIG 239

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           +H G++ +TIGQR+GLG+        EP +V   D   + +I    +         +   
Sbjct: 240 KHQGLMYHTIGQRQGLGIGGLAEFGDEPWYVAEKDLKRNVLIAVQGKHHPLLFSRGLVSG 299

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
            ++W+      +     F+C  K R  Q      V   D GV V F+ ++  V  GQ+ V
Sbjct: 300 PVDWVAG----EPPAQKFRCKAKTRYRQPDQDCEVTVIDGGVKVVFDDAQRAVTPGQSVV 355

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDE 403
           FY  +      LGGG+I  + R +    + L     E
Sbjct: 356 FYQGEV----CLGGGVIEQTWRDNEALPARLEHQASE 388


>gi|182679942|ref|YP_001834088.1| tRNA-specific 2-thiouridylase MnmA [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|205813049|sp|B2IBH3|MNMA_BEII9 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|182635825|gb|ACB96599.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 431

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 217/393 (55%), Positives = 284/393 (72%), Gaps = 9/393 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P   RVVVAMSGGVDSSVVAALLKR+GY+VIGVTLQLY+  +A  RKG+CC
Sbjct: 18  LNSLGLPKPPALTRVVVAMSGGVDSSVVAALLKREGYEVIGVTLQLYDHGEAVHRKGACC 77

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DAR+V D + + HYV DYEERFR  VI PFA SYA GETP+PCV CN  +KF+D
Sbjct: 78  AGQDIQDARQVADQLGIPHYVLDYEERFRRKVIDPFAQSYATGETPIPCVSCNSEIKFAD 137

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           L    + LGADVLATGHY+ S+     +    R + R +D  RDQSYFLFATT  QL  L
Sbjct: 138 LFETAQHLGADVLATGHYVSSK----AEADGGRALYRSLDSSRDQSYFLFATTNAQLELL 193

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR +AR++GL +ADK+DSQDICFV  GKY DV++R++ G  + G+I+H+
Sbjct: 194 RFPLGDLAKPDVRQMARQLGLVVADKADSQDICFVPSGKYSDVIERLSPGAVVPGEILHV 253

Query: 249 NGQILGRHNGIINYTIGQRR-----GLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +G++LGRH+G+I+YTIGQRR      +G   GEPL+V+ LD   ++VIVGPR++L   R+
Sbjct: 254 DGRVLGRHSGVIHYTIGQRRGLGLGAVGAGAGEPLYVIRLDAAKAQVIVGPRQALATRRV 313

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQ 363
           +LR +NW+G G  +D    G + FV++RS++ P+P F+  ++  ++VDF   E GV+ GQ
Sbjct: 314 HLRGVNWIGPGSLQDMDEHGLEIFVQVRSTRAPIPGFLHAHESEIWVDFALDEDGVSPGQ 373

Query: 364 ACVFYTSDSNEARVLGGGIISGSKRSDAVEESL 396
           ACVFY +D   ARVLGGG IS ++ +  + E  
Sbjct: 374 ACVFYENDQPRARVLGGGFISATESALQMREMF 406


>gi|138896133|ref|YP_001126586.1| tRNA-specific 2-thiouridylase MnmA [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250086|ref|ZP_03148780.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. G11MC16]
 gi|166234855|sp|A4IR87|MNMA_GEOTN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|134267646|gb|ABO67841.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus thermodenitrificans NG80-2]
 gi|196210270|gb|EDY05035.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacillus sp. G11MC16]
          Length = 371

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/382 (37%), Positives = 200/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPHETRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVVRVCNQIGIPYYAVNFEKQYWDKVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             +GAD +ATGHY R     G+       M R  D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MSIGADYVATGHYARVEFRDGE-----YKMLRGADPNKDQTYFLNQLGQAQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A+E GL  A K DS  ICF+ +  + + +       A  G +  L+G++ 
Sbjct: 173 HLQKADVRRIAKEAGLATAGKKDSTGICFIGERDFKEFLSHYLP--AQPGVMKTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +   ++N
Sbjct: 231 GRHDGVMYYTIGQRHGLGIGGSGEPWFVVGKDVRENVLYVAQGFENEYLYSTSLKAVDVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+ D   E      F+C  K R  Q  + V V    DG   V F+     V  GQA VFY
Sbjct: 291 WVSDRKPE----APFRCTAKFRYRQPDIGVMVHPLADGKAEVVFDAPARAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      LGGG I    R+ 
Sbjct: 347 NGD----ECLGGGTIDEVFRNG 364


>gi|316935452|ref|YP_004110434.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315603166|gb|ADU45701.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 401

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 214/401 (53%), Positives = 280/401 (69%), Gaps = 10/401 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
               LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A  RK
Sbjct: 2   TEPMLNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGAAIHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+V
Sbjct: 62  GACCAGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSV 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++Q
Sbjct: 122 KFRDLLATARELGASALATGHYVSSRRL----ENGSRALVCAADRDRDQSYFLFATTREQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GD
Sbjct: 178 LQFLRFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGD 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV ++G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI 
Sbjct: 238 IVDIDGRVLGQHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRQVVVGPREALLMDRIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR++NW+GDG  +D V DG + FV++RS+++P P +++  + G  V+    E GV+ GQA
Sbjct: 298 LRDVNWIGDGALDDVVGDGLELFVRVRSTREPQPAWLRAANGGYEVELVVGEEGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGSKR------SDAVEESLLSV 399
           CVFY +   +ARVLGGG I  +         D +E   L+ 
Sbjct: 358 CVFYDAAEGQARVLGGGFIKSAAPRRFEGGRDQIEAPALAA 398


>gi|229543733|ref|ZP_04432793.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus coagulans 36D1]
 gi|229328153|gb|EEN93828.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus coagulans 36D1]
          Length = 371

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/391 (36%), Positives = 205/391 (52%), Gaps = 26/391 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MQKAPKDTRVVVGMSGGVDSSVAAYLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R     G+       M R +D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 LNLGADYLATGHYARVTHQDGE-----YKMLRGVDGNKDQTYFLNQLGQYQLSRVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR++A+E GL  A+K DS  ICF+ +  + + +       A +G +  L+G+++
Sbjct: 173 DLEKPRVREIAKEAGLATANKKDSTGICFIGERNFKEFLSHYLP--AQKGLMKTLDGKVM 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G H G++ YTIGQR GLG+   GEP F V  D   + + V             +   + N
Sbjct: 231 GEHEGLMYYTIGQRHGLGIGGSGEPWFAVGKDLKENVLYVEQGFHHPALYSDYMTGVKAN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFY 368
           W+          + F+C  K R  Q    V VQ   +D V V +++    V  GQA VFY
Sbjct: 291 WVSGK----KPPEVFRCTAKFRYRQPDQKVTVQLLGNDEVKVIYDEPVRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSV 399
             +      LGG  I    ++   EE L+ V
Sbjct: 347 NGE----ECLGGATIDKIYKN---EEQLMYV 370


>gi|192289904|ref|YP_001990509.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           TIE-1]
 gi|192283653|gb|ACF00034.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 401

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/401 (53%), Positives = 280/401 (69%), Gaps = 10/401 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
               LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RK
Sbjct: 2   TEPMLNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+V
Sbjct: 62  GACCAGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSV 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++Q
Sbjct: 122 KFRDLLATARELGASALATGHYVSSRRLDD----GSRALVCAADRDRDQSYFLFATTREQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GD
Sbjct: 178 LQFLRFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGD 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV ++G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI 
Sbjct: 238 IVDVDGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAARRQVVVGPREALLMDRIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR+INW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQA
Sbjct: 298 LRDINWIGDGALDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGSKR------SDAVEESLLSV 399
           CVFY +   +ARVLGGG I  +         + +E   L+ 
Sbjct: 358 CVFYDAAEGQARVLGGGFIKSAAPRRFEGGREQIEAPALAA 398


>gi|39934381|ref|NP_946657.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           CGA009]
 gi|39648230|emb|CAE26749.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris CGA009]
          Length = 401

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/401 (53%), Positives = 280/401 (69%), Gaps = 10/401 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
               LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RK
Sbjct: 2   TEPMLNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+V
Sbjct: 62  GACCAGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSV 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++Q
Sbjct: 122 KFRDLLATARELGASALATGHYVSSRRLDD----GSRALVCAADRDRDQSYFLFATTREQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GD
Sbjct: 178 LQFLRFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGD 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV ++G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI 
Sbjct: 238 IVDVDGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAAQRQVVVGPREALLMDRIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR+INW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQA
Sbjct: 298 LRDINWIGDGSLDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGSKR------SDAVEESLLSV 399
           CVFY +   +ARVLGGG I  +         + +E   L+ 
Sbjct: 358 CVFYDAAEGQARVLGGGFIKSAAPRRFEGGREQIEAPALAA 398


>gi|304317430|ref|YP_003852575.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778932|gb|ADL69491.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 372

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/378 (36%), Positives = 210/378 (55%), Gaps = 24/378 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + ++ K+++VVV MSGGVDSSV A LLK  GYDV+G+ ++ ++    S   G C A +D 
Sbjct: 1   MIESNKNIKVVVGMSGGVDSSVSALLLKEQGYDVVGIFMKNWDEEDDS---GYCTAAEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVCD I + +Y  ++ + + + V   F   Y +G TP P V CN+ +KF   L  +
Sbjct: 58  EDVVRVCDKIGIPYYSINFTQEYWDRVFKYFLDEYRSGRTPNPDVMCNKEIKFKAFLDFS 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            ++GAD +ATGHY R     G     +  M + +D  +DQ+YFL    Q+QL    FP+G
Sbjct: 118 LKIGADYIATGHYARIEYSNG-----KYRMLKGVDKNKDQTYFLCELGQKQLSKTIFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K  VR++AR+ GL  ADK DS  ICF+ + K+ + + +     A  G+I  L+G++L
Sbjct: 173 HLNKFEVREIARKAGLKTADKKDSTGICFIGERKFKEFLNQFLP--AKPGEIRDLSGRVL 230

Query: 254 GRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           G+H+G++ YT+GQRR     G+  GEP FVV  D  ++ + V   E       + ++ ++
Sbjct: 231 GKHDGLMFYTLGQRRGLGIGGIGTGEPWFVVDKDVENNILYVAQGEKNPALYSYALFTKD 290

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +NW+ + +      D F+C  K R  Q    V V   DDG +V F+K +  V  GQ  VF
Sbjct: 291 VNWIDNSI----EADTFRCKAKFRYRQPDQDVTVYAKDDGYFVVFDKPQRAVTPGQFVVF 346

Query: 368 YTSDSNEARVLGGGIISG 385
           Y  +      LGGG+I  
Sbjct: 347 YDGE----YCLGGGVIDS 360


>gi|170751444|ref|YP_001757704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|205816882|sp|B1LV15|MNMA_METRJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|170657966|gb|ACB27021.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 384

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/392 (54%), Positives = 273/392 (69%), Gaps = 10/392 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LDL K P + RVVVAMSGGVDSSVVA LLKR G+DV+GVTLQLY+   AS RKG+CC
Sbjct: 1   MNALDLPKAPHETRVVVAMSGGVDSSVVAGLLKRQGFDVVGVTLQLYDHGAASHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR   + + + HYV DYE+RFR+ VI  FA SY AGETP+PCV+CNRTVKF D
Sbjct: 61  AGQDIHDARAAAEHLGIPHYVLDYEDRFRDEVIEKFAESYLAGETPIPCVECNRTVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R L AD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGLARDLDADALATGHYVASRALPG----GGRALHRALDPARDQSYFLYATTAEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+M+K   R LA+E+GL +A+K DSQDICFV QG+Y DV+ R+    A  G+IV L
Sbjct: 177 RFPLGEMEKTETRALAKELGLSLAEKPDSQDICFVPQGRYSDVIARLRPDAARPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G +LGRH+GI++YT+GQR+GLG++  EPL+VV L+ +++RV+VGPR +L   RI L ++
Sbjct: 237 DGHVLGRHDGIVHYTVGQRKGLGLSGPEPLYVVRLEPDAARVVVGPRTALATTRIRLSDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVF 367
           NWLG+G  E   V      V++RS++ P P  +    DG V V   + E GV+ GQAC  
Sbjct: 297 NWLGEGPAE--AVRDLPVAVRVRSTRPPRPATLTVGPDGAVEVVLAEPEDGVSPGQACAI 354

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSV 399
           Y  D   ARVLGGG I   +R DA+       
Sbjct: 355 YADDGPRARVLGGGTI---RRVDALSARPREA 383


>gi|205822121|sp|Q6NA79|MNMA_RHOPA RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 397

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/397 (53%), Positives = 280/397 (70%), Gaps = 10/397 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRLDD----GSRALVCAADRDRDQSYFLFATTREQLQFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GDIV +
Sbjct: 178 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGDIVDV 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI LR+I
Sbjct: 238 DGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAAQRQVVVGPREALLMDRIVLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGSLDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKR------SDAVEESLLSV 399
            +   +ARVLGGG I  +         + +E   L+ 
Sbjct: 358 DAAEGQARVLGGGFIKSAAPRRFEGGREQIEAPALAA 394


>gi|226312727|ref|YP_002772621.1| tRNA U34-sulfurtransferase [Brevibacillus brevis NBRC 100599]
 gi|226095675|dbj|BAH44117.1| tRNA U34-sulfurtransferase [Brevibacillus brevis NBRC 100599]
          Length = 370

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 137/381 (35%), Positives = 201/381 (52%), Gaps = 27/381 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K P+D RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   KRPEDTRVVVGMSGGVDSSVTAYLLKQQGYDVIGIFMKNWDD---TDEFGHCTAEEDFQD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
            RRVC+ I + +Y  ++E+ + + V   F   Y  G TP P V CNR +KF +LL+    
Sbjct: 59  VRRVCEQIGIPYYTVNFEKEYMDKVFQYFLDEYKRGRTPNPDVMCNREIKFGELLAKVMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +   G+       + R  D  +DQ+YFL    Q+QL    FP+G +
Sbjct: 119 LGADYIATGHYAQVKYIDGE-----YKLIRGADNNKDQTYFLNVLGQEQLSKTMFPIGHL 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR++A + GL  A K DS  ICF+ +  + + ++      A +G+I  ++G ++G 
Sbjct: 174 PKPQVREIAEKAGLYTAKKKDSTGICFIGERNFREFLQNYLP--AKQGNIETVDGAVIGT 231

Query: 256 HNGIINYTIGQRR-----GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H+G++ YT+GQR+     G     G+P FVV  D   + +IVG            +    
Sbjct: 232 HDGLMYYTLGQRQGLGIGGGHGTSGQPWFVVDKDLERNALIVGEGSDHIRLYSKSLLATN 291

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACV 366
           ++W+ D        + F C  K R  Q    V V   +DG V V F++ +  V  GQA V
Sbjct: 292 VSWVSDK----KPSETFTCTAKFRYRQPDQGVTVHLLEDGNVEVVFDQPQKAVTPGQAVV 347

Query: 367 FYTSDSNEARVLGGGIISGSK 387
           FY  +      LGGG I   +
Sbjct: 348 FYNGEV----CLGGGTIDKVR 364


>gi|77459818|ref|YP_349325.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas fluorescens Pf0-1]
 gi|123604062|sp|Q3KA70|MNMA_PSEPF RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|77383821|gb|ABA75334.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas fluorescens Pf0-1]
          Length = 374

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/383 (32%), Positives = 197/383 (51%), Gaps = 26/383 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             +    RV+V MSGGVDSSV A LL   GY+V G+ ++ +     ++    C A  D+ 
Sbjct: 6   PSDTSKKRVIVGMSGGVDSSVSALLLIEQGYEVEGLFMKNWEEDDGTE---YCTAMDDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAM 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+
Sbjct: 123 MLGADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  G+I    G+++G
Sbjct: 178 LEKPEVRAIAEKYELATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIKTTEGEVIG 235

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           RH+G++ +TIGQR+GLG+        EP +V+  D +++ +IV        L    +   
Sbjct: 236 RHHGLMYHTIGQRQGLGIGGLKDAGDEPWYVLRKDLDTNELIVGQGNNHPWLFSSALLAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           EI W+        +    +   K+R  Q      +++ D G    F++ +  V  GQ+ V
Sbjct: 296 EIYWVNPI----DLSQPLRLTAKVRYRQSDQACTLEKTDTGYRAVFDEPQRAVTPGQSVV 351

Query: 367 FYTSDSNEARVLGGGIISGSKRS 389
           FY  +      LGGG+I  ++  
Sbjct: 352 FYDGEI----CLGGGVIEVAEPW 370


>gi|90422506|ref|YP_530876.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisB18]
 gi|90104520|gb|ABD86557.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisB18]
          Length = 404

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/398 (53%), Positives = 280/398 (70%), Gaps = 4/398 (1%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
            A  LNSLDL+  P+D R+VVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A  RK
Sbjct: 2   TAAMLNSLDLEGRPQDTRIVVAMSGGVDSSTTAALLKSEGYDVVGITLQLYDHGAAIHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V D I + HYV DYE RF+ +VI  FA+SYA GETP+PC++CNR++
Sbjct: 62  GACCAGQDIHDARAVADRIGIPHYVLDYESRFQESVIDSFAASYATGETPVPCIECNRSI 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLLS  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT+ Q
Sbjct: 122 KFRDLLSTARELGASALATGHYVSSRRLAD----GSRALVCASDADRDQSYFLFATTRDQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV R+       G+
Sbjct: 178 LDYLRFPLGDMTKPQTRELARKFGLSVADKHDSQDICFVPTGRYTDVVGRLKPNAMEPGE 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV L+G++LG+H GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPRE+L + RI 
Sbjct: 238 IVDLDGRVLGKHQGIVHFTVGQRRGLGIASTAPLYVLRLEPSTRRVVVGPREALRMDRIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR++NW+GD   + AV DG + FV++RS++ P P +++  D G  V+    E GV+ GQA
Sbjct: 298 LRDVNWIGDSSLDRAVGDGLELFVRVRSTRRPQPAWLRAQDGGYQVELVAGEDGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           CVFY + + +ARVLGGG I  +    A + +L      
Sbjct: 358 CVFYDAPAGQARVLGGGFIKSATPRAAGKSALRGAPAS 395


>gi|114706635|ref|ZP_01439536.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fulvimarina pelagi HTCC2506]
 gi|114538027|gb|EAU41150.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fulvimarina pelagi HTCC2506]
          Length = 394

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/383 (55%), Positives = 270/383 (70%), Gaps = 6/383 (1%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
             T LNSLD+ K P+D RV+VAMSGGVDSSV AA+LK +GYDV+G+TLQLY++     + 
Sbjct: 1   MTTHLNSLDIPKAPEDTRVIVAMSGGVDSSVTAAILKDEGYDVVGITLQLYDAGDTPAKA 60

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD+ DARRVCD + + HYV DYEE FR AVI PFA +Y AGETP+PCV CN+TV
Sbjct: 61  GACCAGQDIRDARRVCDLLGIPHYVLDYEENFREAVIDPFADAYVAGETPIPCVSCNQTV 120

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL     LG D LATGHYI SR          R + RP DL+RDQSYFL+ TTQ+Q
Sbjct: 121 KFRDLLKTAMDLGGDALATGHYIESRKR-----GNHRSLHRPFDLDRDQSYFLYGTTQKQ 175

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           +  LRFPL  + K+  R++A + GL IA K DSQDICFV  G+Y D+V+R+       G+
Sbjct: 176 VDFLRFPLASLTKDETREIAAKHGLAIASKPDSQDICFVPTGRYSDLVRRLRPEAGDPGE 235

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IVH++G++LG H GIINYT+GQRRGLGVA GEPL+VV LD  + RV+VGPRE+L    + 
Sbjct: 236 IVHIDGRVLGEHEGIINYTVGQRRGLGVAAGEPLYVVKLDPATRRVVVGPREALATRAVR 295

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQ 363
           LRE+NWL +   E    +  + FVK+RS++ P P  +  + +G + V+   +E GVA GQ
Sbjct: 296 LREVNWLAEESAEVYATETREIFVKLRSTRPPSPARLAADGEGGWMVELLAAEYGVAKGQ 355

Query: 364 ACVFYTSDSNEARVLGGGIISGS 386
           ACVFY ++   A VLGGGII GS
Sbjct: 356 ACVFYGAEGAGAEVLGGGIIDGS 378


>gi|154252635|ref|YP_001413459.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|154156585|gb|ABS63802.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 462

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 218/372 (58%), Positives = 264/372 (70%), Gaps = 9/372 (2%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
              E T LNSLDL   P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A 
Sbjct: 60  AFDEMTGLNSLDLPGRPEDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGAAV 119

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
            RKG+CCAGQD+ DARRV D I + HYV DYE+RFR AV+  FA SYAAGETP+PCV CN
Sbjct: 120 SRKGACCAGQDIQDARRVADQIGIPHYVLDYEDRFRRAVMDDFADSYAAGETPIPCVRCN 179

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
             VKF DLL   R LGA  LATGHYI SR      G   R + RP D ERDQSYFLFATT
Sbjct: 180 ERVKFRDLLDTARDLGAAALATGHYIASRR-----GAAGRELHRPRDEERDQSYFLFATT 234

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           Q+QL  LRFPLG++ K   R LA  MGL++A K DSQDICFV  G+Y  +V+++  G + 
Sbjct: 235 QEQLEFLRFPLGELTKPEARALADRMGLEVAGKPDSQDICFVPTGRYTTIVEKLRPGASA 294

Query: 242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPL----FVVYLDKNSSRVIVGPRES 297
            G++VHL+G++LGRH+GI+N+TIGQRRGLG+   EP+    FVV LD    +VIVGPRE+
Sbjct: 295 PGEVVHLDGRVLGRHSGIVNFTIGQRRGLGIGASEPVSEPLFVVKLDPLKRQVIVGPREA 354

Query: 298 LEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV 357
           LE  ++ LR+INWLGDG F +   +G K   K+RS++ PVP  + R  +G  V+  +SE 
Sbjct: 355 LETQKLTLRDINWLGDGPFAELPGEGLKIVAKVRSTRPPVPARLFRTGEGAVVELLESEG 414

Query: 358 GVASGQACVFYT 369
           GVA GQACVFY 
Sbjct: 415 GVAPGQACVFYD 426


>gi|220925891|ref|YP_002501193.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium nodulans ORS
           2060]
 gi|254811453|sp|B8IU32|MNMA_METNO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|219950498|gb|ACL60890.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 382

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 215/388 (55%), Positives = 270/388 (69%), Gaps = 11/388 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P+D RVVVAMSGGVDSSVVA LLKR GYDV+G+TLQLY+   A+ R+G+CC
Sbjct: 1   MNSLDLPKAPQDTRVVVAMSGGVDSSVVAGLLKRQGYDVVGITLQLYDHGAATHRRGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARR  +T+ + HYV DYE+RFR AVI  FA SY  GETP+PCV+CNR++KF D
Sbjct: 61  AGQDIHDARRAAETLGIPHYVLDYEDRFREAVIDRFADSYIHGETPIPCVECNRSIKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+    LGAD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLATALDLGADALATGHYVASRPRPG----GSRALYRALDPARDQSYFLYATTAEQLDVL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K+  R LARE GL +ADK DSQDICFV QG+Y DV+ R+       G+IVHL
Sbjct: 177 RFPLGELPKDETRRLAREFGLSVADKPDSQDICFVPQGRYQDVIARLRPDSVRPGEIVHL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GII +T+GQRRGL +A GEPL+VV LD  ++RV+VGPRE+L    I L E 
Sbjct: 237 DGRTLGRHDGIIGFTVGQRRGLKLATGEPLYVVRLDPETARVVVGPREALATSVIRLAET 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGD    +  +DG    V++RS+++P P  ++ N       V     E GV+ GQAC 
Sbjct: 297 NWLGDEPLTE--LDGMPVAVRVRSTREPRPATLRWNRAASCAEVMLATPEDGVSPGQACA 354

Query: 367 FYTSDSNEARVLGGGII---SGSKRSDA 391
            Y  +   ARVLGGG I     S+R  A
Sbjct: 355 IYADEGPRARVLGGGTILRVEASRREAA 382


>gi|205822138|sp|Q21AM9|MNMA_RHOPB RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 400

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 212/394 (53%), Positives = 279/394 (70%), Gaps = 4/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D R+VVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRIVVAMSGGVDSSTTAALLKSEGYDVVGITLQLYDHGAAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V D I + HYV DYE RF+ +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARAVADRIGIPHYVLDYESRFQESVIDSFAASYATGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT+ QL  L
Sbjct: 122 LLSTARELGASALATGHYVSSRRLAD----GSRALVCASDADRDQSYFLFATTRDQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRELARKFGLSVADKHDSQDICFVPTGRYTDVVGRLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPRE+L + RI LR++
Sbjct: 238 DGRVLGKHQGIVHFTVGQRRGLGIASTAPLYVLRLEPSTRRVVVGPREALRMDRIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDSSLDRAVGDGLELFVRVRSTRRPQPAWLRAQDGGYQVELVAGEDGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
            + + +ARVLGGG I  +    A + +L      
Sbjct: 358 DAPAGQARVLGGGFIKSATPRAAGKSALRGAPAS 391


>gi|167034615|ref|YP_001669846.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas putida GB-1]
 gi|189040506|sp|B0KMQ6|MNMA_PSEPG RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166861103|gb|ABY99510.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas putida GB-1]
          Length = 374

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/386 (32%), Positives = 196/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   +++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGDLTELLKGLDPNKDQSYFLHAVGGKEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGDIETTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDAGDEPWYVLHKDLTRNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      ++  + G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPI----DLSSPRQLTAKVRYRQSDQQCTLELTETGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIEAAEPWSPRA 374


>gi|104781327|ref|YP_607825.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas entomophila L48]
 gi|122403646|sp|Q1IBE4|MNMA_PSEE4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|95110314|emb|CAK15021.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas entomophila L48]
          Length = 374

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/386 (32%), Positives = 199/386 (51%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   +++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGELTELLKGLDPNKDQSYFLHAVGGKEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  G+I    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIQTTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDAGDEPWYVLHKDLARNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      ++R ++G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPI----DLSSPRRLTAKVRYRQGDQQCTLERTENGYRAMFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++     +
Sbjct: 353 YDGEV----CLGGGVIETAEPWSPRQ 374


>gi|311694977|gb|ADP97850.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine bacterium HP15]
          Length = 395

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 196/384 (51%), Gaps = 23/384 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             +  + RV+V MSGGVDSSV A LLK  GY V G+ ++ ++    ++    C A  D+ 
Sbjct: 10  PNSNANTRVIVGMSGGVDSSVAAWLLKDQGYQVEGLFMKNWDEDDGTE---YCTAMTDLA 66

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ V D I +  +   +   + + V   F S Y AG TP P + CN+ VKF   L    
Sbjct: 67  DAQAVADAIGIKLHTASFAAEYWDRVFEHFLSEYQAGRTPNPDILCNKEVKFRAFLDYAI 126

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY R R   G  GK    + + +D  +DQSYFL A +  ++    FP+G+
Sbjct: 127 TLGADYIATGHYARQRPIAGSTGK--AQLLKGLDPNKDQSYFLHAVSGDRIARTLFPVGE 184

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A + G    DK DS  ICF+ + K+ D +K+     A  GDI   +GQ +G
Sbjct: 185 LEKPEVRRIAEQQGFVTHDKKDSTGICFIGERKFKDFLKQYLP--AQPGDIETPDGQKIG 242

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           RH G++ +TIGQR+GLG+        EP +V   D + + ++    +         +   
Sbjct: 243 RHQGLMYHTIGQRQGLGIGGLSEFGDEPWYVAEKDLSRNVLVAVQGKHHPLLFSRGLVSG 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
            I+W+      +A    F+C  K R  Q      V   D GV VDF+ ++  V  GQ+ V
Sbjct: 303 PIDWVAG----EAPAGHFRCKAKTRYRQPDQDCQVLLIDGGVRVDFDDAQRAVTPGQSVV 358

Query: 367 FYTSDSNEARVLGGGIISGSKRSD 390
           FY  +      LGGG+I  + R D
Sbjct: 359 FYDGEV----CLGGGVIEQTWRDD 378


>gi|312865771|ref|ZP_07725993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus downei F0415]
 gi|311098646|gb|EFQ56868.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus downei F0415]
          Length = 374

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 131/387 (33%), Positives = 189/387 (48%), Gaps = 25/387 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 1   MMTDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAKYRAGRTPNPDVMCNKEIKFKAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG
Sbjct: 118 MSLGADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A E GL  A K DS  ICF+ +  + + +       A  G ++ L+G+ +
Sbjct: 174 HLEKPEVRKIAEEAGLATAKKKDSTGICFIGEKNFKEFLSNYLP--AQPGRMLTLDGKDM 231

Query: 254 GRHNGIINYTI-----GQRRGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G+H G++ YTI         G       P FVV  D + + + V      ++L    +  
Sbjct: 232 GQHAGLMYYTIGQRGGLGIGGQQGGGNAPWFVVGKDLSQNILYVGQGFYHDALMSTSLKA 291

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  D   E       +C  K R  Q    V V    D   V F++ +  +  GQA 
Sbjct: 292 STIHFTRDTPEE----FTMECTAKFRYRQPDSKVTVHVKGDQAEVVFDQPQRAITPGQAV 347

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAV 392
           VFY  D      LGGGII  + +++ V
Sbjct: 348 VFYDGD----ECLGGGIIDNAYKNEVV 370


>gi|288555376|ref|YP_003427311.1| (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Bacillus
           pseudofirmus OF4]
 gi|288546536|gb|ADC50419.1| (5-methylaminomethyl-2-thiouridylate)-methyltran sferase [Bacillus
           pseudofirmus OF4]
          Length = 367

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 137/380 (36%), Positives = 202/380 (53%), Gaps = 23/380 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K P+D +VVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MKKRPEDTKVVVGMSGGVDSSVTALVLKEQGYDVIGIFMKNWDD---TDESGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L+  
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       + R +D  +DQ+YFL A +QQQL    FP+G
Sbjct: 118 MALGADYVATGHYARVEEVDGE-----FQLLRGVDSNKDQTYFLNALSQQQLSKTMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K+ VR+ A    L  A K DS  ICF+ +  + + +       A  G++  ++G++ 
Sbjct: 173 HIPKKEVREKALAADLATAKKKDSTGICFIGERNFKEFLSGFLP--AQPGEMQTVDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YT+GQR+GLG+   GEP FV+  D   + +IV      + L    +    +N
Sbjct: 231 GQHDGLMYYTLGQRQGLGIGGAGEPWFVIDKDLERNVLIVGQGFHNQGLYSEGLEAVHLN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFY 368
           W+            F+C  K R  QD   V V   +D G  V F++ E  +  GQA VFY
Sbjct: 291 WISP----TKPTSEFRCTAKFRYRQDDQGVTVIPQEDGGALVKFDEPERAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKR 388
             D      LGGG I    +
Sbjct: 347 EGDV----CLGGGTIDRVIK 362


>gi|78043170|ref|YP_361010.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|123575599|sp|Q3AA24|MNMA_CARHZ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|77995285|gb|ABB14184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 365

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 145/368 (39%), Positives = 208/368 (56%), Gaps = 14/368 (3%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARR 78
            +V+VAMSGGVDSSV AALL   GY+V+GVT+Q+++ +     +    CC+   V DARR
Sbjct: 7   KKVLVAMSGGVDSSVTAALLLEQGYEVVGVTMQIWDPKIEVIGEEYVGCCSIYAVNDARR 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D + + +YV ++ E F   VI  F   Y  G TP PC+ CNR +KF  LL     LG 
Sbjct: 67  VADRLGIPYYVLNFRELFERKVIDYFTEEYLRGRTPNPCIACNRYIKFDALLKKALSLGM 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R    V  D   +  + R +D ++DQ+Y L+  TQ  L  L  PLG+  KE
Sbjct: 127 DYMATGHYARV---VYKDDIGKYGLFRGVDRKKDQTYVLYNLTQDMLRRLLLPLGEYTKE 183

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR+LAR+  L  ADK +SQ+ICFV    Y   +K         G+ V +NG++LG+H G
Sbjct: 184 QVRELARKYNLVTADKPESQEICFVPDNDYRKFLKERRGEEIKPGNFVDVNGRVLGQHQG 243

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
              YTIGQR+GLG+A+G+P +VV +   ++ V++G    +    +   ++N+L    + D
Sbjct: 244 YPYYTIGQRKGLGLALGKPYYVVDIRPETNEVVIGEASEIFSPGLIASDLNFL----WFD 299

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + + F+   +IR +  P P  V+R   D V V F + +  +  GQA VFY  D     +
Sbjct: 300 EIPERFEAQAQIRYNAKPQPAVVERIGKDKVKVVFNEPQRAITPGQAVVFYRGD----EL 355

Query: 378 LGGGIISG 385
           LGGG I  
Sbjct: 356 LGGGTIEK 363


>gi|319651666|ref|ZP_08005793.1| TrmU protein [Bacillus sp. 2_A_57_CT2]
 gi|317396733|gb|EFV77444.1| TrmU protein [Bacillus sp. 2_A_57_CT2]
          Length = 371

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 146/377 (38%), Positives = 201/377 (53%), Gaps = 23/377 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K+PKD RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MKKDPKDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R     G+       M R +D  +DQ+YFL   TQ QL  + FP+G
Sbjct: 118 MSLGADYLATGHYARVEFRDGE-----YKMLRGLDDNKDQTYFLNQLTQDQLEKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR+LA++ GL  A K DS  ICF+ +  + + +       A  G++  ++G+I+
Sbjct: 173 DIEKSKVRELAKDAGLATAAKKDSTGICFIGERNFKEFLGNYLP--AQPGNMETMDGKIV 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP F +  D   + + V      E L    I     +
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGAGEPWFAIGKDLKRNVLYVGQGFHNEMLYSDSIIAVNAS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+            F+C  K R  Q    V VQ   DG V V F++    V  GQA VFY
Sbjct: 291 WV----THSEQPQEFECTAKFRYRQADSRVKVQILGDGKVQVIFDEPIRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISG 385
             D      LGGG I  
Sbjct: 347 NGD----ECLGGGTIDK 359


>gi|293364413|ref|ZP_06611139.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis ATCC 35037]
 gi|291317259|gb|EFE57686.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis ATCC 35037]
          Length = 415

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 137/403 (33%), Positives = 197/403 (48%), Gaps = 36/403 (8%)

Query: 9   LNSL--DLDK---------NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS 57
           +N +   ++K         +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++ 
Sbjct: 26  MNRILKGMNKRIDGRLTMSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD 85

Query: 58  RKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPC 117
              +   G C A +D  D   V D I + +Y  ++E+ + + V   F + Y AG TP P 
Sbjct: 86  ---TDENGVCTATEDYKDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPD 142

Query: 118 VDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL 177
           V CN+ +KF   L     LGAD +ATGHY R       D      M R +D  +DQ+YFL
Sbjct: 143 VMCNKEIKFKAFLDYAMTLGADYIATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFL 198

Query: 178 FATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINA 237
              +Q+QL    FPLG ++K  VR LA E GL  A K DS  ICF+ +  + + +     
Sbjct: 199 SQLSQEQLQKTMFPLGHLEKPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP 258

Query: 238 GIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV 292
             A  G ++ ++G+ +G H G++ YTIGQR GLG+         P FVV  D + + + V
Sbjct: 259 --AQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSQNILYV 316

Query: 293 ---GPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY 349
                 +SL    +   ++++  D   E       +C  K R  Q    V V    D   
Sbjct: 317 GQGFYHDSLMSTSLEASQVHFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAE 372

Query: 350 VDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAV 392
           V F + +  +  GQA VFY  +      LGGG+I  + R   V
Sbjct: 373 VIFAEPQRAITPGQAVVFYDGE----ECLGGGLIDNAYRDGQV 411


>gi|325273429|ref|ZP_08139681.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas sp. TJI-51]
 gi|324101442|gb|EGB99036.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas sp. TJI-51]
          Length = 374

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 124/386 (32%), Positives = 195/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   +++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGAVTELLKGLDPNKDQSYFLHAVGGKEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  G+I    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGNIETTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDAGDEPWYVLHKDLTRNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      +   D G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNSV----DLSSPRQLTAKVRYRQSDQRCTLALTDGGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIEAAEPWSPRA 374


>gi|330810455|ref|YP_004354917.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327378563|gb|AEA69913.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 374

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 123/383 (32%), Positives = 195/383 (50%), Gaps = 26/383 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             +    RV+V MSGGVDSSV A LL   GY+V G+ ++ +     ++    C A  D+ 
Sbjct: 6   PSDTSKKRVIVGMSGGVDSSVSALLLIEQGYEVEGLFMKNWEEDDGTE---YCTAMDDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAM 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+
Sbjct: 123 MLGADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  G+I    G+++G
Sbjct: 178 LEKPEVRAIAEKHQLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIKTTEGEVIG 235

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           RH+G++ +TIGQR+GLG+        EP +V+  D   + +IV        L    +   
Sbjct: 236 RHHGLMYHTIGQRQGLGIGGLKDAGEEPWYVLVKDLEHNELIVGQGNDHPWLFSRALLAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           +I W+        + +  +   K+R  Q   P  +++   G    F+  +  V  GQ+ V
Sbjct: 296 DIYWVNPI----DLGEPRRLTAKVRYRQSDQPCTLEKTATGYRATFDDPQRAVTPGQSVV 351

Query: 367 FYTSDSNEARVLGGGIISGSKRS 389
           FY  +      LGGG+I  ++  
Sbjct: 352 FYDGEI----CLGGGVIEVAEPW 370


>gi|315303264|ref|ZP_07873908.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria ivanovii FSL F6-596]
 gi|313628376|gb|EFR96865.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria ivanovii FSL F6-596]
          Length = 371

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 199/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +     D+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTKNSDIRVVVGMSGGVDSSVTAHLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLNEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q+QL  + FPLG
Sbjct: 118 ESLGADFVATGHYAQVKQVGDE-----IELLRGVDNNKDQTYFLNQLSQEQLQKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A + GL  A+K DS  ICF+ +  +   +       A  G +  LNG++L
Sbjct: 173 GMEKSEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGKMQTLNGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLTENILFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           +  +     A     +C  K R  Q    V V   +D+   V F +    +  GQA VFY
Sbjct: 291 FTTNA----AKPKTIECTAKFRYRQTDTKVTVHLRDDNTAEVVFAEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++ A
Sbjct: 347 DGDI----CLGGGTIDTVWKNGA 365


>gi|205374227|ref|ZP_03227026.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus coahuilensis m4-4]
          Length = 371

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 141/383 (36%), Positives = 199/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K PKD RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKAPKDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVANQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            +LGAD LATGHY +     G+       M R  D  +DQ+YFL   +Q  L  + FP+G
Sbjct: 118 MKLGADYLATGHYAQVEERDGE-----IKMLRGKDENKDQTYFLNQLSQDVLKKVLFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K  VR++A+E GL  A K DS  ICF+ +  + + + +     A  G +  L+G++ 
Sbjct: 173 SLDKSRVREIAKEAGLATATKKDSTGICFIGERNFKEFLGQYLP--AQPGTMETLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H G++ +TIGQR GLG+   GEP F V  D   + + V      +SL    I   +I+
Sbjct: 231 GQHEGLMYHTIGQRHGLGIGGAGEPWFAVGKDLERNVLFVEQGFDHDSLYSTSILATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFY 368
           W  D   E      F C  K R  Q    V V+  +++ V V F++    V  GQA VFY
Sbjct: 291 WTSDFPKE----QEFHCTAKFRYRQSDNSVTVKLLDNNKVEVIFDEPIRAVTPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I        
Sbjct: 347 DGDV----CLGGGTIDEIFNQGK 365


>gi|322375113|ref|ZP_08049627.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. C300]
 gi|321280613|gb|EFX57652.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. C300]
          Length = 415

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 45  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 101

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 102 AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 161

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 162 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 217

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 218 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 275

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 276 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 335

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 336 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 391

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 392 DGE----ECLGGGLIDNAYRDGQV 411


>gi|197284773|ref|YP_002150645.1| tRNA-specific 2-thiouridylase MnmA [Proteus mirabilis HI4320]
 gi|227357779|ref|ZP_03842128.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Proteus mirabilis ATCC 29906]
 gi|229486421|sp|B4EVG2|MNMA_PROMH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|194682260|emb|CAR41993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Proteus mirabilis HI4320]
 gi|227162108|gb|EEI47122.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Proteus mirabilis ATCC 29906]
          Length = 367

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 127/378 (33%), Positives = 200/378 (52%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK  GY V+G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKEQGYQVVGLFMKNWEEDDDTE---YCSASADLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F S Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTINFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEYAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R R     D   +  + R +D  +DQSYFL+  + QQ+    FP+G+M
Sbjct: 120 LGADYIATGHYVRRR-----DIDGKSQLLRGVDNNKDQSYFLYTLSHQQIAQSLFPVGEM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G IV ++G+ +G 
Sbjct: 175 EKPEVRKIAEKLDLATAKKKDSTGICFIGERKFTDFLSRYLP--AKPGPIVTVDGETIGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ +IV             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGSEDPWYVVDKDVANNILIVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+      + + + F+C VK R  Q  +P  V   ++D + V F+     V  GQ+ V
Sbjct: 293 LHWVA----REPITEAFRCTVKTRYRQADIPCTVTPLDEDKIEVRFDYPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEV----CLGGGIIE 362


>gi|86751223|ref|YP_487719.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           HaA2]
 gi|86574251|gb|ABD08808.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris HaA2]
          Length = 402

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 216/391 (55%), Positives = 274/391 (70%), Gaps = 4/391 (1%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
             T LNSLDL   P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RK
Sbjct: 2   TDTMLNSLDLAGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+V
Sbjct: 62  GACCAGQDIHDARDVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSV 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++Q
Sbjct: 122 KFRDLLATARELGASALATGHYVSSRRLAD----GSRALICAADRDRDQSYFLFATTREQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   RDLAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+
Sbjct: 178 LDFLRFPLGDMTKPQTRDLARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGE 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV LNG++LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI 
Sbjct: 238 IVDLNGRVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRRVVVGPREALRMERIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR++NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQA
Sbjct: 298 LRDVNWIGDGALDRAVGDGLELFVRVRSTRAPQPAWLRAVKGGYEVELVAGEEGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEES 395
           CVFY +   +ARVLGGG I  +      E +
Sbjct: 358 CVFYDAAEGQARVLGGGFIKSAAPRSIAEPA 388


>gi|323490019|ref|ZP_08095240.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Planococcus donghaensis MPA1U2]
 gi|323396315|gb|EGA89140.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Planococcus donghaensis MPA1U2]
          Length = 371

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 133/382 (34%), Positives = 191/382 (50%), Gaps = 21/382 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTKAPQDTRVVVGMSGGVDSSVAAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY +              M R  D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 LSLGADYLATGHYAQVEHA----ENGETKMLRGKDNNKDQTYFLNQLDQHQLSKVMFPIG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K+ VR++A E  L  A K DS  ICF+ +  + + + +     A  G +  L G  +
Sbjct: 174 HMEKKKVREIALEAELATATKKDSTGICFIGERNFKEFLGQYLP--AQPGQMETLEGVKM 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G H+G++ YTIGQR+GLG+   G+P FV+  D   + + VG            +    ++
Sbjct: 232 GTHDGLMYYTIGQRQGLGIGGAGDPWFVIGKDLERNVLYVGQNIHHDALFSDSLTAVNLS 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           +              +C  K R  Q  V V V+   +   V F +    +  GQA VFY 
Sbjct: 292 FTS----NTPPSGILECTAKFRYRQQDVGVSVEFKGESAIVTFAEPVRAITPGQAVVFYD 347

Query: 370 SDSNEARVLGGGIISGSKRSDA 391
            +      LGGG I    ++ A
Sbjct: 348 GE----ECLGGGTIDHVFKNGA 365


>gi|26990719|ref|NP_746144.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas putida KT2440]
 gi|37999625|sp|Q88FR9|MNMA_PSEPK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|24985713|gb|AAN69608.1|AE016594_5 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas putida KT2440]
          Length = 374

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 126/386 (32%), Positives = 196/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   Q++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGALTELLKGLDPNKDQSYFLHAVGGQEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGDIETTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDASDEPWYVLHKDLARNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      ++R   G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPV----DLGSPRQLTAKVRYRQSDQRCTLERTASGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIEAAEPWSPRA 374


>gi|70731250|ref|YP_260991.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas fluorescens Pf-5]
 gi|123654441|sp|Q4K9U2|MNMA_PSEF5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|68345549|gb|AAY93155.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas fluorescens Pf-5]
          Length = 377

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 123/390 (31%), Positives = 197/390 (50%), Gaps = 26/390 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             + +  RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A  D+ 
Sbjct: 6   PSDTQKKRVIVGMSGGVDSSVSALLLMEQGYQVEGLFMKNWEEDDGTE---YCTAMDDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAM 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+
Sbjct: 123 MLGADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  G+I    G+++G
Sbjct: 178 LEKPEVRAIAEKHDLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIKTTEGEVIG 235

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           RH+G++ +TIGQR+GLG+        EP +V+  D   + +IV        L    +   
Sbjct: 236 RHHGLMYHTIGQRQGLGIGGLKDAGEEPWYVLIKDLEHNELIVGQGNDHPWLFSRALLAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           +I W+        +    +   K+R  Q   P  +++  +G    F+  +  V  GQ+ V
Sbjct: 296 DIYWVNPI----DLSLPRRLTAKVRYRQSDQPCTLEKTTNGYRATFDDPQRAVTPGQSVV 351

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVEESL 396
           FY  +      LGGG+I  ++   + +   
Sbjct: 352 FYDGEI----CLGGGVIEVAEPWSSKDARP 377


>gi|313498097|gb|ADR59463.1| MnmA [Pseudomonas putida BIRD-1]
          Length = 374

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 125/386 (32%), Positives = 196/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLDEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   +++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGTLTELLKGLDPNKDQSYFLHAVGGKEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGDIETTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDASDEPWYVLHKDLARNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      ++R   G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPV----DLGSPRQLTAKVRYRQSDQRCTLERTASGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIEAAEPWSPRA 374


>gi|148547054|ref|YP_001267156.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas putida F1]
 gi|166235073|sp|A5W1G2|MNMA_PSEP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|148511112|gb|ABQ77972.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas putida F1]
          Length = 374

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 125/386 (32%), Positives = 196/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   Q++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGALTELLKGLDPNKDQSYFLHAVGGQEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGDIETTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   +
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDASDEPWYVLHKDLARNVLVVGQGNEHPWLFSRALLASD 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +    +   K+R  Q      ++R   G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPV----DLGSPRQLTAKVRYRQSDQRCTLERTASGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIEAAEPWSPRA 374


>gi|91978423|ref|YP_571082.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisB5]
 gi|91684879|gb|ABE41181.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisB5]
          Length = 402

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 218/405 (53%), Positives = 280/405 (69%), Gaps = 12/405 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
             + LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RK
Sbjct: 2   TESMLNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRK 61

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+V
Sbjct: 62  GACCAGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSV 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++Q
Sbjct: 122 KFRDLLATARELGASALATGHYVSSRRLDD----GSRALICAADRDRDQSYFLFATTREQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+
Sbjct: 178 LDFLRFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGE 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV LNG +LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI 
Sbjct: 238 IVDLNGHVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAAHRRVVVGPREALRMERIV 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           LR++NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQA
Sbjct: 298 LRDVNWIGDGAIDQAVGDGLELFVRVRSTRAPQPAWLRAVGGGYEVELVAGEEGVSPGQA 357

Query: 365 CVFYTSDSNEARVLGGGIISGS--------KRSDAVEESLLSVIG 401
           CVFY +   +ARVLGGG I  +         R DA   +L ++ G
Sbjct: 358 CVFYDAADGQARVLGGGFIKSAAPRWSADGVRDDAASPALAAMRG 402


>gi|171778579|ref|ZP_02919706.1| hypothetical protein STRINF_00558 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282802|gb|EDT48226.1| hypothetical protein STRINF_00558 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 406

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 134/385 (34%), Positives = 190/385 (49%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 35  TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 91

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 92  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 151

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG +
Sbjct: 152 LGADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLEKVMFPLGHL 207

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           KK  VR +A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 208 KKPEVRKIAERAGLVTAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTVDGRDMGE 265

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+         P FVV  D + + + V      ESL    +    
Sbjct: 266 HAGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSKNILYVGQGFYHESLMSTSLDASS 325

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +   K R  Q    V V    D   V F++ +  +  GQA VF
Sbjct: 326 IHFTRDMPEE----FTMEVTAKFRYRQPDSKVTVHVKGDKAEVIFDEPQRAITPGQAVVF 381

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  +      LGGGII  + ++   
Sbjct: 382 YDGE----ECLGGGIIDMAYKNGVA 402


>gi|205822083|sp|Q2ISK2|MNMA_RHOP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 215/387 (55%), Positives = 273/387 (70%), Gaps = 4/387 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLAGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRLAD----GSRALICAADRDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   RDLAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRDLARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR++
Sbjct: 238 NGRVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRRVVVGPREALRMERIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAVGDGLELFVRVRSTRAPQPAWLRAVKGGYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEES 395
            +   +ARVLGGG I  +      E +
Sbjct: 358 DAAEGQARVLGGGFIKSAAPRSIAEPA 384


>gi|306826063|ref|ZP_07459399.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304431779|gb|EFM34759.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 415

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 45  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 101

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 102 AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 161

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 162 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 217

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 218 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 275

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 276 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 335

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 336 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 391

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R+  V
Sbjct: 392 DGE----ECLGGGLIDNAYRNGKV 411


>gi|315612257|ref|ZP_07887171.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis ATCC 49296]
 gi|315315650|gb|EFU63688.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis ATCC 49296]
          Length = 415

 Score =  366 bits (940), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 136/403 (33%), Positives = 197/403 (48%), Gaps = 36/403 (8%)

Query: 9   LNSL--DLDK---------NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS 57
           +N +   ++K         +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++ 
Sbjct: 26  MNRILKGMNKRIDGRLTMSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD 85

Query: 58  RKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPC 117
              +   G C A +D  D   V D I + +Y  ++E+ + + V   F + Y AG TP P 
Sbjct: 86  ---TDENGVCTATEDYKDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPD 142

Query: 118 VDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL 177
           V CN+ +KF   L     LGAD +ATGHY R       D      M R +D  +DQ+YFL
Sbjct: 143 VMCNKEIKFKAFLDYAMTLGADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFL 198

Query: 178 FATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINA 237
              +Q+QL    FPLG ++K  VR LA E GL  A K DS  ICF+ +  + + +     
Sbjct: 199 SQLSQEQLQKTMFPLGHLEKPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP 258

Query: 238 GIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV 292
             A  G ++ ++G+ +G H G++ YTIGQR GLG+         P FVV  D + + + V
Sbjct: 259 --AQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYV 316

Query: 293 ---GPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY 349
                 +SL    +   ++++  +   E       +C  K R  Q    V V    D   
Sbjct: 317 GQGFYHDSLMSTSLEASQVHFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAE 372

Query: 350 VDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAV 392
           V F + +  +  GQA VFY  +      LGGG+I  + R   V
Sbjct: 373 VIFAEPQRAITPGQAVVFYDGE----ECLGGGLIDNAYRDGQV 411


>gi|150391390|ref|YP_001321439.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alkaliphilus metalliredigens QYMF]
 gi|205811141|sp|A6TUB2|MNMA_ALKMQ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|149951252|gb|ABR49780.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alkaliphilus metalliredigens QYMF]
          Length = 369

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 132/383 (34%), Positives = 198/383 (51%), Gaps = 25/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K+PKD +VV+ MSGGVDSSV A  LK  GYDVIG+ ++ ++        G C A +D 
Sbjct: 1   MKKDPKDTKVVIGMSGGVDSSVAALKLKEQGYDVIGIFMKNWDEPD---EYGYCTAAEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVC+ I + +Y  ++E+ +   V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  EDVRRVCEQIGIPYYTVNFEKEYWEKVFQYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            +LGAD LATGHY +     G+       + R +D  +DQ+YFL    Q QL    FP+G
Sbjct: 118 LKLGADYLATGHYAQVDYKDGE-----YRLLRGVDSNKDQTYFLNTLGQYQLSKAMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K+ VR++A    L  A K DS  ICF+ +  + + + +     A  G++  L+G + 
Sbjct: 173 HIDKKKVREMALAHDLVTAKKKDSTGICFIGERNFKEFLSQYLP--AQPGEMRDLSGNVK 230

Query: 254 GRHNGIINYTIGQRRGLGVAMGE---PLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           G+H+G++ +T+GQR+GLG+       P FVV  D  ++ + V   E       + +   +
Sbjct: 231 GKHDGLMYHTLGQRKGLGIGGSGSGEPWFVVSKDLKNNILYVVQGEDHPSLYTYGLLATD 290

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACV 366
           ++W+     E  +   F C  K R  Q    V VQ    D   V F+  +  V  GQA V
Sbjct: 291 LHWVS----EKEIPQTFTCTAKFRYRQPDQNVTVQLTGGDTCKVLFDGPQKAVTPGQAVV 346

Query: 367 FYTSDSNEARVLGGGIISGSKRS 389
           FY  ++     LGGGII  + ++
Sbjct: 347 FYNGEA----CLGGGIIDETIKT 365


>gi|226330495|ref|ZP_03806013.1| hypothetical protein PROPEN_04413 [Proteus penneri ATCC 35198]
 gi|225201290|gb|EEG83644.1| hypothetical protein PROPEN_04413 [Proteus penneri ATCC 35198]
          Length = 367

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 125/378 (33%), Positives = 198/378 (52%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK  GY V+G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKEQGYQVVGLFMKNWEEDDDTE---YCSASTDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  Y  ++   + + V   F S Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELYTINFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEYAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R R     D   +  + R +D  +DQSYFL+  + +Q+    FP+G+M
Sbjct: 120 LGADYIATGHYVRRR-----DINGKSQLLRGVDNNKDQSYFLYTLSHEQIAQSLFPVGEM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++G+ +G 
Sbjct: 175 EKPEVRKIAEKLDLATAKKKDSTGICFIGERKFTDFLSRYLP--AKPGPIITVDGETIGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +VV  D  ++ +IV             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGGDDPWYVVDKDVENNILIVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+      + + + F+C VK R  Q  +   V   ++D + V F+     V  GQ+ V
Sbjct: 293 LHWVS----REPITEAFRCTVKTRYRQPDIACTVTPLSEDKIEVRFDYPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEV----CLGGGIIE 362


>gi|170722583|ref|YP_001750271.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas putida W619]
 gi|205816891|sp|B1JBJ1|MNMA_PSEPW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|169760586|gb|ACA73902.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas putida W619]
          Length = 374

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 123/386 (31%), Positives = 194/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 7   KDPAKTRVIVGMSGGVDSSVSALLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLAD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     
Sbjct: 64  AQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALS 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD++ATGHY+R R     D      + + +D  +DQSYFL A   +++    FP+G++
Sbjct: 124 LGADLIATGHYVRRR-----DTGAVTELLKGLDPNKDQSYFLHAVGGKEIARTLFPVGEL 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  G+I    G+++GR
Sbjct: 179 EKPEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIQTTEGEVIGR 236

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H+G++ +TIGQR+GLG+        EP +V++ D   + ++V        L    +   E
Sbjct: 237 HHGLMYHTIGQRQGLGIGGLKDAGDEPWYVLHKDLTRNVLVVGQGNEHPWLFSRALLASE 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+        +        K+R  Q      +   + G    F++ +  V  GQ+ VF
Sbjct: 297 IFWVNPI----DLSSPRTLTAKVRYRQSDQRCTLALTESGYRAVFDEPQRAVTPGQSVVF 352

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVE 393
           Y  +      LGGG+I  ++      
Sbjct: 353 YDGEV----CLGGGVIETAEPWSPRA 374


>gi|218289827|ref|ZP_03494027.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218240118|gb|EED07303.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 365

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 137/376 (36%), Positives = 195/376 (51%), Gaps = 20/376 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RVVV MSGGVDSSV A LLK+ GYDVIGV ++ ++    +   G+C A QD  D RRVC
Sbjct: 3   TRVVVGMSGGVDSSVTALLLKQAGYDVIGVFMKNWDE---TDENGACTAEQDFEDVRRVC 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I + +Y  ++E  +   V   F   +  G TP P V CNR +KF +LL+    LGAD 
Sbjct: 60  EQIGIPYYGVNFEREYEERVFQHFLEEFRRGRTPNPDVLCNREIKFKELLACALDLGADY 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY + R            + R  D  +DQ+YFL   TQ  L    FP+G + K  V
Sbjct: 120 LATGHYAQVRQL----EDGSVALVRGRDKNKDQTYFLHMLTQAPLRRAMFPIGHLTKPEV 175

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +AR+ GL +A K DS  ICF+ +  +   +++     A  G I  ++G++LG H+G++
Sbjct: 176 RQIARDHGLHVAQKKDSTGICFIGERNFRAFLQQYLP--AQPGLIEDVDGRVLGEHDGLM 233

Query: 261 NYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL 315
            YTIGQR+GL +         P FVV  D   + ++V                + +   +
Sbjct: 234 YYTIGQRKGLRLGGLPGRDPAPWFVVDKDLARNVLVVAQGHDHPRLYSRALSADTVS-FV 292

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNE 374
            E    + F+C  K R  QD  PV V+   +D   V F++ +  +  GQ+ VFY  D   
Sbjct: 293 AERPPAERFRCTAKFRYRQDDQPVKVEMTGEDTCRVIFDEPQRAITPGQSVVFYDGDI-- 350

Query: 375 ARVLGGGIISGSKRSD 390
              LGGGII+  +  D
Sbjct: 351 --CLGGGIIASREPVD 364


>gi|146282652|ref|YP_001172805.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas stutzeri A1501]
 gi|166235074|sp|A4VLW2|MNMA_PSEU5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|145570857|gb|ABP79963.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas stutzeri A1501]
          Length = 375

 Score =  366 bits (939), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 128/381 (33%), Positives = 197/381 (51%), Gaps = 26/381 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
            P+  RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA
Sbjct: 8   APEKTRVIVGMSGGVDSSVSALLLLEQGYQVEGLFMKNWEEDDGTE---YCTAKEDLADA 64

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           + VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     L
Sbjct: 65  QAVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALML 124

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +QL    FP+G+++
Sbjct: 125 GADLIATGHYVRRR-----DRDGRSELLKGLDPNKDQSYFLHAVGGEQLAKTLFPVGELE 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  G+I  ++G+++GRH
Sbjct: 180 KPEVRAIAEKHSLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGNIEAVDGEVIGRH 237

Query: 257 NGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
           +G++ +TIGQR+GLG+        EP +V+  D   + +IV        L    +   EI
Sbjct: 238 HGLMYHTIGQRQGLGIGGLKDASDEPWYVLSKDLQRNVLIVGQGNDHPWLFSRALLASEI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
            W+        +    K   K+R  Q      +++  DG    FE  +  V  GQ+ VFY
Sbjct: 298 YWVNPV----DLSAPLKLTAKVRYRQSDQACTLEQTSDGYRAVFEVPQRAVTPGQSVVFY 353

Query: 369 TSDSNEARVLGGGIISGSKRS 389
             +      LGGG+I  ++  
Sbjct: 354 DGEV----CLGGGVIEQAEPW 370


>gi|170743223|ref|YP_001771878.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium sp. 4-46]
 gi|205816883|sp|B0UIW7|MNMA_METS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|168197497|gb|ACA19444.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium sp. 4-46]
          Length = 382

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 217/388 (55%), Positives = 272/388 (70%), Gaps = 11/388 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P+D RVVVAMSGGVDSSVVA LL+R GYDV+G+TLQLY+   A+ R+G+CC
Sbjct: 1   MNSLDLPKAPQDTRVVVAMSGGVDSSVVAGLLRRQGYDVVGITLQLYDHGAATHRRGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARR  +T+ + HYV DYE+RFR AVI  FA SY  GETP+PCV+CNR++KF D
Sbjct: 61  AGQDIHDARRAAETLGIPHYVLDYEDRFREAVIDRFAESYIHGETPIPCVECNRSIKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+    LGAD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLATALDLGADALATGHYVASRARPG----GGRALYRALDPARDQSYFLYATTPEQLDVL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K+  R LARE GL +ADK DSQDICFV QG+Y DV+ R+    A  G+IVHL
Sbjct: 177 RFPLGELPKDETRRLAREFGLAVADKPDSQDICFVPQGRYQDVIARLRPDAARPGEIVHL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH GII +T+GQRRGLG+A GEPL+VV LD  ++RV+VGPRE+L    I + E 
Sbjct: 237 DGRTLGRHEGIIGFTVGQRRGLGLATGEPLYVVRLDPETARVVVGPREALATSVIRIAET 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACV 366
           NWLGD    D  +DG    V++RS+++P P  ++ N       V  E  E GV+ GQAC 
Sbjct: 297 NWLGDEPLAD--LDGMPVAVRVRSTREPRPAALRWNRALACAEVVLETPEDGVSPGQACA 354

Query: 367 FYTSDSNEARVLGGGII---SGSKRSDA 391
            Y  D   ARVLGGG I     ++R  A
Sbjct: 355 IYADDGPRARVLGGGTIQKVEAARREAA 382


>gi|205822155|sp|Q131Q8|MNMA_RHOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 218/401 (54%), Positives = 279/401 (69%), Gaps = 12/401 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRLDD----GSRALICAADRDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG +LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR++
Sbjct: 238 NGHVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAAHRRVVVGPREALRMERIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGAIDQAVGDGLELFVRVRSTRAPQPAWLRAVGGGYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS--------KRSDAVEESLLSVIG 401
            +   +ARVLGGG I  +         R DA   +L ++ G
Sbjct: 358 DAADGQARVLGGGFIKSAAPRWSADGVRDDAASPALAAMRG 398


>gi|326794627|ref|YP_004312447.1| tRNA-specific 2-thiouridylase mnmA [Marinomonas mediterranea MMB-1]
 gi|326545391|gb|ADZ90611.1| tRNA-specific 2-thiouridylase mnmA [Marinomonas mediterranea MMB-1]
          Length = 371

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 120/389 (30%), Positives = 194/389 (49%), Gaps = 29/389 (7%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NS +      + +V+V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C 
Sbjct: 1   MNSSE---QNSNTKVIVGMSGGVDSSVSALLLMQQGYQVEGLFMKNWDEDDGTE---YCT 54

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           A +D+ DA+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF  
Sbjct: 55  AKEDLADAQAVCDKLGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIKFKA 114

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
            L     L AD +ATGHY+R     G D     ++ + +D  +DQSYFL+A  + ++   
Sbjct: 115 FLEYAMALKADYIATGHYVR----KGFDENGNALLLKGLDNNKDQSYFLYAVGKGEIAKT 170

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
            FP+G+++K  VR LA E  L   +K DS  ICF+ + ++ D +++     A  GDI  L
Sbjct: 171 FFPVGELEKPEVRRLAEEHDLITHNKKDSTGICFIGERRFKDFLEQYLP--AQPGDIETL 228

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EV 300
            G  +GRH+G++ +TIGQR+GLG+        EP +VV  D   + + V           
Sbjct: 229 EGDKIGRHHGLMYHTIGQRQGLGIGGLSKYPDEPWYVVAKDLERNVLQVTQGGQHPSLYK 288

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGV 359
             +     +W+      +       C  K R  Q      + +  D  + V F + +  +
Sbjct: 289 THLIADNFDWVA----REKPSLPLTCKAKCRYRQPDQDCTISELKDGRIEVSFSEPQRAI 344

Query: 360 ASGQACVFYTSDSNEARVLGGGIISGSKR 388
             GQ+ VFY  ++     LGGGII+ +  
Sbjct: 345 TPGQSVVFYLDEN----CLGGGIINIAFN 369


>gi|205822308|sp|A7HV69|MNMA_PARL1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 399

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 217/368 (58%), Positives = 263/368 (71%), Gaps = 9/368 (2%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
            T LNSLDL   P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A  RKG
Sbjct: 1   MTGLNSLDLPGRPEDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGAAVSRKG 60

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAGQD+ DARRV D I + HYV DYE+RFR AV+  FA SYAAGETP+PCV CN  VK
Sbjct: 61  ACCAGQDIQDARRVADQIGIPHYVLDYEDRFRRAVMDDFADSYAAGETPIPCVRCNERVK 120

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLL   R LGA  LATGHYI SR      G   R + RP D ERDQSYFLFATTQ+QL
Sbjct: 121 FRDLLDTARDLGAAALATGHYIASRR-----GAAGRELHRPRDEERDQSYFLFATTQEQL 175

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG++ K   R LA  MGL++A K DSQDICFV  G+Y  +V+++  G +  G++
Sbjct: 176 EFLRFPLGELTKPEARALADRMGLEVAGKPDSQDICFVPTGRYTTIVEKLRPGASAPGEV 235

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPL----FVVYLDKNSSRVIVGPRESLEVH 301
           VHL+G++LGRH+GI+N+TIGQRRGLG+   EP+    FVV LD    +VIVGPRE+LE  
Sbjct: 236 VHLDGRVLGRHSGIVNFTIGQRRGLGIGASEPVSEPLFVVKLDPLKRQVIVGPREALETQ 295

Query: 302 RIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVAS 361
           ++ LR+INWLGDG F +   +G K   K+RS++ PVP  + R  +G  V+  +SE GVA 
Sbjct: 296 KLTLRDINWLGDGPFAELPGEGLKIVAKVRSTRPPVPARLFRTGEGAVVELLESEGGVAP 355

Query: 362 GQACVFYT 369
           GQACVFY 
Sbjct: 356 GQACVFYD 363


>gi|322391188|ref|ZP_08064660.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus peroris ATCC 700780]
 gi|321145941|gb|EFX41330.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus peroris ATCC 700780]
          Length = 453

 Score =  365 bits (938), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 83  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 139

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 140 AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 199

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 200 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 255

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 256 KPEVRKIAEEAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTVDGRDMGEH 313

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      E+L    +   ++
Sbjct: 314 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHEALMSTSLEASQV 373

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 374 HFTRDMPEE----FTLECIAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 429

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 430 DGE----ECLGGGLIDNAYRDGKV 449


>gi|209884347|ref|YP_002288204.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oligotropha carboxidovorans OM5]
 gi|229486419|sp|B6JCC3|MNMA_OLICO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209872543|gb|ACI92339.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oligotropha carboxidovorans OM5]
          Length = 393

 Score =  365 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 212/381 (55%), Positives = 269/381 (70%), Gaps = 4/381 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P   RVVVAMSGGVDSS  AALLK +GYDVIG+TLQLY+  +A+ RKG+CC
Sbjct: 2   LNSLDLEGPPSSTRVVVAMSGGVDSSTTAALLKAEGYDVIGITLQLYDHGEATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDRFAESYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGA  LATGHY+ SR          R M    D +RDQSYFLFATTQ QL  L
Sbjct: 122 LLTTAQELGAQALATGHYVASRRQPD----GSRAMVCAADADRDQSYFLFATTQDQLNHL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR   L +A+K DSQDICFV  G+Y DV++R+     L GDIV L
Sbjct: 178 RFPLGDMTKAQTRELARRFDLPVAEKHDSQDICFVPTGRYTDVIERMRPNAMLPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
            G++LG H GI N+T+GQRRG+G+A   PL+VV LD  S +VIVGPR +L  + I LR+I
Sbjct: 238 RGRVLGHHQGIANFTVGQRRGIGIAASMPLYVVALDAASRQVIVGPRAALRKNLITLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG F+D   +G   ++K+RS++ P P  ++ N D   V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGTFDDVAREGRDLYIKVRSTRPPQPAHLRMNGDHCEVELFAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRS 389
            + + +ARVLGGG I+ +  +
Sbjct: 358 DAPTGQARVLGGGFITHASNN 378


>gi|152989329|ref|YP_001347945.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas aeruginosa PA7]
 gi|205816889|sp|A6V4G0|MNMA_PSEA7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|150964487|gb|ABR86512.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas aeruginosa PA7]
          Length = 375

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 126/381 (33%), Positives = 200/381 (52%), Gaps = 26/381 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  RV+V MSGGVDSSV A LL++ GY V G+ ++ ++    ++    C A +D+ DA+
Sbjct: 8   PRRERVIVGMSGGVDSSVSALLLQQQGYQVEGLFMKNWDEDDGTE---YCTAREDLADAQ 64

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LG
Sbjct: 65  AVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLG 124

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K
Sbjct: 125 ADLIATGHYVRRR-----DLDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEK 179

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GRH+
Sbjct: 180 PEVRAIAEKHGLATAKKKDSTGICFIGERRFTDFLKQYLP--AQPGDIETTEGKVIGRHS 237

Query: 258 GIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G++ +TIGQR+GLG+        +P +V+  D   + ++VG            +    I 
Sbjct: 238 GLMYHTIGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIY 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+     E       +   K+R  Q      +++  DG    F++ +  V  GQ+ VFY 
Sbjct: 298 WVNPVELE----RPRRLRAKVRYRQSDQDCVLEKTADGYRAVFDEPQRAVTPGQSVVFYD 353

Query: 370 SDSNEARVLGGGIISGSKRSD 390
            +      LGGG+I  ++  D
Sbjct: 354 GEV----CLGGGVIETAEAWD 370


>gi|294501356|ref|YP_003565056.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus megaterium QM B1551]
 gi|294351293|gb|ADE71622.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus megaterium QM B1551]
          Length = 370

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 140/382 (36%), Positives = 204/382 (53%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K+PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTKSPKDTRVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R     G+       M R +D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MTLGADYLATGHYARVAYRDGE-----YKMLRGVDGNKDQTYFLNQLGQDQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E GL  A K DS  ICF+ +  + + + +     A  G +  L+G++ 
Sbjct: 173 EIEKSKVREIAKEAGLATATKKDSTGICFIGERNFKEFLSQYLP--AQPGVMQTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +    ++
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGSGEPWFVVGKDLEKNVLYVDQGFHNELLYSTSLTATNVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +  +         C  K R  Q    V V++ +DD + V F +    +  GQA VFY
Sbjct: 291 WVSERDWS----SPMTCTAKFRYRQTDSAVTVEKVDDDTIKVIFAEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      LGG  I    + +
Sbjct: 347 KDD----ECLGGATIDKVFQEE 364


>gi|172058087|ref|YP_001814547.1| tRNA-specific 2-thiouridylase MnmA [Exiguobacterium sibiricum
           255-15]
 gi|205816866|sp|B1YJE9|MNMA_EXIS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|171990608|gb|ACB61530.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Exiguobacterium sibiricum 255-15]
          Length = 374

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 133/382 (34%), Positives = 198/382 (51%), Gaps = 23/382 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K P++  VVV MSGGVDSSV A LLK+ GY+VIG+ ++ ++    +   G C A +D  D
Sbjct: 6   KAPEETTVVVGMSGGVDSSVTAYLLKQQGYNVIGIFMKNWDD---TDENGFCTATEDYED 62

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 63  VIAVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLDHAMR 122

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R+    G+       + R +D  +DQ+YFL   +Q Q+    FP+G M
Sbjct: 123 LGADFVATGHYARAVYEDGE-----HKLLRGVDTNKDQTYFLNQLSQDQIAKAMFPIGHM 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  +   + +     A  G++  L+G+ +GR
Sbjct: 178 EKSEVRKIAEEANLATAKKKDSTGICFIGERNFKQFLSQYLP--AQPGEMRTLDGKTMGR 235

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWL 311
           H+G++ YT+GQR GLG+   GEP FVV  +   + + V      E L    +Y  +I+W 
Sbjct: 236 HDGLMYYTMGQRHGLGIGGDGEPWFVVGKNLQDNILFVEQGFHNELLYSEGLYASDISWT 295

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
                       F+C  K R  Q   PV V+  D G + V F++ +  +  GQA VFY  
Sbjct: 296 ATM----PAGTEFRCTAKFRYRQTDTPVTVRVLDGGRLDVAFDERQRAITPGQAVVFYDG 351

Query: 371 DSNEARVLGGGIISGSKRSDAV 392
           D      LGG  I  + ++   
Sbjct: 352 DV----CLGGATIDDAYKAGQA 369


>gi|254974826|ref|ZP_05271298.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-66c26]
 gi|255092214|ref|ZP_05321692.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CIP 107932]
 gi|255100299|ref|ZP_05329276.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-63q42]
 gi|255306238|ref|ZP_05350410.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile ATCC 43255]
 gi|255313953|ref|ZP_05355536.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-76w55]
 gi|255516633|ref|ZP_05384309.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-97b34]
 gi|255649732|ref|ZP_05396634.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-37x79]
 gi|260682888|ref|YP_003214173.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CD196]
 gi|260686486|ref|YP_003217619.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile R20291]
 gi|260209051|emb|CBA62172.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CD196]
 gi|260212502|emb|CBE03431.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile R20291]
          Length = 359

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 220/368 (59%), Gaps = 12/368 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
           + +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV
Sbjct: 2   NKKVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDVVEIEGGCCSLSAVEDARRV 61

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D
Sbjct: 62  ANKIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCD 121

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ 
Sbjct: 122 YVATGHYAKIEK---DESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDR 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI
Sbjct: 179 VREIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E L    +  +++N++     E  
Sbjct: 239 LYYTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNEDLFKKELIAKDVNFISIDTLE-- 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             +  +   KIR S  P P  + R  +D + + F++++  +  GQ+ V Y  D     V+
Sbjct: 297 --EPLRVQAKIRYSAKPSPATIHRVGEDTIKIVFDEAQRAITKGQSVVMYDGDI----VV 350

Query: 379 GGGIISGS 386
           GGGII  S
Sbjct: 351 GGGIIEKS 358


>gi|126698878|ref|YP_001087775.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile 630]
 gi|123174593|sp|Q18BE2|MNMA_CLOD6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|115250315|emb|CAJ68137.1| transfer RNA-specific 2-thiouridylase MnmA [Clostridium difficile]
          Length = 361

 Score =  365 bits (937), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 220/368 (59%), Gaps = 12/368 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
           + +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV
Sbjct: 4   NKKVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDVVEIEGGCCSLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D
Sbjct: 64  ANKIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ 
Sbjct: 124 YVATGHYAKIEK---DESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDR 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI
Sbjct: 181 VREIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E L    +  +++N++     E  
Sbjct: 241 LYYTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNEDLFKKELIAKDVNFISIDTLE-- 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             +  +   KIR S  P P  + R  +D + + F++++  +  GQ+ V Y  D     V+
Sbjct: 299 --EPLRVQAKIRYSAKPSPATIHRVGEDTIKIVFDEAQRAITKGQSVVMYDGDI----VV 352

Query: 379 GGGIISGS 386
           GGGII  S
Sbjct: 353 GGGIIEKS 360


>gi|289625417|ref|ZP_06458371.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649300|ref|ZP_06480643.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330866846|gb|EGH01555.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 366

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSALLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DTDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|317128230|ref|YP_004094512.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cellulosilyticus DSM 2522]
 gi|315473178|gb|ADU29781.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cellulosilyticus DSM 2522]
          Length = 367

 Score =  365 bits (936), Expect = 8e-99,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 210/381 (55%), Gaps = 21/381 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++   +++RVVV MSGGVDSSV A LLK++GY VIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNTEKQNIRVVVGMSGGVDSSVAAYLLKQEGYQVIGIFMKNWDD---TDEFGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ +++ +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIRVCNQLDIPYYAVNFEKEYWDKVFTYFLNEYRAGRTPNPDVMCNKEIKFKAFLDHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R R            + R +D  +DQ+YFL A ++ QL  + FP+G
Sbjct: 119 MSLGADYVATGHYARVRHS-----DNGVELLRGIDENKDQTYFLNALSEDQLKHVLFPIG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E  L  A K DS  ICF+ +  + + + +     A  G++  L+G++ 
Sbjct: 174 EIEKPRVREIAKEAHLATATKKDSTGICFIGERNFKEFLSQYLP--AQRGEMQTLDGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G H+G++ YT+GQR+GLG+   GEP FV+  D + + ++VG            +   ++N
Sbjct: 232 GYHDGLMYYTLGQRQGLGIGGAGEPWFVIDKDLDKNILLVGQGYHHPALYSSGLIAEDVN 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+   L +      F C  K R  Q    V V   +DG V V F++ E  +  GQ+ VFY
Sbjct: 292 WINQHLIKGK--KEFHCTAKFRYRQKDQGVTVSIMNDGQVKVIFDEQERAITPGQSVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRS 389
             +      LGGG+I    +S
Sbjct: 350 DGEV----CLGGGVIDKVIKS 366


>gi|322378091|ref|ZP_08052577.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. M334]
 gi|321280928|gb|EFX57942.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. M334]
          Length = 391

 Score =  365 bits (936), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 21  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 77

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 78  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 137

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 138 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 193

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 194 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 251

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 252 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 311

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 312 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 367

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 368 DGE----ECLGGGLIDNAYRDGQV 387


>gi|312961679|ref|ZP_07776177.1| tRNA-specific 2-thiouridylase [Pseudomonas fluorescens WH6]
 gi|311283938|gb|EFQ62521.1| tRNA-specific 2-thiouridylase [Pseudomonas fluorescens WH6]
          Length = 374

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 124/387 (32%), Positives = 198/387 (51%), Gaps = 26/387 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             + +  RV+V MSGGVDSSV A LL   GY+V G+ ++ +     ++    C A  D+ 
Sbjct: 6   PSDTQKKRVIVGMSGGVDSSVSAVLLMEQGYEVEGLFMKNWEEDDGTE---YCTAMDDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAM 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+
Sbjct: 123 MLGADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  G+I    G+++G
Sbjct: 178 LEKPEVRRIAEQHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIKTTEGEVIG 235

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           RH+G++ +TIGQR+GLG+        EP +V+  D  ++ ++VG            +   
Sbjct: 236 RHHGLMYHTIGQRQGLGIGGLKDAGEEPWYVLVKDLENNVLVVGQGNEHPLLFSGALLAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           EI W+        +    +   K+R  Q   P  +++   G    F+  +  V  GQ+ V
Sbjct: 296 EIYWVNPI----DLSVPRRLTAKVRYRQSDQPCTLEKTASGYRATFDDPQRAVTPGQSVV 351

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVE 393
           FY  +      LGGG+I  ++    + 
Sbjct: 352 FYDGEI----CLGGGVIEVAEPWSNLA 374


>gi|168483769|ref|ZP_02708721.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC1873-00]
 gi|172042905|gb|EDT50951.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC1873-00]
          Length = 373

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 136/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG +K
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLK 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|307702622|ref|ZP_07639574.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis ATCC 35037]
 gi|307623738|gb|EFO02723.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis ATCC 35037]
          Length = 373

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYIATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSQNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|15902166|ref|NP_357716.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae R6]
 gi|15457661|gb|AAK98926.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae R6]
          Length = 391

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 21  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 77

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 78  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 137

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG +K
Sbjct: 138 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLK 193

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 194 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 251

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 252 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 311

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 312 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 367

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 368 DGE----ECLGGGLIDNAYRDGQV 387


>gi|330940375|gb|EGH43479.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 366

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                       +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PIDLSSPP----RLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|258510943|ref|YP_003184377.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257477669|gb|ACV57988.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 365

 Score =  364 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 137/379 (36%), Positives = 197/379 (51%), Gaps = 26/379 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RVVV MSGGVDSSV A LLK+ GYDVIGV ++ ++    +   G+C A QD  D RRVC
Sbjct: 3   TRVVVGMSGGVDSSVTALLLKQAGYDVIGVFMKNWDE---TDENGACTAEQDFEDVRRVC 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I + +Y  ++E  +   V   F   +  G TP P V CNR +KF +LL+    LGAD 
Sbjct: 60  EQIGIPYYGVNFEREYEERVFQHFLEEFKRGRTPNPDVLCNREIKFKELLACALDLGADY 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY + R     D      + R  D  +DQ+YFL   TQ  L    FP+G + K  V
Sbjct: 120 LATGHYAQVR----KDEDGTVALLRGRDKNKDQTYFLHMLTQAPLRRAMFPIGHLTKPEV 175

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +AR+ GL +A K DS  ICF+ +  +   +++     A  G I  ++G++LG H+G++
Sbjct: 176 RQIARDHGLHVAQKKDSTGICFIGERNFRAFLQQYLP--AQPGLIEDVDGRVLGEHDGLM 233

Query: 261 NYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLG 312
            YTIGQR+GL +         P FVV  D   + ++V             +    ++++ 
Sbjct: 234 YYTIGQRKGLRLGGLPGRDPAPWFVVDKDLARNVLVVAQGHDHPRLYSRALTADTVSFVA 293

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSD 371
               E      F+C  K R  QD  PV V+   +D   V F++ +  +  GQ+ VFY  +
Sbjct: 294 ----ERPPAKRFRCTAKFRYRQDEQPVEVEMTGEDTCRVIFDEPQRAITPGQSVVFYDGE 349

Query: 372 SNEARVLGGGIISGSKRSD 390
                 LGGGII+  +  D
Sbjct: 350 V----CLGGGIIASREPVD 364


>gi|307710241|ref|ZP_07646684.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK564]
 gi|307619003|gb|EFN98136.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK564]
          Length = 373

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|303260932|ref|ZP_07346881.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP14-BS292]
 gi|303269624|ref|ZP_07355383.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS458]
 gi|301801084|emb|CBW33752.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae INV200]
 gi|302637769|gb|EFL68255.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP14-BS292]
 gi|302640826|gb|EFL71214.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS458]
 gi|332077431|gb|EGI87892.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae GA41301]
          Length = 373

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|114798727|ref|YP_759370.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomonas neptunium ATCC 15444]
 gi|123323559|sp|Q0C4H3|MNMA_HYPNA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|114738901|gb|ABI77026.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomonas neptunium ATCC 15444]
          Length = 394

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 208/394 (52%), Positives = 266/394 (67%), Gaps = 10/394 (2%)

Query: 1   MVVSEAT----RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN 56
           M +  A     R+NSL   K P + RVV AMSGGVDSSVVAA+LK +GYDVIG+TLQLY+
Sbjct: 1   MTIDTAAWPAGRVNSLGFAKPPHETRVVAAMSGGVDSSVVAAMLKAEGYDVIGITLQLYD 60

Query: 57  SRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLP 116
              A ++KG+CCAGQD++DAR V D I + HYV DYE RFR  V+  FA +Y +G TP+P
Sbjct: 61  HGAAIEKKGACCAGQDIHDARNVSDAIGIPHYVLDYESRFREQVMEDFADTYLSGSTPIP 120

Query: 117 CVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF 176
           C+ CN+TVKF+DLL+  ++LGAD LATGHYIR       DG     + R  D  RDQSYF
Sbjct: 121 CIRCNQTVKFADLLATAKELGADCLATGHYIRR-----TDGPEGPELHRAQDASRDQSYF 175

Query: 177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRIN 236
           LFATT+ QL  LRFPLG + K  VR+LA +  L +A K DSQDICFV  G Y  VV+++ 
Sbjct: 176 LFATTRAQLDFLRFPLGSLPKSEVRELAEKFALQVAAKPDSQDICFVPDGSYAKVVEKLR 235

Query: 237 AGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRE 296
            G    G+IVHL+G++LG+H G+I+YTIGQRRGLGVA G+PLFVV +D  + RVIVGPRE
Sbjct: 236 PGSGRGGEIVHLDGRVLGKHEGVIHYTIGQRRGLGVATGDPLFVVKIDAPARRVIVGPRE 295

Query: 297 SLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSE 356
           +L    + L E+NWLG G  E+A   G +  +++RS++ PVP  +   D    V F+  E
Sbjct: 296 ALMTRGLLLEELNWLGQGSLEEAATHGARVLIRVRSTRPPVPGRLGYEDGVPAVFFDAPE 355

Query: 357 VGVASGQACVFYTSDSNEARVLGGGIISGSKRSD 390
            GVA GQA V Y  +    R+LGGG I+    +D
Sbjct: 356 EGVARGQAAVLYDLE-GSTRILGGGFIARPLPAD 388


>gi|146307422|ref|YP_001187887.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas mendocina ymp]
 gi|205816890|sp|A4XUY9|MNMA_PSEMY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|145575623|gb|ABP85155.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas mendocina ymp]
          Length = 370

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 124/379 (32%), Positives = 196/379 (51%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
            P   RV+V MSGGVDSSV A LL   GY V G+ ++ ++    ++    C A  D+ DA
Sbjct: 3   APSTQRVIVGMSGGVDSSVSALLLMEQGYQVEGLFMKNWDEDDGTE---YCTAMDDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           + VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     L
Sbjct: 60  QAVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALSL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++
Sbjct: 120 GADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGELE 174

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  GDI    GQ++GRH
Sbjct: 175 KPQVRAIAEKYELATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGDIETTEGQVIGRH 232

Query: 257 NGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
           +G++ +TIGQR+GLG+        +P +V+  D   + +IV        L    +   +I
Sbjct: 233 HGLMYHTIGQRQGLGIGGLKDASDDPWYVLRKDLTRNVLIVGQGNEHPWLFSRALLASDI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
            W+        +    +   K+R  Q      +++ ++G    F++ +  V  GQ+ VFY
Sbjct: 293 YWVNPV----DLSTPRRLTAKVRYRQSDQACTLEKTENGYRAVFDEPQRAVTPGQSVVFY 348

Query: 369 TSDSNEARVLGGGIISGSK 387
             +      LGGG+I  ++
Sbjct: 349 DGEV----CLGGGVIETAQ 363


>gi|258621706|ref|ZP_05716737.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus VM573]
 gi|258626348|ref|ZP_05721195.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus VM603]
 gi|262171838|ref|ZP_06039516.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus MB-451]
 gi|258581400|gb|EEW06302.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus VM603]
 gi|258585937|gb|EEW10655.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus VM573]
 gi|261892914|gb|EEY38900.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio mimicus MB-451]
          Length = 371

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 124 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDNNKDQSYFLYTLSHEQVARSLFPVGDL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKESNEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RTPITEPLRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEI----CLGGGIIEE 369


>gi|167464004|ref|ZP_02329093.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322382960|ref|ZP_08056792.1| tRNA-specific 2-thiouridylase MnmA-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153080|gb|EFX45538.1| tRNA-specific 2-thiouridylase MnmA-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 364

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 130/374 (34%), Positives = 189/374 (50%), Gaps = 25/374 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
             + R+++ MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D R
Sbjct: 2   NANKRIILGMSGGVDSSVSALLLKEQGYDVIGVFMKNWDD---TVEFGHCTAEEDAEDVR 58

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RVCD + +  Y  ++E+++   V   F + Y  G TP P V CNR +KF + L     LG
Sbjct: 59  RVCDQVGIPFYTVNFEKQYMEKVFSYFLNEYKRGRTPNPDVMCNREIKFGEFLQKGLDLG 118

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
            D +ATGHY R     G+      ++ R  D  +DQ+YFL A  Q QL    FP+G + K
Sbjct: 119 GDYIATGHYARVEERNGE-----YVLLRGNDPNKDQTYFLHALNQFQLSKAMFPIGHLPK 173

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR LA E GL  A K DS  +CF+ +  + + +       A  G++  L G++ GRH+
Sbjct: 174 PEVRKLAEEAGLATAKKKDSTGVCFIGERNFKEFLSNYLP--AKPGEMRTLEGEVKGRHD 231

Query: 258 GIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           G++ YT+GQR+     G   GEP FV   D  ++ + V   E         +   ++NW+
Sbjct: 232 GLMYYTLGQRQGLGIGGSGTGEPWFVADKDLQNNILYVVQGEKHPSLYSTGLSATDVNWI 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTS 370
                E      ++C  K R  Q    V +    D+   V F++ +  V  GQ+ VFY  
Sbjct: 292 SPVKPE----GQYRCTAKFRYRQPDQGVTLTMGADNTCEVIFDEPQKAVTPGQSVVFYDG 347

Query: 371 DSNEARVLGGGIIS 384
           +      LGGGII 
Sbjct: 348 EV----CLGGGIID 357


>gi|307265916|ref|ZP_07547465.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919085|gb|EFN49310.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 376

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 144/390 (36%), Positives = 217/390 (55%), Gaps = 17/390 (4%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           ++    RL +L + KN    RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +   
Sbjct: 1   MIESTRRLENLSMQKNN---RVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEE 57

Query: 62  KR--KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD 119
               +G CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ 
Sbjct: 58  AVRVEGGCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIA 117

Query: 120 CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA 179
           CN+ +KF +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+ 
Sbjct: 118 CNKYIKFEELLKRAWMIDAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYN 174

Query: 180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            TQ QL  + FPLG  KK+ VR LA+ +GL +A K DSQ+ICFV    Y   ++      
Sbjct: 175 LTQTQLEHILFPLGKYKKDEVRKLAQNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEE 234

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLE 299
              G+     G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + + 
Sbjct: 235 IKPGEFRDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVF 294

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVG 358
              +     N++      D +    +   KIR +       ++  +DG V+V F+  +  
Sbjct: 295 GDELISYNNNFISI----DKLEGEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRA 350

Query: 359 VASGQACVFYTSDSNEARVLGGGIISGSKR 388
           +  GQ+ VFY  D     V+GGG I    R
Sbjct: 351 ITPGQSVVFYDGDI----VVGGGTIERKVR 376


>gi|15613824|ref|NP_242127.1| (5-methylaminomethyl-2-thiouridylate)-methyltran sferase [Bacillus
           halodurans C-125]
 gi|14195281|sp|Q9KDF2|MNMA_BACHD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|10173877|dbj|BAB04980.1| (5-methylaminomethyl-2-thiouridylate)- methyltransferase [Bacillus
           halodurans C-125]
          Length = 371

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 137/386 (35%), Positives = 202/386 (52%), Gaps = 23/386 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K P+  RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 4   KRPEQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYQD 60

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +VC+ + +++Y  ++E+ + + V   F   Y AG TP P V CN+ +KF   L+    
Sbjct: 61  VVQVCNQLGIAYYAVNFEKEYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHALT 120

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +   G     +  + R  D  +DQ+YFL A +QQQL  + FPLG +
Sbjct: 121 LGADYVATGHYAQVKNVDG-----QYQLIRGKDPNKDQTYFLNALSQQQLSRVMFPLGHL 175

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A   GL  A K DS  ICF+ +  + + +       A  G++  L+G++ G 
Sbjct: 176 EKKEVRAIAERAGLATAKKKDSTGICFIGKRDFKEFLSSYLP--AQPGEMQTLDGEVKGT 233

Query: 256 HNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YT+GQR+GLG+   GEP FV+  +   + + VG            +   ++NW+
Sbjct: 234 HDGLMYYTLGQRQGLGIGGSGEPWFVIGKNLEKNILYVGQGFHHPGLYSEGLRAIKVNWI 293

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
                     + F+C  K R  Q    V V    DG V V F + +  +  GQA VFY  
Sbjct: 294 ----LRRESDEPFECTAKFRYRQPDQKVTVYPQSDGAVEVLFAEPQRAITPGQAVVFYDG 349

Query: 371 DSNEARVLGGGIISGSKRSDAVEESL 396
           D      LGGG I    +     ES 
Sbjct: 350 DV----CLGGGTIDHVLKKKEDRESA 371


>gi|306828717|ref|ZP_07461909.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis ATCC 6249]
 gi|304428895|gb|EFM31983.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis ATCC 6249]
          Length = 373

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|298487541|ref|ZP_07005583.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298157925|gb|EFH99003.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 376

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 12  KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 69  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 129 IATGHYVRRR-----DTDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 183

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 184 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 241

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 242 YHTIGQRQGLGIGGLKDASDDPWYVLIKDLDNNELIVGQGNDHPWLFSRALVSTEIYWVN 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 302 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 357

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 358 ----CLGGGVIEIAEPW 370


>gi|256822321|ref|YP_003146284.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Kangiella koreensis DSM 16069]
 gi|256795860|gb|ACV26516.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Kangiella koreensis DSM 16069]
          Length = 367

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 132/383 (34%), Positives = 205/383 (53%), Gaps = 27/383 (7%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
           DK P++  V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ 
Sbjct: 3   DKAPENTHVIVGMSGGVDSSVSAYLLKKQGYQVEGLFMKNWEEDDTDE---YCSAAEDLA 59

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD + +     ++   + + V   F   Y AG TP P + CN+ +KF   L   +
Sbjct: 60  DAQAVCDKLGIKLRTVNFAAEYWDRVFEYFLEEYKAGRTPNPDIMCNKEIKFKAFLDYAQ 119

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY+R       +   +  + R +DL +DQSYFL+  + +++    FP+G 
Sbjct: 120 LLGADYIATGHYVRR-----GEADGKATLLRGLDLNKDQSYFLYGVSHEKIAKTLFPVGC 174

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A E GL  A K DS  ICF+ + K+ D +++     A  G+I    G+++G
Sbjct: 175 IEKPEVRKIAEEQGLVTAKKKDSTGICFIGERKFTDFLQQYLP--AQPGNIETPEGEVIG 232

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           +HNG++ +T+GQR+GLG+        EP F +  D   + +IVG          H +   
Sbjct: 233 KHNGLMYHTLGQRKGLGIGGRQDSSEEPWFTLNKDLKRNVLIVGQGHEHPLLMSHGLIAD 292

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
           +++W+      +   D F+C  K R  QD VP  V+R +D    V+F+  +  V  GQ+ 
Sbjct: 293 KLDWIAT----EPPSDEFRCTAKTRYRQDDVPCQVKRLNDTQWLVEFDDKQRAVTPGQSV 348

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           VFY  +      LGGGII   +R
Sbjct: 349 VFYQGEV----CLGGGIIKEIRR 367


>gi|116516757|ref|YP_815643.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae D39]
 gi|30173410|sp|Q8CWW0|MNMA_STRR6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|122279467|sp|Q04MV1|MNMA_STRP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116077333|gb|ABJ55053.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae D39]
          Length = 373

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG +K
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLK 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|15597822|ref|NP_251316.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas aeruginosa PAO1]
 gi|107102147|ref|ZP_01366065.1| hypothetical protein PaerPA_01003197 [Pseudomonas aeruginosa PACS2]
 gi|116050613|ref|YP_790568.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|14195276|sp|Q9I0L2|MNMA_PSEAE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|122259736|sp|Q02NB8|MNMA_PSEAB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|9948693|gb|AAG06014.1|AE004691_5 tRNA methyltransferase [Pseudomonas aeruginosa PAO1]
 gi|115585834|gb|ABJ11849.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 375

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 126/381 (33%), Positives = 199/381 (52%), Gaps = 26/381 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  RV+V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C A +D+ DA+
Sbjct: 8   PRRERVIVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWDEDDGTE---YCTAREDLADAQ 64

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LG
Sbjct: 65  AVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLG 124

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K
Sbjct: 125 ADLIATGHYVRRR-----DRDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEK 179

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GRH+
Sbjct: 180 PEVRAIAEKHGLATAKKKDSTGICFIGERRFTDFLKQYLP--AQPGDIETTEGKVIGRHS 237

Query: 258 GIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G++ +TIGQR+GLG+        +P +V+  D   + ++VG            +    I 
Sbjct: 238 GLMYHTIGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIY 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+     E       +   K+R  Q      +++  +G    F++ +  V  GQ+ VFY 
Sbjct: 298 WVNPVELE----RPRRLRAKVRYRQSDQDCVLEKTAEGYRAVFDEPQRAVTPGQSVVFYD 353

Query: 370 SDSNEARVLGGGIISGSKRSD 390
            D      LGGG+I  ++  D
Sbjct: 354 GDV----CLGGGVIETAEAWD 370


>gi|257485430|ref|ZP_05639471.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|330987933|gb|EGH86036.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 366

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DTDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|261405437|ref|YP_003241678.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus sp. Y412MC10]
 gi|261281900|gb|ACX63871.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus sp. Y412MC10]
          Length = 375

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 136/384 (35%), Positives = 202/384 (52%), Gaps = 23/384 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           + + K   + R+VV MSGGVDSSV A LLK+ GY+VIG+ ++ ++    +   G C A  
Sbjct: 5   ITMSKEKHNTRIVVGMSGGVDSSVTALLLKQQGYEVIGIFMKNWDD---TDELGYCTAEA 61

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D  D RRVC+ +++ +Y  ++E+ + + V   F   Y AG TP P V CNR +KF + L+
Sbjct: 62  DAEDVRRVCEQLDIPYYTVNFEKEYFDKVFSYFLDEYKAGRTPNPDVMCNREIKFGEFLN 121

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
               LGAD +ATGHY R     G     +  + R +D  +DQ+YFL A +Q+QL    FP
Sbjct: 122 KAMDLGADYVATGHYARVIEEDG-----QYRLLRGVDSNKDQTYFLNALSQEQLAKAMFP 176

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NG 250
           +G + K  VR LA E GL  A K DS  +CF+ +  + + + +     A  GD+V +  G
Sbjct: 177 IGHLPKPEVRRLAEEAGLYTAKKKDSTGVCFIGERNFKEFLGQYLP--AQSGDMVDIVTG 234

Query: 251 QILGRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL--EVHRIYL 305
           ++ GRH+G++ YT+GQR+     G   GEP FV   D  ++ + V   +        +  
Sbjct: 235 EVKGRHDGLMYYTLGQRQGLGIGGSGSGEPWFVADKDLTNNILYVVQGDHPSLYSTGLVA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQA 364
             INW+     +    D + C  K R  Q    V +   +DG V+V F K +  +  GQA
Sbjct: 295 SGINWIAG--QDAMPKDAYTCTAKFRYRQPDQEVTITPREDGTVHVAFAKPQKAITPGQA 352

Query: 365 CVFYTSDSNEARVLGGGIISGSKR 388
            VFY  D      LGGG I  + +
Sbjct: 353 VVFYQGD----ECLGGGTIETADK 372


>gi|218891213|ref|YP_002440079.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas aeruginosa LESB58]
 gi|226704774|sp|B7UV15|MNMA_PSEA8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|218771438|emb|CAW27205.1| tRNA methyltransferase [Pseudomonas aeruginosa LESB58]
          Length = 375

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 126/381 (33%), Positives = 200/381 (52%), Gaps = 26/381 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  RV+V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C A +D+ DA+
Sbjct: 8   PRRERVIVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWDEDDGTE---YCTAREDLADAQ 64

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LG
Sbjct: 65  AVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLG 124

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K
Sbjct: 125 ADLIATGHYVRRR-----DRDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEK 179

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI  + G+++GRH+
Sbjct: 180 PEVRAIAEKHGLATAKKKDSTGICFIGERRFTDFLKQYLP--AQPGDIETIEGKVIGRHS 237

Query: 258 GIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G++ +TIGQR+GLG+        +P +V+  D   + ++VG            +    I 
Sbjct: 238 GLMYHTIGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIY 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+     E       +   K+R  Q      +++  +G    F++ +  V  GQ+ VFY 
Sbjct: 298 WVNPVELE----RPRRLRAKVRYRQSDQDCVLEKTAEGYRAVFDEPQRAVTPGQSVVFYD 353

Query: 370 SDSNEARVLGGGIISGSKRSD 390
            D      LGGG+I  ++  D
Sbjct: 354 GDV----CLGGGVIETAEAWD 370


>gi|254519285|ref|ZP_05131341.1| tRNA-specific 2-thiouridylase mnmA [Clostridium sp. 7_2_43FAA]
 gi|226913034|gb|EEH98235.1| tRNA-specific 2-thiouridylase mnmA [Clostridium sp. 7_2_43FAA]
          Length = 360

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/369 (36%), Positives = 214/369 (57%), Gaps = 15/369 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDAR 77
             +VVV MSGGVDSSV A LLK  GY+VIGVT++ ++       +R+G CC+   V DAR
Sbjct: 2   KKKVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMKHFDDEDEDYIEREGGCCSLSSVEDAR 61

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV D + +  YV ++++ F+  VI  F   Y  G+TP PC+ CN+ +KF + L   + +G
Sbjct: 62  RVADKLGIPFYVLNFKDSFKEKVIDYFVQEYMEGKTPNPCIACNKHIKFDEFLRRAKGIG 121

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD +ATGHY +       +   R ++ +  D ++DQ+Y L+  TQ+QL     P GD  K
Sbjct: 122 ADYVATGHYAKIE----KNEDGRYLLIKADDDKKDQTYALYNFTQEQLSQTLMPCGDYTK 177

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           + +R++A+E+GL + +K DS++ICF+    +   +         EG+ V  NG ILG+H 
Sbjct: 178 DKIREIAKEIGLAVHNKKDSEEICFIPDNNHGKYILNARPNQVREGNFVDKNGNILGKHK 237

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI+ YTIGQR+GLG+A+G P+FV  ++  ++ V++GP E +    +  +++N++      
Sbjct: 238 GIVYYTIGQRKGLGLALGTPIFVTDINPRTNEVVIGPEEDVFKTDLVAKDVNFI----PF 293

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +++ +    F K+R    P    +    DG V V F++ +  +  GQ+ VFY  +     
Sbjct: 294 NSLSEEITVFAKVRYQAKPSEAIISPLADGRVKVSFKEKQRAITKGQSVVFYDGNV---- 349

Query: 377 VLGGGIISG 385
           V+GGGII  
Sbjct: 350 VVGGGIIEE 358


>gi|325979485|ref|YP_004289201.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325179413|emb|CBZ49457.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 373

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG ++
Sbjct: 120 GADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G H
Sbjct: 176 KPEVRKIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +    I
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNQPWFVVGKDLSKNILYVGQGFYHDSLMSTSLDASSI 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +   K R  Q    V V    D   V F++ +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTMEVTAKFRYRQPDSKVTVHVKGDKAEVVFDEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGGII  + ++   
Sbjct: 350 DGE----ECLGGGIIDMAYKNGVA 369


>gi|270291927|ref|ZP_06198142.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. M143]
 gi|270279455|gb|EFA25297.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. M143]
          Length = 383

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 13  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 69

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 70  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 129

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 130 GADYVATGHYARV----ARDEDGIVHMLRGVDTGKDQTYFLSQLSQEQLQKTMFPLGHLE 185

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 186 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKEFLSNYLP--AQPGRMMTMDGRDMGEH 243

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 244 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSQNILYVGQGFYHDSLMSTSLEASQV 303

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 304 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 359

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 360 DGE----ECLGGGLIDNAYRDGQV 379


>gi|66046419|ref|YP_236260.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           syringae B728a]
 gi|75501528|sp|Q4ZRK0|MNMA_PSEU2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|63257126|gb|AAY38222.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. syringae B728a]
          Length = 376

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 12  KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 69  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 129 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 183

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 184 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 241

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D  ++ +IV        L    +   EI W+ 
Sbjct: 242 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLENNELIVGQGNDHPWLFSRALVSSEIYWVN 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 302 PI----DLSSPRRLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 357

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 358 ----CLGGGVIEIAEPW 370


>gi|253574914|ref|ZP_04852254.1| tRNA methyl transferase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845960|gb|EES73968.1| tRNA methyl transferase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 378

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 132/380 (34%), Positives = 197/380 (51%), Gaps = 24/380 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K   + RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A  D 
Sbjct: 2   MAKPNSETRVVVGMSGGVDSSVTALLLKQQGYDVIGIFMKNWDD---TDEFGYCTAEADA 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVC+ I++ +Y  ++E+++ + V   F   Y  G TP P V CNR +KF + L+  
Sbjct: 59  EDVRRVCEQIDIPYYTVNFEKQYYDKVFAYFLEEYKRGRTPNPDVMCNREIKFGEFLNKA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R       +  +   + R +D  +DQ+YFL A  Q+QL    FP+G
Sbjct: 119 LDLGADYVATGHYARVV-----EENKTYKLLRGVDSNKDQTYFLNALNQEQLSKAMFPIG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQI 252
            + K  VR +A E GL  A K DS  +CF+ +  + + +       A  GD++ +  G++
Sbjct: 174 HLPKPEVRRIAEEAGLYTAKKKDSTGVCFIGERNFKEFLSNYLP--AQSGDMIDIVTGEV 231

Query: 253 LGRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
            GRH+G++ YT+GQR+     G   GEP FV   D   + + V   +         +   
Sbjct: 232 KGRHDGLMYYTLGQRQGLGIGGSGTGEPWFVADKDLERNILYVVQGDKHPSLYSTSLIAS 291

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
            +NW+     +      +KC  K R  Q    V + +  DG V+V F++ +  +  GQA 
Sbjct: 292 GVNWIAGA--DKMPEGPYKCTAKFRYRQPDQGVTLTKQPDGTVHVAFDEPQKAITPGQAV 349

Query: 366 VFYTSDSNEARVLGGGIISG 385
           VFY  +      LGGG I  
Sbjct: 350 VFYQGE----ECLGGGTIEA 365


>gi|307711099|ref|ZP_07647521.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK321]
 gi|307617061|gb|EFN96239.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK321]
          Length = 373

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 189/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYREGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  +   +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKTFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|312866787|ref|ZP_07727000.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis F0405]
 gi|311097570|gb|EFQ55801.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis F0405]
          Length = 373

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +  + RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSETRVVVGMSGGVDSSVTALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVSR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTIDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      E+L    ++  ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSQNILYVGQGFYHEALMSTSLHASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|254241058|ref|ZP_04934380.1| tRNA methyltransferase [Pseudomonas aeruginosa 2192]
 gi|126194436|gb|EAZ58499.1| tRNA methyltransferase [Pseudomonas aeruginosa 2192]
          Length = 375

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 126/381 (33%), Positives = 199/381 (52%), Gaps = 26/381 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  RV+V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C A +D+ DA+
Sbjct: 8   PRRERVIVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWDEDDGTE---YCTAREDLADAQ 64

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LG
Sbjct: 65  AVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLG 124

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K
Sbjct: 125 ADLIATGHYVRRR-----DRDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEK 179

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GRH+
Sbjct: 180 PEVRAIAEKHGLATAKKKDSTGICFIGERRFTDFLKQYLP--AQPGDIETTEGKVIGRHS 237

Query: 258 GIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G++ +TIGQR+GLG+        +P +V+  D   + ++VG            +    I 
Sbjct: 238 GLMYHTIGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIY 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+     E       +   K+R  Q      +++  +G    F++ +  V  GQ+ VFY 
Sbjct: 298 WVNPVELE----RPRRLRAKVRYRQSDQDCVLEKTTEGYRAVFDEPQRAVTPGQSVVFYD 353

Query: 370 SDSNEARVLGGGIISGSKRSD 390
            D      LGGG+I  ++  D
Sbjct: 354 GDV----CLGGGVIETAEAWD 370


>gi|323704672|ref|ZP_08116250.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536134|gb|EGB25907.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 369

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 207/385 (53%), Gaps = 24/385 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +    ++++VVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    S   G C A +D 
Sbjct: 1   MAYENQNVKVVVGMSGGVDSSVSALLLKEQGYDVIGIFMKNWDEEDDS---GYCTAAEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVCD I + +Y  ++ + + + V   F + Y +G TP P V CN+ +KF   L  +
Sbjct: 58  EDVVRVCDKIGIPYYSINFTKEYWDRVFQYFLNEYKSGRTPNPDVMCNKEIKFKAFLEFS 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            ++GAD +ATGHY R     G        M + +D  +DQ+YFL    Q+QL    FP+G
Sbjct: 118 MKIGADYIATGHYARIEHIDG-----HYKMLKGVDKNKDQTYFLCELGQKQLSKTMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K  VR++AR+ GL  ADK DS  ICF+ + K+ + + +     A  G+I  L+G++L
Sbjct: 173 HLDKSEVREIARKAGLKTADKKDSTGICFIGERKFKEFLNQFLP--AKPGEIRDLSGRVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAMGE---PLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           GRH+G++ YT+GQRRG+G+       P FVV  D  ++ + V   +       + ++ + 
Sbjct: 231 GRHDGLMFYTLGQRRGIGIGGVGTGEPWFVVDKDVENNILYVAQGDKNPALYSYGLFTKN 290

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +NW+   +  D      +C  K R  Q    V V + D+G  V F+K +  V  GQ  VF
Sbjct: 291 VNWIDGDMNFDE----LRCKAKFRYRQPDQDVMVFKKDNGYLVVFDKPQRAVTPGQFVVF 346

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  +      LGGG+I    + +  
Sbjct: 347 YDGE----YCLGGGVIETIYKDEKA 367


>gi|225857998|ref|YP_002739508.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae 70585]
 gi|254811463|sp|C1CAE7|MNMA_STRP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225721738|gb|ACO17592.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae 70585]
          Length = 373

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|330958166|gb|EGH58426.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 366

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 123/377 (32%), Positives = 194/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D      + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DTDGHTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPQV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D  ++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLQNNELIVGQGNDHPWLFSSALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRRLTAKVRYRQSDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEVAEPW 360


>gi|330875781|gb|EGH09930.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 366

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQSDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|205821605|sp|Q07SU0|MNMA_RHOP5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 400

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 212/387 (54%), Positives = 279/387 (72%), Gaps = 4/387 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGEAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARTVAERIGIPHYVLDYESRFRESVIDSFATSYATGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA VLATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 122 LLSTARELGAAVLATGHYVSSRRLPD----GSRALVCAADADRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y DVV R+       GDIV L
Sbjct: 178 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPSGRYSDVVGRLKPNAMEPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H+GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPR +L + RI LR++
Sbjct: 238 DGRVLGKHHGIVHFTVGQRRGLGIASHAPLYVLRLEPSTRRVVVGPRAALRMDRILLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDNSLDLAVGDGLEMFVRVRSTRRPQPAWLRAIDGEYQVELIAGEDGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEES 395
            +   +ARVLGGG I  +    A +++
Sbjct: 358 DAPEGQARVLGGGFIKSAAPRAANKDA 384


>gi|229591246|ref|YP_002873365.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas fluorescens SBW25]
 gi|259495834|sp|C3JY68|MNMA_PSEFS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|229363112|emb|CAY50124.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas fluorescens SBW25]
          Length = 374

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/381 (32%), Positives = 199/381 (52%), Gaps = 26/381 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
             + +  RV+V MSGGVDSSV A LL   GY+V G+ ++ +     ++    C A  D+ 
Sbjct: 6   PSDTQKKRVIVGMSGGVDSSVSAVLLMEQGYEVEGLFMKNWEEDDGTE---YCTAMDDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYAM 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD++ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+
Sbjct: 123 MLGADLIATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIAKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A + GL  A K DS  ICF+ + ++ D +K+     A  G+I   +G+++G
Sbjct: 178 LEKPEVRKIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGEIKTTDGEVIG 235

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           RH+G++ +TIGQR+GLG+        EP +V+  D +++ +IVG            +   
Sbjct: 236 RHHGLMYHTIGQRQGLGIGGLKDAGEEPWYVLVKDLDNNVLIVGQGNEHPLLFSGALLAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           EI W+        +    +   K+R  Q   P  +++   G    F+  +  V  GQ+ V
Sbjct: 296 EIYWVNPI----DLSTPRRLTAKVRYRQGDQPCTLEKTATGYRATFDDPQRAVTPGQSVV 351

Query: 367 FYTSDSNEARVLGGGIISGSK 387
           FY  +      LGGG+I  ++
Sbjct: 352 FYDGEI----CLGGGVIEVAE 368


>gi|121535962|ref|ZP_01667756.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosinus carboxydivorans Nor1]
 gi|121305454|gb|EAX46402.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosinus carboxydivorans Nor1]
          Length = 364

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 151/372 (40%), Positives = 212/372 (56%), Gaps = 14/372 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDAR 77
             RVVVAMSGGVDSS+ AALL   GYDVIGVT+Q++ +   +       CC+   V DAR
Sbjct: 4   KPRVVVAMSGGVDSSLTAALLVHQGYDVIGVTMQIWENDLPEIDPEHRGCCSLSAVNDAR 63

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV D + + +YV ++ E F+  V+  F   YAAG+TP PC+ CNR VKF  LL     L 
Sbjct: 64  RVADKLGIPYYVLNFREMFQETVVDYFIREYAAGKTPNPCIACNRYVKFEGLLQKALALD 123

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A  +ATGHY R      D G+ R I+ + +D  +DQSY L+   Q  L     PLG+  K
Sbjct: 124 AQYVATGHYARIEY---DKGRGRYILRKGVDRTKDQSYALYHLNQHTLRHFLMPLGEYTK 180

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
              R +AR+ GL +A+K DSQ+ICF+    Y   ++         G+IV  +G+ILGRH 
Sbjct: 181 VQTRQMARQFGLAVAEKPDSQEICFIPNDDYKSFLEEKAPETLRPGNIVDTHGRILGRHK 240

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           G+  YT+GQR+GLG+A+G+PL+VV LD   + VIVG  E +    +   ++N++      
Sbjct: 241 GLPLYTVGQRKGLGIAVGKPLYVVALDYERNEVIVGSDEDVFASELIAEDLNFI----TV 296

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           D +    +   KIR S    P  +    +G VYV F++ +  +  GQ+ VFY  D+    
Sbjct: 297 DKLASPLRVAAKIRYSAREAPATITPEREGAVYVRFDEPQRAITPGQSVVFYDGDT---- 352

Query: 377 VLGGGIISGSKR 388
           V+GGGII  + R
Sbjct: 353 VVGGGIIRKAIR 364


>gi|307707803|ref|ZP_07644280.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis NCTC 12261]
 gi|307616063|gb|EFN95259.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis NCTC 12261]
          Length = 373

 Score =  364 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/383 (34%), Positives = 190/383 (49%), Gaps = 25/383 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
               RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D  
Sbjct: 4   NSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDVA 60

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            V D I + +Y  ++E+ + ++V   F + Y AG TP P V CN+ +KF   L     LG
Sbjct: 61  AVADQIGIPYYSVNFEKEYWDSVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLG 120

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++K
Sbjct: 121 ADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEK 176

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++ + +G H 
Sbjct: 177 PEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDSRDMGEHA 234

Query: 258 GIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   +++
Sbjct: 235 GLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVH 294

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           +  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY 
Sbjct: 295 FTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFYD 350

Query: 370 SDSNEARVLGGGIISGSKRSDAV 392
            +      LGGG+I  + R   V
Sbjct: 351 GE----ECLGGGLIDNAYRDGQV 369


>gi|240140914|ref|YP_002965394.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens AM1]
 gi|254563424|ref|YP_003070519.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens DM4]
 gi|240010891|gb|ACS42117.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens AM1]
 gi|254270702|emb|CAX26706.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens DM4]
          Length = 410

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 209/382 (54%), Positives = 271/382 (70%), Gaps = 8/382 (2%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           +  +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG
Sbjct: 23  SPAMNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKG 82

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VK
Sbjct: 83  ACCAGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVK 142

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLL + R+LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL
Sbjct: 143 FRDLLGLARELGAEALATGHYVASRARP----EGGRALYRALDPARDQSYFLYATTPEQL 198

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+I
Sbjct: 199 AYLRFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEI 258

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V L+G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L
Sbjct: 259 VDLDGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRL 318

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQ 363
            ++NWLGDG  ED V       V++RS+++P P  +  N  +    V+    E GV+ GQ
Sbjct: 319 TDLNWLGDGAPEDIVERP--VAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQ 376

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           ACV Y  D   A+VLGGG I  
Sbjct: 377 ACVIYADDDPRAQVLGGGTIRR 398


>gi|330972900|gb|EGH72966.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 366

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D  ++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLENNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRRLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|229505277|ref|ZP_04394787.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae BX 330286]
 gi|229511053|ref|ZP_04400532.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae B33]
 gi|229518173|ref|ZP_04407617.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC9]
 gi|229608296|ref|YP_002878944.1| tRNA-specific 2-thiouridylase MnmA [Vibrio cholerae MJ-1236]
 gi|254848257|ref|ZP_05237607.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MO10]
 gi|255745540|ref|ZP_05419488.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholera CIRS 101]
 gi|262158386|ref|ZP_06029502.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae INDRE 91/1]
 gi|262170249|ref|ZP_06037936.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC27]
 gi|229344888|gb|EEO09862.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC9]
 gi|229351018|gb|EEO15959.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae B33]
 gi|229357500|gb|EEO22417.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae BX 330286]
 gi|229370951|gb|ACQ61374.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MJ-1236]
 gi|254843962|gb|EET22376.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MO10]
 gi|255736615|gb|EET92012.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholera CIRS 101]
 gi|262021264|gb|EEY39978.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC27]
 gi|262029827|gb|EEY48475.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae INDRE 91/1]
          Length = 371

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARTLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEI----CLGGGIIEE 369


>gi|307705802|ref|ZP_07642645.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK597]
 gi|307620634|gb|EFN99727.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus mitis SK597]
          Length = 373

 Score =  363 bits (932), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 134/383 (34%), Positives = 190/383 (49%), Gaps = 25/383 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
               RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D  
Sbjct: 4   NSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDVA 60

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
            V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     LG
Sbjct: 61  AVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLG 120

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++K
Sbjct: 121 ADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEK 176

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H 
Sbjct: 177 PEVRRLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEHA 234

Query: 258 GIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   +++
Sbjct: 235 GLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVH 294

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           +  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY 
Sbjct: 295 FTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFYD 350

Query: 370 SDSNEARVLGGGIISGSKRSDAV 392
            +      LGGG+I  + R   V
Sbjct: 351 GE----ECLGGGLIDNAYRDGQV 369


>gi|330965599|gb|EGH65859.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 366

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQSDQPCTLEKTTDGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|303255169|ref|ZP_07341245.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS455]
 gi|303259175|ref|ZP_07345153.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP-BS293]
 gi|303263258|ref|ZP_07349181.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS397]
 gi|303265423|ref|ZP_07351323.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS457]
 gi|302597999|gb|EFL65069.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS455]
 gi|302639593|gb|EFL70050.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP-BS293]
 gi|302644863|gb|EFL75110.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS457]
 gi|302647031|gb|EFL77255.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae BS397]
          Length = 373

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|322388413|ref|ZP_08062016.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus infantis ATCC 700779]
 gi|321140726|gb|EFX36228.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus infantis ATCC 700779]
          Length = 373

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----LRDEDGVVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKEFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSQNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|289434792|ref|YP_003464664.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289171036|emb|CBH27578.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313633159|gb|EFS00043.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria seeligeri FSL N1-067]
          Length = 371

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/383 (34%), Positives = 198/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +     D+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTKNSDIRVVVGMSGGVDSSVTAHLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q+QL  + FPLG
Sbjct: 118 ESLGADFVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQEQLQKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K+ VR++A + GL  A+K DS  ICF+ +  +   +       A  G +  L+G++L
Sbjct: 173 GMEKKEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGKMQTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FV   D   + + V      ESL    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVAGKDLKENILFVEQGFHHESLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +D+   V F +    +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLRDDNTAEVVFAEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +++A
Sbjct: 347 DGDI----CLGGGTIDTVWKNNA 365


>gi|15641141|ref|NP_230773.1| tRNA-specific 2-thiouridylase MnmA [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121587442|ref|ZP_01677211.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 2740-80]
 gi|121726243|ref|ZP_01679533.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae V52]
 gi|147673628|ref|YP_001216596.1| tRNA-specific 2-thiouridylase MnmA [Vibrio cholerae O395]
 gi|153816924|ref|ZP_01969591.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae NCTC 8457]
 gi|153822021|ref|ZP_01974688.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae B33]
 gi|227081301|ref|YP_002809852.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae M66-2]
 gi|14195282|sp|Q9KSX8|MNMA_VIBCH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205828983|sp|A5F2F2|MNMA_VIBC3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|9655600|gb|AAF94287.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548362|gb|EAX58426.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 2740-80]
 gi|121631189|gb|EAX63562.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae V52]
 gi|126512511|gb|EAZ75105.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae NCTC 8457]
 gi|126520486|gb|EAZ77709.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae B33]
 gi|146315511|gb|ABQ20050.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae O395]
 gi|227009189|gb|ACP05401.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae M66-2]
 gi|227012943|gb|ACP09153.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae O395]
          Length = 372

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 8   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 64

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 65  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 124

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 125 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARTLFPVGEL 181

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 182 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 239

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 240 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 300 LHWVD----RTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 355

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 356 FYQGEI----CLGGGIIEE 370


>gi|71735842|ref|YP_275272.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|123635957|sp|Q48H61|MNMA_PSE14 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71556395|gb|AAZ35606.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 376

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 12  KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 69  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 129 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 183

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 184 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 241

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 242 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 302 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 357

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 358 ----CLGGGVIEIAEPW 370


>gi|148987860|ref|ZP_01819323.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP6-BS73]
 gi|148992708|ref|ZP_01822351.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP9-BS68]
 gi|149017799|ref|ZP_01834258.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP23-BS72]
 gi|168489391|ref|ZP_02713590.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP195]
 gi|168493828|ref|ZP_02717971.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC3059-06]
 gi|147926324|gb|EDK77397.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP6-BS73]
 gi|147928434|gb|EDK79449.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP9-BS68]
 gi|147931363|gb|EDK82341.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP23-BS72]
 gi|183572139|gb|EDT92667.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP195]
 gi|183576137|gb|EDT96665.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC3059-06]
 gi|301793411|emb|CBW35778.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae INV104]
 gi|332075800|gb|EGI86267.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae GA17570]
 gi|332076573|gb|EGI87035.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae GA17545]
          Length = 373

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|23012016|ref|ZP_00052207.1| COG0482: Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Magnetospirillum magnetotacticum MS-1]
          Length = 403

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 206/382 (53%), Positives = 270/382 (70%), Gaps = 8/382 (2%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           +  +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG
Sbjct: 16  SPAMNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKG 75

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAG+D++DAR V +T+ + HYV DYE++FR +VI  FA SY +GETP+PCV+CNR+VK
Sbjct: 76  ACCAGRDIHDARAVAETLGIPHYVLDYEDKFRESVIDRFAESYLSGETPIPCVECNRSVK 135

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLL++ R LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL
Sbjct: 136 FRDLLALARDLGAEALATGHYVASRPLA----EGGRGLFRALDPARDQSYFLYATTPEQL 191

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G I
Sbjct: 192 AFLRFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPGAI 251

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V L+G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI L
Sbjct: 252 VDLDGRHLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRIRL 311

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQ 363
            ++NWLG G  E   +      V++RS+++P P  +  N +     V+    E GV+ GQ
Sbjct: 312 TDLNWLGGGTPES--LAELPVAVRVRSTREPRPARLSWNAEAACAEVELVAPEDGVSPGQ 369

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           ACV Y  D   A+VLGGG I  
Sbjct: 370 ACVIYADDGPRAQVLGGGTIRR 391


>gi|302185016|ref|ZP_07261689.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           syringae 642]
 gi|330981378|gb|EGH79481.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 366

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRRLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|331267205|ref|YP_004326835.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis Uo5]
 gi|326683877|emb|CBZ01495.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus oralis Uo5]
          Length = 373

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|306832460|ref|ZP_07465612.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
 gi|304425360|gb|EFM28480.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus gallolyticus subsp. gallolyticus TX20005]
          Length = 393

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 23  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKDV 79

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 80  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 139

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG ++
Sbjct: 140 GADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHLE 195

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G H
Sbjct: 196 KPEVRKIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGEH 253

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +    I
Sbjct: 254 AGLMYYTIGQRGGLGIGGQQGGDNQPWFVVGKDLSKNILYVGQGFYHDSLMSTSLDASSI 313

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +   K R  Q    V V    D   V F++ +  +  GQA VFY
Sbjct: 314 HFTRDMPEE----FTMEVTAKFRYRQPDSKVTVHVKGDKAEVVFDEPQRAITPGQAVVFY 369

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGGII  + ++   
Sbjct: 370 DGE----ECLGGGIIDMAYKNGVA 389


>gi|115523063|ref|YP_779974.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisA53]
 gi|115517010|gb|ABJ04994.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 419

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 212/387 (54%), Positives = 279/387 (72%), Gaps = 4/387 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 21  LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGEAIHRKGACC 80

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 81  AGQDIHDARTVAERIGIPHYVLDYESRFRESVIDSFATSYATGETPVPCIECNRSIKFRD 140

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA VLATGHY+ SR          R +    D +RDQSYFLFATT++QL  L
Sbjct: 141 LLSTARELGAAVLATGHYVSSRRLPD----GSRALVCAADADRDQSYFLFATTREQLDFL 196

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y DVV R+       GDIV L
Sbjct: 197 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPSGRYSDVVGRLKPNAMEPGDIVDL 256

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H+GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPR +L + RI LR++
Sbjct: 257 DGRVLGKHHGIVHFTVGQRRGLGIASHAPLYVLRLEPSTRRVVVGPRAALRMDRILLRDV 316

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 317 NWIGDNSLDLAVGDGLEMFVRVRSTRRPQPAWLRAIDGEYQVELIAGEDGVSPGQACVFY 376

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEES 395
            +   +ARVLGGG I  +    A +++
Sbjct: 377 DAPEGQARVLGGGFIKSAAPRAANKDA 403


>gi|255655293|ref|ZP_05400702.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-23m63]
          Length = 359

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 220/368 (59%), Gaps = 12/368 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
           + +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV
Sbjct: 2   NKKVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDDVEIEGGCCSLSAVEDARRV 61

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D
Sbjct: 62  ANKIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCD 121

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ 
Sbjct: 122 YVATGHYAKIEK---DESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDR 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI
Sbjct: 179 VREIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E+L    +  +++N++     E  
Sbjct: 239 LYYTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNENLFKKELIAKDVNFISIDTLE-- 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             +  +   KIR S  P P  + R   D + + F++++  +  GQ+ V Y  D     V+
Sbjct: 297 --EPLRVQAKIRYSAKPSPATIHRVGKDTIKIVFDEAQRAITKGQSVVMYDEDI----VV 350

Query: 379 GGGIISGS 386
           GGGII  S
Sbjct: 351 GGGIIEKS 358


>gi|269967776|ref|ZP_06181823.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio alginolyticus 40B]
 gi|269827596|gb|EEZ81883.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio alginolyticus 40B]
          Length = 430

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 122/380 (32%), Positives = 195/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 59  DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 115

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 116 QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 175

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 176 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDGNKDQSYFLYTLSNEQIARSLFPVGDL 232

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 233 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGQ 290

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            +P FV   D   + +I         L+   +  
Sbjct: 291 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLERNVLIAVQGKDHPMLKSEGLLA 350

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 351 SQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 406

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 407 AVFYKGDV----CLGGGIIE 422


>gi|149005874|ref|ZP_01829603.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP18-BS74]
 gi|225855906|ref|YP_002737417.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae P1031]
 gi|237649790|ref|ZP_04524042.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CCRI 1974]
 gi|237821488|ref|ZP_04597333.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CCRI 1974M2]
 gi|307126353|ref|YP_003878384.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae 670-6B]
 gi|254811467|sp|C1CI29|MNMA_STRZP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|147762230|gb|EDK69191.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP18-BS74]
 gi|225725914|gb|ACO21766.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae P1031]
 gi|306483415|gb|ADM90284.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae 670-6B]
          Length = 373

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|296451277|ref|ZP_06893017.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP08]
 gi|296880371|ref|ZP_06904334.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP07]
 gi|296259883|gb|EFH06738.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP08]
 gi|296428612|gb|EFH14496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP07]
          Length = 361

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 220/368 (59%), Gaps = 12/368 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
           + +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV
Sbjct: 4   NKKVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDDVEIEGGCCSLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D
Sbjct: 64  ANKIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ 
Sbjct: 124 YVATGHYAKIEK---DESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDR 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI
Sbjct: 181 VREIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E+L    +  +++N++     E  
Sbjct: 241 LYYTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNENLFKKELIAKDVNFISIDTLE-- 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             +  +   KIR S  P P  + R   D + + F++++  +  GQ+ V Y  D     V+
Sbjct: 299 --EPLRVQAKIRYSAKPSPATIHRVGKDTIKIVFDEAQRAITKGQSVVMYDEDI----VV 352

Query: 379 GGGIISGS 386
           GGGII  S
Sbjct: 353 GGGIIEKS 360


>gi|295706703|ref|YP_003599778.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus megaterium DSM 319]
 gi|294804362|gb|ADF41428.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus megaterium DSM 319]
          Length = 370

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 139/382 (36%), Positives = 204/382 (53%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K+PKD RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTKSPKDTRVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIRVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R     G+       M R +D  +DQ+YFL    Q QL  + FP+G
Sbjct: 118 MTLGADYLATGHYARVAYRDGE-----YKMLRGVDGNKDQTYFLNQLGQDQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E GL  A K DS  ICF+ +  + + + +     A  G +  L+G++ 
Sbjct: 173 EIEKSKVREIAKEAGLATATKKDSTGICFIGERNFKEFLSQYLP--AQPGVMQTLDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E L    +    ++
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGSGEPWFVVGKDLEKNVLYVDQGFHNELLYSTSLTATNVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +  +         C  K R  Q    V V++ +DD + V F +    +  GQA VFY
Sbjct: 291 WVSERDWS----SPMTCTAKFRYRQTDSAVTVEKVDDDTIKVIFAEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      +GG  I    + +
Sbjct: 347 KDD----ECVGGATIDKVFQEE 364


>gi|170755439|ref|YP_001780808.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum B1 str.
           Okra]
 gi|205810574|sp|B1IIY2|MNMA2_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|169120651|gb|ACA44487.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum B1 str. Okra]
          Length = 356

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 139/368 (37%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D  +DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDRKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++IN++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDINYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + D  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKDPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|289168790|ref|YP_003447059.1| tRNA methyl transferase [Streptococcus mitis B6]
 gi|288908357|emb|CBJ23199.1| tRNA methyl transferase [Streptococcus mitis B6]
          Length = 373

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDDDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA + GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEKAGLATAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|260597502|ref|YP_003210073.1| tRNA-specific 2-thiouridylase MnmA [Cronobacter turicensis z3032]
 gi|260216679|emb|CBA30030.1| tRNA-specific 2-thiouridylase mnmA [Cronobacter turicensis z3032]
          Length = 369

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 125/378 (33%), Positives = 194/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +           C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGED---YCTAASDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R +D  +DQSYFL+     Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRR-----ADVNGKSRLLRGLDGNKDQSYFLYTLGHDQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+ L  A K DS  ICF+ + K+ + + R     A  G IV ++G ++G 
Sbjct: 175 EKPEVRRIAEELDLVTAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIVTVDGDVIGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         EP +VV  D  ++ +IV             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGGEEPWYVVDKDVENNILIVAQGHDHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+      + V   F C VK R  Q  +P  V+  +DD + V F++    V  GQ+ V
Sbjct: 293 LHWVD----REPVTAPFTCTVKTRYRQADIPCTVRPLDDDRIEVLFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYLGEV----CLGGGIIE 362


>gi|242373921|ref|ZP_04819495.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis M23864:W1]
 gi|242348475|gb|EES40077.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis M23864:W1]
          Length = 372

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 206/380 (54%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + +D+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNEDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIRRH----EDGHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + + +     A  GD+V L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQDLATAKKKDSTGICFIGERNFKEFLSQYLP--AQSGDMVTLDGKKMGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  + + + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLDDNVLYVEQGFHHDALYSDYLVASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTS 370
            +G     +  GF+C  K R  Q    VFVQR N++ + V F++    +  GQA VFY  
Sbjct: 292 NEGEIN--LEQGFECTAKFRYRQKDTKVFVQRENENSIRVTFDQPVRAITPGQAVVFYNG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGG  I    +++
Sbjct: 350 EV----CLGGATIDDVYKNE 365


>gi|330889667|gb|EGH22328.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 366

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|168487074|ref|ZP_02711582.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC1087-00]
 gi|183570004|gb|EDT90532.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC1087-00]
          Length = 373

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|229515510|ref|ZP_04404969.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae TMA 21]
 gi|229520442|ref|ZP_04409867.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae TM 11079-80]
 gi|229525739|ref|ZP_04415144.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae bv. albensis VL426]
 gi|229529783|ref|ZP_04419173.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 12129(1)]
 gi|229333557|gb|EEN99043.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 12129(1)]
 gi|229339320|gb|EEO04337.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae bv. albensis VL426]
 gi|229342540|gb|EEO07533.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae TM 11079-80]
 gi|229347279|gb|EEO12239.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae TMA 21]
 gi|327483833|gb|AEA78240.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Vibrio cholerae LMA3894-4]
          Length = 371

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEI----CLGGGIIEE 369


>gi|288958853|ref|YP_003449194.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Azospirillum sp. B510]
 gi|288911161|dbj|BAI72650.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Azospirillum sp. B510]
          Length = 391

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 201/397 (50%), Positives = 259/397 (65%), Gaps = 18/397 (4%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL L K P+D RVVVAMSGGVDSSV AA+L+ +GYDV+G+TLQLY+   A ++ G+CC
Sbjct: 1   MNSLGLSKRPQDTRVVVAMSGGVDSSVTAAVLREEGYDVVGITLQLYDHGLALQKPGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+YDAR+V D I + HYV DYE RF   V+  FA SY  GETP+PCV CN+ VKF D
Sbjct: 61  AGQDIYDARQVADRIGIPHYVLDYEGRFSQDVMDDFADSYLRGETPIPCVRCNQRVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHY+R        G R   + R +D  +DQSYFLFATT++QL  L
Sbjct: 121 LLNTARDLGADALATGHYVRRIA-----GPRGAELHRAVDPAKDQSYFLFATTREQLEFL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA   GL++A K DSQDICFV  G Y +VV ++  G    GDIVH+
Sbjct: 176 RFPLGGLTKPETRALAGRHGLEVAAKPDSQDICFVPNGNYAEVVAKLRPGSVEPGDIVHV 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +G++LGRH G+++YT+GQR+GLG+        E L+VV L+    RV+VGPR  L    +
Sbjct: 236 DGRVLGRHKGVVHYTVGQRKGLGIGGIRGQEEEALYVVRLEPARRRVVVGPRRDLARSLV 295

Query: 304 YLREINWLG-DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVAS 361
            +R++NWLG D   + A   G +  VK+RS+Q   P       DG   V+  + + G+A 
Sbjct: 296 MVRDVNWLGSDPAPDQADGAGLEVSVKLRSAQPAAPALWHAGPDGTARVELREPQHGIAP 355

Query: 362 GQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           GQACV Y  D    RVLGGG ISG+  +  V E + S
Sbjct: 356 GQACVVYQGD----RVLGGGWISGT--AGTVAEGVES 386


>gi|182683091|ref|YP_001834838.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CGSP14]
 gi|182628425|gb|ACB89373.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CGSP14]
          Length = 391

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 21  DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 77

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 78  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 137

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 138 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 193

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 194 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 251

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 252 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 311

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 312 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFTEPQRAITPGQAVVFY 367

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 368 DGE----ECLGGGLIDNAYRDGQV 387


>gi|23099469|ref|NP_692935.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methy ltransferase
           [Oceanobacillus iheyensis HTE831]
 gi|30173412|sp|Q8CXC7|MNMA_OCEIH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|22777698|dbj|BAC13970.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Oceanobacillus iheyensis HTE831]
          Length = 371

 Score =  363 bits (931), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 139/380 (36%), Positives = 206/380 (54%), Gaps = 22/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           KN KD RVVV MSGGVDSSV A LLK+ GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 2   KNNKDTRVVVGMSGGVDSSVAALLLKQQGYDVVGIFMKNWDD---TDEFGVCTATEDFDD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             RVC+ + + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L     
Sbjct: 59  VVRVCNQLEIPYYSVNFEKQYWDKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHALA 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD LATGHY + R     D   R  M R  D  +DQ+YFL   ++  L  + FPLG +
Sbjct: 119 LGADYLATGHYAQVRR----DKNGRVEMLRGNDENKDQTYFLNQLSEDVLDKVMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR +A+E  L  A+K DS  ICF+ +  + + +       A  G++  L+G + G 
Sbjct: 175 PKSEVRKIAKEHELVTAEKKDSTGICFIGERNFKEFLSEYLP--AQPGEMQTLDGIVKGS 232

Query: 256 HNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWL 311
           H+G++ YT+GQR+GLG+   G+P FVV  +   + + V      + L  + +   +INW+
Sbjct: 233 HDGLMYYTLGQRQGLGIGGSGDPWFVVGKNLTDNILYVGQGYENDYLYSNALVATDINWI 292

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTS 370
                 D + D F C  K R  Q    V V  ++++ VYV F++ +  +  GQA VFY  
Sbjct: 293 ----QPDKISDTFNCTAKFRYRQQDSEVNVTIKSENEVYVAFKEDQRAITPGQAVVFYDG 348

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGGG I    ++D
Sbjct: 349 EV----CLGGGTIDTIIKND 364


>gi|229918430|ref|YP_002887076.1| tRNA-specific 2-thiouridylase MnmA [Exiguobacterium sp. AT1b]
 gi|229469859|gb|ACQ71631.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Exiguobacterium sp. AT1b]
          Length = 373

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 132/381 (34%), Positives = 200/381 (52%), Gaps = 24/381 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K P++  VVV MSGGVDSSV A +LK  GY+VIG+ ++ ++    +   G C A +D  D
Sbjct: 6   KAPEETTVVVGMSGGVDSSVTAHVLKEQGYNVIGIFMKNWDD---TDENGVCTATEDYED 62

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V + I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L    +
Sbjct: 63  VIAVANQIGIPYYAVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDHALR 122

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +   G+       + R  D  +DQ+YFL   +Q QL    FP+G M
Sbjct: 123 LGADFVATGHYAQVKYVDGE-----HRLLRGKDDNKDQTYFLNQLSQDQLARTMFPIGHM 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K+ VR +A E GL  A K DS  ICF+ +  + + +       +  G++  L+G + GR
Sbjct: 178 DKKDVRAIAEEAGLATAKKKDSTGICFIGERNFKEFLSEYLP--SQPGEMRTLDGVVKGR 235

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWL 311
           H+G++ YT+GQR GLG+   G+P FVV  D  ++ + V      ++L    +   +++W 
Sbjct: 236 HDGLMYYTLGQRHGLGIGGDGDPWFVVGKDVENNVLFVGQGFHHDALYSDALLASKLSWT 295

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
           G      A    F+   K R  Q  VPV V   ++G V V F++ +  +  GQA VFY  
Sbjct: 296 G-----AAPTGEFRATAKFRYRQQDVPVTVAPLENGEVLVKFDEPQRAITPGQAVVFYDG 350

Query: 371 DSNEARVLGGGIISGSKRSDA 391
           D      LGG  I  + R+  
Sbjct: 351 DV----CLGGATIDEAYRNGK 367


>gi|309799040|ref|ZP_07693293.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus infantis SK1302]
 gi|308117275|gb|EFO54698.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus infantis SK1302]
          Length = 373

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEAGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKEFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|163853494|ref|YP_001641537.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens PA1]
 gi|163665099|gb|ABY32466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens PA1]
          Length = 410

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 208/382 (54%), Positives = 269/382 (70%), Gaps = 8/382 (2%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           +  +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG
Sbjct: 23  SPAMNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKG 82

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VK
Sbjct: 83  ACCAGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVK 142

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLL + R LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL
Sbjct: 143 FRDLLGLARDLGAEALATGHYVASRARP----EGGRALYRALDPARDQSYFLYATTPEQL 198

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+I
Sbjct: 199 AYLRFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEI 258

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V L+G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L
Sbjct: 259 VDLDGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRL 318

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQ 363
            ++NWLGDG  ED         V++RS+++P P  +  N  +    V+    E GV+ GQ
Sbjct: 319 TDLNWLGDGAPEDIAERP--VAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQ 376

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           ACV Y  D   A+VLGGG I  
Sbjct: 377 ACVIYADDDPRAQVLGGGTIRR 398


>gi|149010994|ref|ZP_01832299.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP19-BS75]
 gi|147764630|gb|EDK71560.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP19-BS75]
          Length = 373

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDEAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|27382106|ref|NP_773635.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium japonicum USDA
           110]
 gi|81735060|sp|Q89ES7|MNMA_BRAJA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|27355276|dbj|BAC52260.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Bradyrhizobium japonicum USDA 110]
          Length = 393

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 212/378 (56%), Positives = 274/378 (72%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V   + + HYV DYE+RFR +VI  FA SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARDVAAKLGIPHYVLDYEDRFRESVIDNFADSYALGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA  LATGHY+ SR          R++    D +RDQSYFLFATTQ+QL  L
Sbjct: 122 LLKTARELGAQALATGHYVASRRLDD----GSRVLVCAADADRDQSYFLFATTQEQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y D++ R+       GDIV L
Sbjct: 178 RFPLGDMTKPETRELARRFGLAVADKHDSQDICFVPTGRYTDIITRLRPNAMDPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRHNGI N+T+GQRRGLG+A   PLFVV L+  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGRVLGRHNGIANFTVGQRRGLGIAAHAPLFVVRLEAANRRVVVGPREALKMHRISLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLG G  + A+ +G + FV++RS++ P P +++       ++    E GV+ GQACVFY
Sbjct: 298 NWLGGGDIDSAIGNGLEMFVRVRSTRSPQPAWLRGAGGHYEIELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            + S +ARVLGGG I  +
Sbjct: 358 DAPSGQARVLGGGFIQSA 375


>gi|324991889|gb|EGC23812.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK405]
 gi|324996221|gb|EGC28131.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK678]
 gi|327458514|gb|EGF04864.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK1]
 gi|327471584|gb|EGF17027.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK408]
 gi|327490314|gb|EGF22101.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK1058]
          Length = 373

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DKDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ + G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTMEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|223044127|ref|ZP_03614166.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus capitis SK14]
 gi|314933788|ref|ZP_07841153.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus caprae C87]
 gi|222442521|gb|EEE48627.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus capitis SK14]
 gi|313653938|gb|EFS17695.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus caprae C87]
          Length = 372

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 205/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIRRH----EDGHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + + +     A  GD+V L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQDLATAKKKDSTGICFIGERNFKEFLSQYLP--AQSGDMVTLDGKKMGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  + + + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLDDNLLYVEQGFHHDALYSDYLIASDFSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
            +   +  +  GF+C  K R  Q    VFV++ D+  + V F++    +  GQA VFY  
Sbjct: 292 NENEID--LEHGFECTAKFRYRQKDTKVFVKKEDESSIRVTFDQPVRAITPGQAVVFYNE 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGG  I    +++
Sbjct: 350 EV----CLGGATIDDVYKNE 365


>gi|153214224|ref|ZP_01949259.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 1587]
 gi|153802718|ref|ZP_01957304.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MZO-3]
 gi|153828671|ref|ZP_01981338.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 623-39]
 gi|254225518|ref|ZP_04919128.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae V51]
 gi|297578730|ref|ZP_06940658.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC385]
 gi|124115473|gb|EAY34293.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 1587]
 gi|124121758|gb|EAY40501.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MZO-3]
 gi|125621988|gb|EAZ50312.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae V51]
 gi|148875824|gb|EDL73959.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae 623-39]
 gi|297536324|gb|EFH75157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae RC385]
          Length = 372

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 8   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 64

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 65  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 124

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 125 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 181

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 182 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 239

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 240 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 300 LHWVD----RTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 355

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 356 FYQGEI----CLGGGIIEE 370


>gi|290893871|ref|ZP_06556849.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL J2-071]
 gi|290556588|gb|EFD90124.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL J2-071]
          Length = 371

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 199/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  A+K DS  ICF+ +  +   +       A  G++  L+G++L
Sbjct: 173 GMEKTEVREIAKKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +     A     +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----AKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++ A
Sbjct: 347 DGDI----CLGGGTIDTVWKNGA 365


>gi|313637741|gb|EFS03100.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria seeligeri FSL S4-171]
          Length = 371

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 133/383 (34%), Positives = 198/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +     D+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTKNSDIRVVVGMSGGVDSSVTAHLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q+QL  + FPLG
Sbjct: 118 ESLGADFVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQEQLQKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K+ VR++A + GL  A+K DS  ICF+ +  +   +       A  G +  L+G++L
Sbjct: 173 GMEKKEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGKMQTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FV   D   + + V      ESL    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVAGKDLKENILFVEQGFHHESLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +++   V F +    +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLRDNNTAEVVFAEPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +++A
Sbjct: 347 DGDI----CLGGGTIDTVWKNNA 365


>gi|159185866|ref|NP_356917.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium tumefaciens str. C58]
 gi|25298384|pir||AC3012 hypothetical protein trmU [imported] - Agrobacterium tumefaciens
           (strain C58, Dupont)
 gi|159141000|gb|AAK89702.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium tumefaciens str. C58]
          Length = 380

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 222/377 (58%), Positives = 279/377 (74%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCCAGQD+ DARRVC+T+ + 
Sbjct: 1   MSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCCAGQDIDDARRVCETLGIP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF+DLL+  ++LGAD LATGHY
Sbjct: 61  HYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFADLLATAQELGADALATGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
           IRSR         RR + RP+D +RDQS+FLFATTQ+Q+  LRFPLG + K   R LA E
Sbjct: 121 IRSRPNPVSGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYLRFPLGGLSKAETRALAEE 180

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
           MGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL+G++LGRH+GI++YTIGQ
Sbjct: 181 MGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHLDGRVLGRHDGIVHYTIGQ 240

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           RRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR++NWLGDG        GF C
Sbjct: 241 RRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDMNWLGDGALAADAGQGFTC 300

Query: 327 FVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS 386
           F K+RS++ P    +  +++G+YVD    E GVA GQACV Y++   +ARV GGG I  S
Sbjct: 301 FAKVRSTRPPTEAVLHADENGIYVDLMTGEAGVAPGQACVLYSAPGPDARVYGGGFIDRS 360

Query: 387 KRSDAVEESLLSVIGDE 403
           +RS   E SL +++   
Sbjct: 361 ERSVDAEASLKALLEKP 377


>gi|194398405|ref|YP_002036838.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae G54]
 gi|229487424|sp|B5E605|MNMA_STRP4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|194358072|gb|ACF56520.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae G54]
          Length = 373

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 190/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V     + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYXXAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|319946006|ref|ZP_08020255.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus australis ATCC 700641]
 gi|319747814|gb|EFW00059.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus australis ATCC 700641]
          Length = 373

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      E+L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSQNILYVGQGFYHEALMSTSLQASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVTFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|148983522|ref|ZP_01816841.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP3-BS71]
 gi|221231050|ref|YP_002510202.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae ATCC 700669]
 gi|254811464|sp|B8ZK04|MNMA_STRPJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|147923669|gb|EDK74781.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP3-BS71]
 gi|220673510|emb|CAR67990.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae ATCC 700669]
 gi|301799298|emb|CBW31824.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae OXC141]
          Length = 373

 Score =  362 bits (930), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|254478804|ref|ZP_05092171.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydibrachium pacificum DSM 12653]
 gi|214035259|gb|EEB75966.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydibrachium pacificum DSM 12653]
          Length = 376

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 145/390 (37%), Positives = 218/390 (55%), Gaps = 17/390 (4%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           +     RL +L + KN    RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +   
Sbjct: 1   MRESTRRLENLSMQKNN---RVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEE 57

Query: 62  KR--KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD 119
               +G CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ 
Sbjct: 58  AVRVEGGCCSLAAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIA 117

Query: 120 CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA 179
           CN+ +KF +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+ 
Sbjct: 118 CNKYIKFEELLKRAWMIDAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYN 174

Query: 180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            TQ QL  + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++      
Sbjct: 175 LTQTQLEHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEE 234

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLE 299
              G+     G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + + 
Sbjct: 235 IKPGEFRDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVY 294

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVG 358
              +     N++      D +    +   KIR +       ++  +DG V+V F+  +  
Sbjct: 295 GDELISYNNNFISI----DKLEKEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRA 350

Query: 359 VASGQACVFYTSDSNEARVLGGGIISGSKR 388
           +  GQ+ VFY  D     V+GGGII    R
Sbjct: 351 ITPGQSVVFYDGDI----VVGGGIIERKVR 376


>gi|270291444|ref|ZP_06197666.1| tRNA methyl transferase [Pediococcus acidilactici 7_4]
 gi|304385157|ref|ZP_07367503.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pediococcus acidilactici DSM 20284]
 gi|270280290|gb|EFA26126.1| tRNA methyl transferase [Pediococcus acidilactici 7_4]
 gi|304329351|gb|EFL96571.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pediococcus acidilactici DSM 20284]
          Length = 377

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 134/390 (34%), Positives = 196/390 (50%), Gaps = 24/390 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSVVA LLK+ GYDV+GV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVVAYLLKKQGYDVVGVFMKNWDD---TDENGYCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F   Y  G TP P V CN  +KF   L     
Sbjct: 59  VAKVAAKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPNPDVICNNEIKFKAFLDYAIS 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D    + + R  D  +DQ+YFL   + +QL  + FPLG M
Sbjct: 119 LGADYVATGHYAQVER----DENGHQHLLRATDSNKDQTYFLSQLSAEQLDRVMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR +A+E GL + DK DS  ICF+ +  + + +       A  G ++ L+G++ G 
Sbjct: 175 VKPEVRAIAKEAGLAVYDKKDSVGICFIGEKNFREFLSNYLP--AKPGKMMTLDGEVKGE 232

Query: 256 HNGIINYTIGQRRGLGVAMG----EPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
           H G++ YTIGQRRGLG+  G    EP FVV  D + + + V        L    +   ++
Sbjct: 233 HAGLMYYTIGQRRGLGIGGGSKNNEPWFVVGKDLSKNILYVGQGFDNPHLYAASLDASDM 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACV 366
           +++      +     F+C  K R     VPV V  +DD   V VDF++    +  GQA V
Sbjct: 293 HFVN--RLGEERGHDFRCTAKFRYRAKDVPVTVHFSDDFSKVTVDFDEPARAITPGQALV 350

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAVEESL 396
            Y  +      +GGGII  +      +   
Sbjct: 351 LYDGE----ECIGGGIIDAAYSESKQQLQY 376


>gi|110802009|ref|YP_699068.1| tRNA-specific 2-thiouridylase MnmA [Clostridium perfringens SM101]
 gi|123047295|sp|Q0SS39|MNMA_CLOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110682510|gb|ABG85880.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens SM101]
          Length = 359

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 141/368 (38%), Positives = 210/368 (57%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRTGNFVDKYGNVLGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     ED
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLED 297

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
                 +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V
Sbjct: 298 ----PMEVEAKIRYSAKPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|322386456|ref|ZP_08060085.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus cristatus ATCC 51100]
 gi|321269542|gb|EFX52473.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus cristatus ATCC 51100]
          Length = 373

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 131/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ ++G+ +G+H
Sbjct: 176 KPEVRAVAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTMDGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      + L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNEPWFVVGKDLSQNILYVGQGFYHDHLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAIVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + ++  V
Sbjct: 350 DGE----ECLGGGLIDRAYKNGQV 369


>gi|205829101|sp|B2IRK2|MNMA_STRPS RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 373

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFTEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|331091036|ref|ZP_08339878.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405258|gb|EGG84794.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 360

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 138/368 (37%), Positives = 203/368 (55%), Gaps = 15/368 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDA 76
           +  +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++     +  +  G CC    V DA
Sbjct: 2   EKKKVVVGMSGGVDSSVAAHLLKEQGYDVIGVTMQIWQDEDRAIQEENGGCCGLSAVDDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV   + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +
Sbjct: 62  RRVAGQLEIPYYVMNFKKEFKKEVIDYFIEEYRQGRTPNPCIACNRYVKWESLLKRSMDI 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R           R  + R   L +DQ+Y L+  TQ QL     P+G+  
Sbjct: 122 GADYIATGHYARIVKL----ENGRYTLKRSATLAKDQTYALYNLTQNQLSHTLMPVGEYT 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ +R +A ++ L +A+K DSQDICFV  G Y   ++         G+ V LNG ILG+H
Sbjct: 178 KDEIRQIAEKIHLQVANKPDSQDICFVPDGDYASFIEETTGERIQTGNFVDLNGNILGQH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YT+GQR+GLG+++G P FV+ +   ++ V++G  E    + +    +N++     
Sbjct: 238 KGIIHYTVGQRKGLGLSLGRPAFVLEIRPETNEVVIGTNEDAMSYTLRANHLNFMSISDL 297

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
           E         F KIR +       +++  +D V   F++ +  +  GQA VFY  +    
Sbjct: 298 E----GEMHVFAKIRYNHKGAWCTIKKTSEDEVLCTFDEPQRAITPGQAVVFYDDE---- 349

Query: 376 RVLGGGII 383
            V+GGG I
Sbjct: 350 YVIGGGTI 357


>gi|169834334|ref|YP_001693654.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae
           Hungary19A-6]
 gi|205828976|sp|B1I833|MNMA_STRPI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|168996836|gb|ACA37448.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae Hungary19A-6]
          Length = 373

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + +++       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKNLLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|322805504|emb|CBZ03068.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum H04402 065]
          Length = 356

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|168178604|ref|ZP_02613268.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226948452|ref|YP_002803543.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A2 str.
           Kyoto]
 gi|182670342|gb|EDT82316.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226842334|gb|ACO85000.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A2 str. Kyoto]
          Length = 356

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 207/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +    DD V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQTPSKAIITPIEDDRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|262402513|ref|ZP_06079074.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. RC586]
 gi|262351295|gb|EEZ00428.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. RC586]
          Length = 371

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 189/379 (49%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 124 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDNNKDQSYFLYTLSHEQVTRSLFPVGDL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKESNEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   ++D + V F+  +V V  GQ+ V
Sbjct: 299 LHWVD----RTPITEPLRCSVKTRYRQSDIACTIIPLSNDRIKVMFDDPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEI----CLGGGIIEE 369


>gi|148263558|ref|YP_001230264.1| tRNA-specific 2-thiouridylase MnmA [Geobacter uraniireducens Rf4]
 gi|205816712|sp|A5GE36|MNMA_GEOUR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146397058|gb|ABQ25691.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter uraniireducens Rf4]
          Length = 375

 Score =  362 bits (929), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 158/381 (41%), Positives = 221/381 (58%), Gaps = 18/381 (4%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS----CCA 69
           + KN K  RVV+AMSGGVDSSV AALLK +G++VIG+++Q+++  + +  +G     CC+
Sbjct: 1   MVKNNKRKRVVIAMSGGVDSSVAAALLKEEGHEVIGISMQVWDYTRFTAEEGEKFDTCCS 60

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
             D++DARRV + + +  YV ++EE F+N VI  F + Y  G TP PCV CN+ +KF  L
Sbjct: 61  LDDIHDARRVAEQLEIPFYVVNFEEEFQNLVIDDFVNEYLLGRTPNPCVRCNQWIKFELL 120

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   R LGAD++ATGHY R+      D   R  + + +D  +DQSYFLF  TQ+QL    
Sbjct: 121 LKKARGLGADMIATGHYARTEQ----DADGRYRLMKGVDPAKDQSYFLFTLTQEQLAMTL 176

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG M K+ VR LA   GL +A+K +SQ+ICFV    Y   ++       L G+IV   
Sbjct: 177 FPLGGMTKQEVRALAAGYGLRVAEKGESQEICFVPDNDYVRFIEEERGKQLLSGNIVDRK 236

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG H+G   YT+GQR+GLG+A  EPL+V+ +D     V VGPR++L    +    IN
Sbjct: 237 GKVLGVHDGTYRYTVGQRKGLGIAHPEPLYVLGVDAARKEVTVGPRDALYSDGLIATAIN 296

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFY 368
           W+             +   KIR    P+P  +    D+   V F + E  V  GQA VFY
Sbjct: 297 WIAPT-----PETAIEASCKIRYRHHPIPCRILPLADNRAEVRFTEREKSVTPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRS 389
             D+    VLGGG I  +  +
Sbjct: 352 DGDT----VLGGGWIEHAVNT 368


>gi|156934382|ref|YP_001438298.1| tRNA-specific 2-thiouridylase MnmA [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166234851|sp|A7MFV2|MNMA_ENTS8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|156532636|gb|ABU77462.1| hypothetical protein ESA_02213 [Cronobacter sakazakii ATCC BAA-894]
          Length = 369

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 125/378 (33%), Positives = 193/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +           C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGED---YCTAASDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFEHFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R +D  +DQSYFL+     Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRR-----ADVDGKSRLLRGLDGNKDQSYFLYTLGHDQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+ L  A K DS  ICF+ + K+ + + R     A  G IV ++G  +G 
Sbjct: 175 EKPEVRRIAEELDLVTAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIVTVDGDTIGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         EP +VV  D  ++ +IV             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGGEEPWYVVDKDVENNILIVAQGHDHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+      + V   F C VK R  Q  +P  V+  +DD + V F++    V  GQ+ V
Sbjct: 293 LHWVD----REPVTAPFTCSVKTRYRQADIPCTVRPLDDDRIEVVFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYLGEV----CLGGGIIE 362


>gi|170760751|ref|YP_001786568.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A3 str.
           Loch Maree]
 gi|205810328|sp|B1KZE1|MNMA1_CLOBM RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|169407740|gb|ACA56151.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 356

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 138/368 (37%), Positives = 211/368 (57%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCITCNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G +LGRH G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNVLGRHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++IN++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDINYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   +DG V V+F++ +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFQEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|330900616|gb|EGH32035.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 366

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 124/377 (32%), Positives = 196/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLIEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    +   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRRLTAKVRYRQGDQPCTLEKAADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|205822340|sp|A9W8W7|MNMA_METEP RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 385

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 208/379 (54%), Positives = 268/379 (70%), Gaps = 8/379 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 1   MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 61  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGLARDLGAEALATGHYVASRARP----EGGRALYRALDPARDQSYFLYATTPEQLAYL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+IV L
Sbjct: 177 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 237 DGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGDG  ED         V++RS+++P P  +  N  +    V+    E GV+ GQACV
Sbjct: 297 NWLGDGAPEDIAERP--VAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQACV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
            Y  D   A+VLGGG I  
Sbjct: 355 IYADDDPRAQVLGGGTIRR 373


>gi|228477995|ref|ZP_04062606.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus salivarius SK126]
 gi|228250175|gb|EEK09428.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus salivarius SK126]
          Length = 373

 Score =  362 bits (929), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 192/385 (49%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVVR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKTMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVREIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSKNILYVGQGFHHESLMSTSLDASM 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA VF
Sbjct: 293 IHFTRDMPEE----FEMECTAKFRYRQPDSKVTVKVKGDKAEVIFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGGII  + +   V
Sbjct: 349 YDG----QECLGGGIIDQAYKDGKV 369


>gi|46907740|ref|YP_014129.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes str. 4b F2365]
 gi|226224113|ref|YP_002758220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes Clip81459]
 gi|254824429|ref|ZP_05229430.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL J1-194]
 gi|254852136|ref|ZP_05241484.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL R2-503]
 gi|254931447|ref|ZP_05264806.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes HPB2262]
 gi|254993966|ref|ZP_05276156.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes FSL
           J2-064]
 gi|300764822|ref|ZP_07074812.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL N1-017]
 gi|67461977|sp|Q71ZF8|MNMA_LISMF RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|259495831|sp|C1KVF9|MNMA_LISMC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|46881009|gb|AAT04306.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes serotype 4b str. F2365]
 gi|225876575|emb|CAS05284.1| Putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|258605439|gb|EEW18047.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL R2-503]
 gi|293582998|gb|EFF95030.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes HPB2262]
 gi|293593665|gb|EFG01426.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL J1-194]
 gi|300514498|gb|EFK41555.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL N1-017]
 gi|328465550|gb|EGF36779.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes 1816]
 gi|328474873|gb|EGF45673.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes 220]
          Length = 371

 Score =  362 bits (929), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 198/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  A+K DS  ICF+ +  +   +       A  G++  LNG++L
Sbjct: 173 GMEKTEVREIAKKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLNGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++ A
Sbjct: 347 DGDI----CLGGGTIDTVWKNGA 365


>gi|153875033|ref|ZP_02003007.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Beggiatoa sp. PS]
 gi|152068503|gb|EDN66993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Beggiatoa sp. PS]
          Length = 359

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 123/377 (32%), Positives = 188/377 (49%), Gaps = 27/377 (7%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           M+V+V MSGGVDSSV A LLK+ GY+V G+ ++ +        +  C A +DV DA+ VC
Sbjct: 1   MKVIVGMSGGVDSSVAALLLKKQGYEVQGLFMKNWEEDD---TENYCSAAEDVRDAQAVC 57

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           DT+ +  +  ++   + + V       Y AG TP P + CNR +KF   L     LG   
Sbjct: 58  DTLEIPLHTVNFATEYWDNVFTHCLQEYQAGRTPNPDILCNREIKFKVFLEHALHLGGKA 117

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R              + +  D  +DQSYFL+   Q QL    FP+G+++K  V
Sbjct: 118 IATGHYVRL-----GKNNAHYQLLKGHDPNKDQSYFLYTLGQSQLAHSLFPIGELQKTQV 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R LA + GL    K DS  ICF+ +  +   + R        G +    G++LG+H+G++
Sbjct: 173 RQLAEQAGLATYAKKDSTGICFIGERPFKAFLSRFLP--TQPGPMETPEGEVLGQHDGLM 230

Query: 261 NYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLG 312
            YT+GQR+GL +       GEP +VV  D  ++R+IVG   +        +  ++++W+ 
Sbjct: 231 YYTLGQRQGLNIGGQVGGSGEPWYVVAKDMPNNRLIVGQGHNHPLLFCDGLKAQQLHWIS 290

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSD 371
                 A    F C  K R  Q   P  +   +++   V F + +  V  GQ+ VFY +D
Sbjct: 291 GI----APSLPFSCSAKTRYRQTEQPCVITALDNETCEVHFNQPQRAVTPGQSVVFYQND 346

Query: 372 SNEARVLGGGIISGSKR 388
                 LGG II  +  
Sbjct: 347 ----ECLGGAIIEMTYN 359


>gi|296133414|ref|YP_003640661.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermincola sp. JR]
 gi|296031992|gb|ADG82760.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermincola potens JR]
          Length = 358

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 156/364 (42%), Positives = 216/364 (59%), Gaps = 13/364 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             +VVVAMSGGVDSS+ AALL+  GYDVIGVT+Q++      + +G CC+   V DARRV
Sbjct: 3   KSKVVVAMSGGVDSSLAAALLQEQGYDVIGVTMQIW--PAEEQAEGGCCSLAAVEDARRV 60

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            DT+ + +YV ++ + FR  VI  F + Y AG TP PC+ CNR VKF  LL     LGA+
Sbjct: 61  ADTLGIPYYVMNFRDLFRKTVIADFCAEYMAGRTPNPCIVCNRKVKFEALLQKALALGAE 120

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R      D+ +RR +M R +D  +DQ+Y L+  TQ QL     PLG+  K  
Sbjct: 121 YIATGHYARLSY---DEARRRYLMRRALDRGKDQTYALYNLTQYQLKHTLMPLGNYTKAE 177

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R++A ++GL +A+K DSQ+ICFV    Y   ++         G  + L G +LGRH GI
Sbjct: 178 AREMAAKLGLRVANKPDSQEICFVTDNNYRRFLEENVDQEIKPGPFLDLEGNVLGRHEGI 237

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YTIGQR+GLG+A+G+P++VV +D   + VI+G  E +    +   + N++    +   
Sbjct: 238 PFYTIGQRKGLGIALGKPMYVVDIDPERNAVILGSNEDVFARGLISTDNNFI----YIPE 293

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           + D  +  VKIR S  P    +  +DDGV V+FEK +  V  GQA VFY  D     V+G
Sbjct: 294 LKDPMEVEVKIRYSAQPAKAIIYPHDDGVRVEFEKPQRAVTPGQAAVFYKDD----YVVG 349

Query: 380 GGII 383
           GG I
Sbjct: 350 GGTI 353


>gi|168492409|ref|ZP_02716552.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC0288-04]
 gi|183573402|gb|EDT93930.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae CDC0288-04]
          Length = 373

 Score =  362 bits (928), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    +   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGEKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|221310688|ref|ZP_03592535.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|221315011|ref|ZP_03596816.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221319932|ref|ZP_03601226.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221324213|ref|ZP_03605507.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. SMY]
 gi|255767628|ref|NP_390627.3| tRNA-specific 2-thiouridylase MnmA [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|254763446|sp|O35020|MNMA_BACSU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225185256|emb|CAB14691.3| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 371

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 137/380 (36%), Positives = 200/380 (52%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYYEKVFQYFLDEYKAGRTPNPDVLCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D    +  M R +D  +DQ+YFL   T+  L  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGGKVRMLRGIDENKDQTYFLNQLTEDTLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 ELQKSRVREIAKEAELATATKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    I+
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+   + +    +   C  K R  Q+   V V+   +G   V F++    V  GQA VFY
Sbjct: 291 WVRSDIMK---GEEISCTAKFRYRQEDHKVTVRMTGEGEAEVIFDEQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|218532352|ref|YP_002423168.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium
           chloromethanicum CM4]
 gi|218524655|gb|ACK85240.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium chloromethanicum CM4]
          Length = 410

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 209/382 (54%), Positives = 271/382 (70%), Gaps = 8/382 (2%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           +  +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG
Sbjct: 23  SPAMNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKG 82

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VK
Sbjct: 83  ACCAGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFADSYLSGETPIPCVECNRSVK 142

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLL + R+LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL
Sbjct: 143 FRDLLGLARELGAEALATGHYVASRARP----EGGRALYRALDPARDQSYFLYATTPEQL 198

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+I
Sbjct: 199 AYLRFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEI 258

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V L+G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L
Sbjct: 259 VDLDGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRL 318

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQ 363
            ++NWLGDG  ED V       V++RS+++P P  +  N  +    V+    E GV+ GQ
Sbjct: 319 TDLNWLGDGTPEDIVERP--VAVRVRSTREPRPGRLSWNAAEACAEVELLVPEDGVSPGQ 376

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           ACV Y  D   A+VLGGG I  
Sbjct: 377 ACVIYADDDPRAQVLGGGTIRR 398


>gi|153814505|ref|ZP_01967173.1| hypothetical protein RUMTOR_00719 [Ruminococcus torques ATCC 27756]
 gi|317500546|ref|ZP_07958768.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089354|ref|ZP_08338254.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847999|gb|EDK24917.1| hypothetical protein RUMTOR_00719 [Ruminococcus torques ATCC 27756]
 gi|316898056|gb|EFV20105.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330405417|gb|EGG84952.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 356

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 149/366 (40%), Positives = 210/366 (57%), Gaps = 15/366 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARR 78
            +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++        +  G CC    V DARR
Sbjct: 2   KKVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEEDVCTVEENGGCCGLSAVEDARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   + + +YV ++ E F+  VI  FA SY  G+TP PC+ CNR VK+  LL  +  +GA
Sbjct: 62  VAAALGIPYYVMNFREEFQKNVIDYFADSYVNGQTPNPCIACNRYVKWEALLKRSISIGA 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R           R  + R     +DQ+Y L+  TQ+QL     P+G+  KE
Sbjct: 122 DFIATGHYARVEQL----SNGRYALRRSATAAKDQTYALYNLTQEQLKRTLMPVGEYTKE 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A ++GL +ADK DSQDICFVQ G Y   ++      A EG+ V  +G ++GRH G
Sbjct: 178 EVRVIAEKIGLLVADKPDSQDICFVQDGNYAAFIEEHTGKKASEGNFVTSDGTVIGRHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           II+YT+GQR+GLG+A+G P FV+ +   ++ V++G  E      +  +++N++      +
Sbjct: 238 IIHYTVGQRKGLGLALGYPAFVLEIRPETNEVVIGTYEESLTTVVRAKQLNFMS----VE 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  + F KIR +       V+R  +D V   FE+ +  V  GQA VFY  +     V
Sbjct: 294 DLKEPLRVFAKIRYNHKGAWCTVERTKEDEVTCCFEEPQRAVTPGQAIVFYDGE----YV 349

Query: 378 LGGGII 383
           LGGG I
Sbjct: 350 LGGGTI 355


>gi|254291552|ref|ZP_04962342.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae AM-19226]
 gi|150422504|gb|EDN14461.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae AM-19226]
          Length = 372

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 189/379 (49%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 8   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 64

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 65  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 124

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 125 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 181

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 182 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 239

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 240 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 300 LHWVD----RTPITGPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 355

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 356 FYQGEI----CLGGGIIEE 370


>gi|306834574|ref|ZP_07467687.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus bovis ATCC 700338]
 gi|304423376|gb|EFM26529.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus bovis ATCC 700338]
          Length = 373

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 190/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG ++
Sbjct: 120 GADYVATGHYAQVSR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G H
Sbjct: 176 KPEVRKIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +    I
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNQPWFVVGKDLSKNILYVGQGFYHESLMSTSLDASSI 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +   K R  Q    V +    D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTMEVTAKFRYRQPDSKVTIHVKGDKAEVVFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
                    LGGGII  + ++   
Sbjct: 350 DG----KECLGGGIIDMAYKNGVA 369


>gi|148379169|ref|YP_001253710.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|153931319|ref|YP_001383546.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936775|ref|YP_001387095.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A str.
           Hall]
 gi|205810260|sp|A7FT69|MNMA1_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|205810283|sp|A5I123|MNMA1_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|148288653|emb|CAL82734.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|152927363|gb|ABS32863.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 19397]
 gi|152932689|gb|ABS38188.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. Hall]
          Length = 356

 Score =  362 bits (928), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 209/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAIGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L   ++  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTKLIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|325686453|gb|EGD28482.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK72]
          Length = 373

 Score =  362 bits (928), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|325689331|gb|EGD31337.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK115]
          Length = 373

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ +   V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWERVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTIECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|324989555|gb|EGC21501.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK353]
          Length = 373

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F+K +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDKPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|311069234|ref|YP_003974157.1| tRNA-specific 2-thiouridylase MnmA [Bacillus atrophaeus 1942]
 gi|310869751|gb|ADP33226.1| tRNA-specific 2-thiouridylase MnmA [Bacillus atrophaeus 1942]
          Length = 371

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 137/380 (36%), Positives = 202/380 (53%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWDKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D    +  M R +D  +DQ+YFL   T++QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGGKVRMLRGLDENKDQTYFLNQLTEEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 ELQKSRVREIAKEAELATAAKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I   +++
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITAADVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFY 368
           W   G+ +        C  K R  Q+   V V+   +    V F++    V  GQA VFY
Sbjct: 291 WTRTGILD---GKEISCTAKFRYRQEDHKVTVRMTGESEAEVIFDEQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|116872941|ref|YP_849722.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|123461086|sp|A0AIW1|MNMA_LISW6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116741819|emb|CAK20943.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 371

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 199/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLEEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKIGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A + GL  A+K DS  ICF+ +  +   +       A  G++  L+G++L
Sbjct: 173 GMEKTEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D  ++ + V      ESL    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKANVLFVEQGFHHESLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           +  +          F+C  K R  Q    V V   +D    V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTFECTAKFRYRQTDTKVTVHLRSDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +++A
Sbjct: 347 DGDI----CLGGGTIDTVWKNEA 365


>gi|262281666|ref|ZP_06059435.1| tRNA-specific 2-thiouridylase mnmA [Streptococcus sp. 2_1_36FAA]
 gi|262262120|gb|EEY80817.1| tRNA-specific 2-thiouridylase mnmA [Streptococcus sp. 2_1_36FAA]
          Length = 373

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDKAYKNGQV 369


>gi|254480686|ref|ZP_05093933.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2148]
 gi|214039269|gb|EEB79929.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2148]
          Length = 363

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 123/374 (32%), Positives = 191/374 (51%), Gaps = 26/374 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            +V+V MSGGVDSSV A LLK  GY V G+ ++ +     ++    C A +D  DA+ V 
Sbjct: 7   KKVIVGMSGGVDSSVSALLLKEQGYAVEGLFMKNWEEDDGTE---YCTAKEDFADAQAVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 64  DKLGIKLHGANFAAEYWDNVFEHFLDEYRAGRTPNPDILCNREIKFKAFLDYALTLGADL 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R  L  G     +  + + +D  +DQSYFL A   ++L    FP+GD++K  V
Sbjct: 124 IATGHYTRLGLAAG-----QATLLKGLDPNKDQSYFLHAVGHRELAKTLFPVGDIEKPEV 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R LA E  L  A K DS  ICF+ + ++ D +++     A  GDIV L+G+ LG+H G++
Sbjct: 179 RSLAEEYDLATAKKKDSTGICFIGERRFSDFLQQYLP--AQPGDIVSLDGEHLGQHQGLM 236

Query: 261 NYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +VV  D +++ ++V             +   E+ W+ 
Sbjct: 237 YHTIGQRQGLGIGGLANHTDDPWYVVEKDLDNNVLLVAQGNDHPALFKSSLVTGEVFWVA 296

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                       +C  K+R  Q      +     G  V+F+  +  +  GQ+ VFY  ++
Sbjct: 297 GA----PPPLPLQCTAKVRYRQSDQSCTITEQKGGYQVEFDAPQRAITPGQSVVFYLGET 352

Query: 373 NEARVLGGGIISGS 386
                LGGG+I  +
Sbjct: 353 ----CLGGGVIERT 362


>gi|329926781|ref|ZP_08281189.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus sp. HGF5]
 gi|328938981|gb|EGG35349.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus sp. HGF5]
          Length = 389

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 203/384 (52%), Gaps = 23/384 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           + + K   + R+VV MSGGVDSSV A LLK+ GY+VIG+ ++ ++    +   G C A  
Sbjct: 19  ITMSKEKHNTRIVVGMSGGVDSSVTALLLKQQGYEVIGIFMKNWDD---TDELGYCTAEA 75

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D  D RRVC+ +++ +Y  ++E+ + + V   F   Y AG TP P V CNR +KF + L+
Sbjct: 76  DAEDVRRVCEQLDIPYYTVNFEKEYFDKVFSYFLDEYKAGRTPNPDVMCNREIKFGEFLN 135

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
               LGAD +ATGHY R     G     +  + R +D  +DQ+YFL A +Q+QL    FP
Sbjct: 136 KAMDLGADYVATGHYARVIEEDG-----QYRLLRGVDSNKDQTYFLNALSQEQLSKAMFP 190

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NG 250
           +G + K  VR LA E GL  A K DS  +CF+ +  + + + +     A  GD+V +  G
Sbjct: 191 IGHLPKPEVRRLAEEAGLYTAKKKDSTGVCFIGERNFKEFLGQYLP--AQSGDMVDIVTG 248

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGE---PLFVVYLDKNSSRVIVGPRESL--EVHRIYL 305
           ++ GRH+G++ YT+GQR+GLG+       P FV   D  ++ + V   +        +  
Sbjct: 249 EVKGRHDGLMYYTLGQRQGLGIGGSGSGEPWFVADKDLTNNILYVVQGDHPSLYSTGLVA 308

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQA 364
             +NW+     +    D + C  K R  Q    V +   +DG V+V F K +  +  GQA
Sbjct: 309 SGMNWIAG--QDAMPKDAYACTAKFRYRQPDQEVTITPREDGTVHVAFAKPQKAITPGQA 366

Query: 365 CVFYTSDSNEARVLGGGIISGSKR 388
            VFY  D      LGGG I  + +
Sbjct: 367 VVFYQGDD----CLGGGTIETADK 386


>gi|153938615|ref|YP_001390533.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum F str.
           Langeland]
 gi|205810312|sp|A7GCM3|MNMA1_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|152934511|gb|ABS40009.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. Langeland]
 gi|295318614|gb|ADF98991.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. 230613]
          Length = 356

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGSILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|153826012|ref|ZP_01978679.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MZO-2]
 gi|149740232|gb|EDM54379.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio cholerae MZO-2]
          Length = 372

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 8   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 64

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD I +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 65  QAVCDKIGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 124

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 125 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 181

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 182 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 239

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 240 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGADHPLLKSHGLVAAQ 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   +DD + V F++ +V V  GQ+ V
Sbjct: 300 LHWVD----RTPITEPVRCSVKTRYRQSDIACTIIPLSDDRIKVMFDEPQVAVTPGQSAV 355

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 356 FYQGEI----CLGGGIIEE 370


>gi|315179841|gb|ADT86755.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio furnissii NCTC 11218]
          Length = 372

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 116/379 (30%), Positives = 189/379 (49%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+    +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTF---PEHGEKPQMLRGLDGNKDQSYFLYTLGHEQVARSLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGL-----GVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL          +P +V   D   + +I            + +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKDGSEDPWYVAEKDLKRNVLIAVQGADHPLLKSNGLIASQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   V   +++ + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RLPMTEPMRCTVKTRYRQTDIQCTVTPVDENTIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEV----CLGGGIIEE 369


>gi|321312277|ref|YP_004204564.1| tRNA-specific 2-thiouridylase MnmA [Bacillus subtilis BSn5]
 gi|291485158|dbj|BAI86233.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus subtilis subsp. natto BEST195]
 gi|320018551|gb|ADV93537.1| tRNA-specific 2-thiouridylase MnmA [Bacillus subtilis BSn5]
          Length = 371

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 137/380 (36%), Positives = 200/380 (52%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYYEKVFQYFLDEYKAGRTPNPDVLCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D    +  M R +D  +DQ+YFL   T+  L  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGEKVRMLRGIDENKDQTYFLNQLTEDTLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 ELQKSRVREIAKEAELATATKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    I+
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+   + +    +   C  K R  Q+   V V+   +G   V F++    V  GQA VFY
Sbjct: 291 WVRSDIMK---GEEISCTAKFRYRQEDHKVTVRMTGEGEAEVIFDEQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|242242895|ref|ZP_04797340.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis W23144]
 gi|242233670|gb|EES35982.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis W23144]
          Length = 372

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 135/380 (35%), Positives = 205/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE++ + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEQYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIRRH----EDGHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDV 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + + +     A  G+++ LNG+ +G+
Sbjct: 174 EKSEVRRIAEEQNLATAKKKDSTGICFIGERNFKEFLSQYLP--AQSGEMLTLNGKKMGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  + N + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLNDNILYVEQGFHHDALYSDYLIASDFSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTS 370
                +  +  GF+C  K R  Q    V+VQR N++ + V F +    +  GQA VFY  
Sbjct: 292 NPSEID--LEKGFECTAKFRYRQKDTKVYVQRENENSIRVTFAEPVRAITPGQAVVFYNQ 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGG  I    +++
Sbjct: 350 EV----CLGGATIDDVYKNE 365


>gi|91226036|ref|ZP_01260963.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio alginolyticus 12G01]
 gi|91189477|gb|EAS75754.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio alginolyticus 12G01]
          Length = 374

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 122/380 (32%), Positives = 195/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDGNKDQSYFLYTLSNEQIARSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            +P FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLERNVLIAVQGKDHPMLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYKGDV----CLGGGIIE 366


>gi|313623686|gb|EFR93838.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria innocua FSL J1-023]
          Length = 371

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 135/383 (35%), Positives = 195/383 (50%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A + GL  A+K DS  ICF+ +  +   +       A  GD+  L+G++L
Sbjct: 173 GMEKTEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGDMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D  ++ + V             +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKNNVLFVEQGFHHDSLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +          F+C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNS----EKPKTFECTAKFRYRQTDTKVTVNMREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +  A
Sbjct: 347 DGDI----CLGGGTIDTVWKKGA 365


>gi|251783539|ref|YP_002997844.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242392171|dbj|BAH82630.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
          Length = 379

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 191/386 (49%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +  + RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 6   FMTDNSNTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 63  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 MTLGADYVATGHYAQVKR----DEDGTVHMLRGADNGKDQTYFLSQLSQKQLQKTLFPLG 178

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 179 HLQKPEVRQIAERAGLATAKKKDSTGICFIGEKNFKTFLSQYLP--AQKGRMMTVDGRDM 236

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +  
Sbjct: 237 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHESLMSTSLDA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             +++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA 
Sbjct: 297 SVVHFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVVFAEPQRAITPGQAV 352

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY  +      LGGG+I  + R   
Sbjct: 353 VFYDGE----ECLGGGMIDMAYRDGQ 374


>gi|322390500|ref|ZP_08064018.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis ATCC 903]
 gi|321142774|gb|EFX38234.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis ATCC 903]
          Length = 373

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 190/380 (50%), Gaps = 25/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVSR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTIDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      ESL    +    I
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSQNILYVGQGFYHESLMSTSLDASMI 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FEMECTAKFRYRQPDSKVTVKVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKR 388
                    LGGGII  + +
Sbjct: 350 DG----QECLGGGIIDQAYK 365


>gi|116492933|ref|YP_804668.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase,
           PP-loop ATPase [Pediococcus pentosaceus ATCC 25745]
 gi|122265603|sp|Q03EZ6|MNMA_PEDPA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116103083|gb|ABJ68226.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pediococcus pentosaceus ATCC 25745]
          Length = 377

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 134/385 (34%), Positives = 195/385 (50%), Gaps = 24/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSVVA LLK+ GYDV+GV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVVAYLLKQQGYDVVGVFMKNWDD---TDENGYCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F   Y  G TP P V CN  +KF   L     
Sbjct: 59  VAKVAAKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPNPDVICNNEIKFKAFLDYAIS 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D    + + R  D  +DQ+YFL   + +QL  + FPLG M
Sbjct: 119 LGADYVATGHYAQVER----DENGHQHLLRATDSNKDQTYFLSQLSAEQLDRVMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR +A E GL + DK DS  ICF+ +  + + +       A  G ++ L+G++ G 
Sbjct: 175 IKPEVRKVAEEAGLSVYDKKDSVGICFIGEKNFREFLGNYLP--AKAGKMMTLDGEVKGE 232

Query: 256 HNGIINYTIGQRRGLGVAMG----EPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
           H G++ YTIGQRRGLG+  G    EP FVV  D + + + V        L    +   ++
Sbjct: 233 HAGLMYYTIGQRRGLGIGGGSKNNEPWFVVGKDLSKNILYVGQGFENSHLYAASLDASDM 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACV 366
           +++      +     F+C  K R     VPV V  ++D   V VDF+     +  GQA V
Sbjct: 293 HFVN--KLGEERGRDFRCTAKFRYRAQDVPVTVHFSEDFSKVTVDFDDPARAITPGQALV 350

Query: 367 FYTSDSNEARVLGGGIISGSKRSDA 391
            Y  +      +GGGII  +  S+ 
Sbjct: 351 LYDGE----ECIGGGIIDAAYNSEK 371


>gi|322374000|ref|ZP_08048534.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. C150]
 gi|321276966|gb|EFX54037.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sp. C150]
          Length = 373

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 136/385 (35%), Positives = 193/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVVR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKTMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVREIAEHAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSKNILYVGQGFHHESLMSTSLDASM 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D L E       +C  K R  Q    V V+   D   V F + +  +  GQA VF
Sbjct: 293 IHFTRDMLEE----FDMECTAKFRYRQPDSKVTVKVKGDKAEVIFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGGII  + +   V
Sbjct: 349 YDG----QECLGGGIIDQAYKDGKV 369


>gi|320156716|ref|YP_004189095.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio vulnificus MO6-24/O]
 gi|319932028|gb|ADV86892.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio vulnificus MO6-24/O]
          Length = 374

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 127/381 (33%), Positives = 196/381 (51%), Gaps = 28/381 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +     S+    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNSE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHKINFASEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G+I    G++LG+
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGNIESPEGEVLGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            EP FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEEPWFVAEKDLKRNVLIAVQGQDHPMLKSEGLIA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q  +P  +   DD  + V F++ E+ V  GQ+
Sbjct: 295 SQLHWV----EREPIRDVMKCTVKTRYRQQDIPCTIIPIDDENIKVIFDEPEIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  D      LGGGII  
Sbjct: 351 AVFYQGDV----CLGGGIIEK 367


>gi|224476719|ref|YP_002634325.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|254811461|sp|B9DNH6|MNMA_STACT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|222421326|emb|CAL28140.1| putative (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 370

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 133/380 (35%), Positives = 194/380 (51%), Gaps = 22/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + +D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNQDTRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEQEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R +D  +DQ+YFL   T +QL  + FPLG M
Sbjct: 118 LGADYVATGHYAQVRR----DADGNVEMLRGVDNNKDQTYFLNQLTHEQLSKVMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + +       A  GD+  LNG+ +G 
Sbjct: 174 EKSEVRRIAAEQDLATAKKKDSTGICFIGERNFKEFLSNYLP--AQSGDMRTLNGKKMGT 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   +++ +
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLEDNVLYVEQGFHHDALYSDYLIASDVSLV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTS 370
            D      + DG +C  K R  Q    V V + +++ + VDF++    +  GQA V Y  
Sbjct: 292 NDI----DLTDGLECTAKFRYRQKDTKVTVTRIDENQIRVDFDQPVRAITPGQAVVLYDG 347

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +  
Sbjct: 348 DV----CLGGATIDDVYKEA 363


>gi|37679527|ref|NP_934136.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio vulnificus YJ016]
 gi|61217310|sp|Q7MLT4|MNMA_VIBVY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|37198271|dbj|BAC94107.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Vibrio vulnificus YJ016]
          Length = 374

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 128/381 (33%), Positives = 196/381 (51%), Gaps = 28/381 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +     S+    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDDSE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F S Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHKINFAAEYWDNVFEYFLSEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGEL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G+I    G++LG+
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGNIESPEGEVLGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            EP FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEEPWFVAEKDLKRNVLIAVQGQDHPMLKSEGLIA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q  +P  +   DD  + V F++ E+ V  GQ+
Sbjct: 295 SQLHWV----EREPIRDVMKCTVKTRYRQQDIPCTIIPIDDENIKVIFDEPEIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  D      LGGGII  
Sbjct: 351 AVFYQGDV----CLGGGIIEK 367


>gi|320323780|gb|EFW79864.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327920|gb|EFW83925.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 366

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DKIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  G+I    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGEIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W  
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWAN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++  DG    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQGDQPCTLEKTADGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|226944910|ref|YP_002799983.1| tRNA-specific 2-thiouridylase MnmA [Azotobacter vinelandii DJ]
 gi|226719837|gb|ACO79008.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Azotobacter vinelandii DJ]
          Length = 372

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 127/388 (32%), Positives = 201/388 (51%), Gaps = 26/388 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +P   RV+V MSGGVDSSV A LL + GY V G+ ++ +     ++    C A +D+ DA
Sbjct: 3   DPAHTRVIVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWEEDDGTE---YCTAKEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           + VCD I +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     L
Sbjct: 60  QAVCDRIGMRLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALSL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD++ATGHY+R R     D + R  + + +D  +DQSYFL A   +QL    FP+G+++
Sbjct: 120 GADMIATGHYVRRR-----DAEDRTELLKGLDPNKDQSYFLHAVASEQLAKSLFPVGELE 174

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K +VR +A   GL  A K DS  ICF+ + ++ D +K+     A  G I    G+++G+H
Sbjct: 175 KPAVRAIAELHGLATARKKDSTGICFIGERRFGDFLKQYLP--ARPGPIETTEGKVIGQH 232

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
           +G++ +TIGQR+GLG+        +P +V+  D   + +IV        L    ++  E+
Sbjct: 233 HGLMYHTIGQRQGLGIGGMKNATEDPWYVLAKDLTRNVLIVGQGNQHPWLFSRALHTSEM 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
            W+    F        +   K+R  Q      +++ D G  V F++ +  V  GQ+ V Y
Sbjct: 293 FWVNPPDFP----LPRRLAAKVRYRQGDQTCTLEKTDQGFRVLFDEPQRAVTPGQSVVLY 348

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESL 396
             D      LGGG+I  ++     +E  
Sbjct: 349 DGDV----CLGGGVIETAEPWKREDEQP 372


>gi|288906423|ref|YP_003431645.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus gallolyticus UCN34]
 gi|288733149|emb|CBI14730.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus gallolyticus UCN34]
          Length = 373

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 131/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG ++
Sbjct: 120 GADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G H
Sbjct: 176 KPEVRKIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +    I
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNQPWFVVGKDLSKNILYVGQGFYHDSLMSTSLDASSI 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +   K R  Q    V V        V F++ +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTMEVTAKFRYRQPDSKVTVHVKGAKAEVVFDEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGGII  + ++   
Sbjct: 350 DGE----ECLGGGIIDMAYKNGVA 369


>gi|84391736|ref|ZP_00991638.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio splendidus 12B01]
 gi|84376449|gb|EAP93328.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio splendidus 12B01]
          Length = 378

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 118/387 (30%), Positives = 193/387 (49%), Gaps = 27/387 (6%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQD 72
           D+     + +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D
Sbjct: 3   DISSGNSEKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAED 59

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           + DA+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L  
Sbjct: 60  LADAQAVCDKLGIHLHTINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEF 119

Query: 133 TRQ-LGADVLATGHYIRSRLYVGD--DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
             + L AD +A GHY+R      +  D   +  M R +D  +DQSYFL+  +  Q+    
Sbjct: 120 ADEVLDADYIAMGHYVRRTFPTQEELDAGVKPEMLRGLDGNKDQSYFLYTLSSDQVARSL 179

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FP+G+++K  VR +A E  L  A K DS  ICF+ + K+ + + +     A  G+I    
Sbjct: 180 FPVGELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPE 237

Query: 250 GQILGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE--- 299
           GQ++G+H G++ +T+GQR+GL            +P FV   D   + +I    +      
Sbjct: 238 GQVIGQHQGLMYHTLGQRKGLHIGGTKGGGGNEDPWFVGEKDLKRNVLIAVQGKDHPLLK 297

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVG 358
              +   +++W+        + +   C VK R  Q  +P  +   +DD + V F++ ++ 
Sbjct: 298 SEGLIASQLHWVN----RTPITEVMTCTVKTRYRQTDIPCTIIPIDDDNIKVIFDEPQIA 353

Query: 359 VASGQACVFYTSDSNEARVLGGGIISG 385
           V  GQ+ VFY  +      LGGGII  
Sbjct: 354 VTPGQSAVFYQDEV----CLGGGIIEK 376


>gi|110801338|ref|YP_696468.1| tRNA-specific 2-thiouridylase MnmA [Clostridium perfringens ATCC
           13124]
 gi|168211408|ref|ZP_02637033.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626]
 gi|24638315|sp|Q8XJH3|MNMA_CLOPE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|123049729|sp|Q0TPH2|MNMA_CLOP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110675985|gb|ABG84972.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens ATCC 13124]
 gi|170710614|gb|EDT22796.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626]
          Length = 359

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 210/368 (57%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----D 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V
Sbjct: 294 KLEGPMEVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|168214260|ref|ZP_02639885.1| tRNA -methyltransferase [Clostridium perfringens CPE str. F4969]
 gi|170714272|gb|EDT26454.1| tRNA -methyltransferase [Clostridium perfringens CPE str. F4969]
          Length = 359

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 209/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G  LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNALGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----D 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V
Sbjct: 294 KLEGPMEVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|28870522|ref|NP_793141.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|37999578|sp|Q87ZR6|MNMA_PSESM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|28853770|gb|AAO56836.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 376

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 12  KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 69  DRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 129 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPQV 183

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  GDI    G+++GRH+G++
Sbjct: 184 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGDIKTTEGEVIGRHSGLM 241

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 242 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++   G    F+  +  V  GQ+ VFY  + 
Sbjct: 302 PI----DLSSPRKLTAKVRYRQSDQPCTLEKTAGGYRATFDDPQRAVTPGQSVVFYDGEI 357

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 358 ----CLGGGVIEIAEPW 370


>gi|270261459|ref|ZP_06189732.1| tRNA-specific 2-thiouridylase mnmA [Serratia odorifera 4Rx13]
 gi|270044943|gb|EFA18034.1| tRNA-specific 2-thiouridylase mnmA [Serratia odorifera 4Rx13]
          Length = 367

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 122/378 (32%), Positives = 196/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVTAYLLQQQGYQVAGLFMKNWEEDDDEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LGADFIATGHYVRRQ-----DVDGKSRLLRGVDGNKDQSYFLYTLSHEQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G IV+++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIVNVDGQTVGE 232

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGMKDSSEDPWYVVDKDVANNVLVVAQGHDHPRLMSTGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V   DD  + V F++    V  GQ+ V
Sbjct: 293 LHWVD----RLPLSGPLRCTVKTRYRQQDIPCTVTPLDDQRIEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEI----CLGGGIIE 362


>gi|168218238|ref|ZP_02643863.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens NCTC 8239]
 gi|182379744|gb|EDT77223.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens NCTC 8239]
          Length = 359

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 210/368 (57%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----D 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V
Sbjct: 294 KLEGPMEVEAKIRYSARPAKATISPMENGKVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|257892743|ref|ZP_05672396.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,408]
 gi|257829122|gb|EEV55729.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,408]
          Length = 373

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 192/385 (49%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + N V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWNRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +G++V L+G++ G+
Sbjct: 175 EKSEVRAIAERAGLATAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 232

Query: 256 HNGIINYTI----GQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTI    G   G G    EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGNSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|90021322|ref|YP_527149.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Saccharophagus degradans 2-40]
 gi|123090544|sp|Q21K42|MNMA_SACD2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|89950922|gb|ABD80937.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Saccharophagus degradans 2-40]
          Length = 380

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 120/382 (31%), Positives = 197/382 (51%), Gaps = 23/382 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
            +   ++ V+V MSGGVDSSV A LLK+ GY V G+ ++ ++    ++    C A  D+ 
Sbjct: 13  PRPANEITVIVGMSGGVDSSVSALLLKQQGYKVEGLFMKNWDEDDGTE---YCTAMTDLM 69

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA  VC  +++  +  ++  ++ + V   F   Y A  TP P + CNR +KF   L   +
Sbjct: 70  DAAAVCQKLDIHLHTANFARQYWDNVFEYFLEEYKACRTPNPDILCNREIKFKVFLEYAK 129

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           +LGAD +ATGHY R+  + G        + + +D  +DQSYFL A  +Q+     FP+GD
Sbjct: 130 KLGADYIATGHYTRTSQHEGC-----TQLRKGLDPNKDQSYFLHAVGEQEFAQTLFPIGD 184

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A E GL   +K DS  ICF+ + ++ D ++      A  G IV  NG  +G
Sbjct: 185 IEKPQVRAIAEERGLVTHNKKDSTGICFIGERRFKDFLETYLP--AQPGVIVDENGVEIG 242

Query: 255 RHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           +H G++ +TIGQR+GLG+         P +V      +++++V    +      + +   
Sbjct: 243 KHQGLMYHTIGQRQGLGIGGVPGRPEAPWYVAEKRLQTNQLVVVQGSNHPLLFSNELTTG 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
            ++W+   L    + + F+C  K R  Q      +  N DGV   F++ +  V  GQ+ V
Sbjct: 303 AMHWINPRLAPT-LSEPFRCTAKTRYRQPEQWCTLTANGDGVIAVFDEPQRAVTPGQSAV 361

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  D      LGG +I  +++
Sbjct: 362 FYQGDI----CLGGAVIETTRK 379


>gi|257453848|ref|ZP_05619126.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enhydrobacter aerosaccus SK60]
 gi|257448775|gb|EEV23740.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enhydrobacter aerosaccus SK60]
          Length = 391

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 129/393 (32%), Positives = 205/393 (52%), Gaps = 24/393 (6%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
           ++ +T +N  D+  +P   RV+V MSGGVDSSV A LLK+ G+DV G+ ++ +     ++
Sbjct: 1   MNYSTAVNLSDIA-SPAQTRVIVGMSGGVDSSVTAVLLKQAGFDVEGLFMKNWEEDDGTE 59

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
               C A  D+ DA+ V D I +  +  ++   + + V   F + Y+AG TP P + CN+
Sbjct: 60  ---YCTAMTDLADAQAVADKIGIKLHTANFAMEYWDRVFEHFLAEYSAGRTPNPDILCNK 116

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
            VKF   L     LGAD +ATGHY R       D   +  + R +D  +DQSYFL A   
Sbjct: 117 EVKFKAFLDYALTLGADYIATGHYARRGFS---DETGKAPLLRGLDNNKDQSYFLHAVAG 173

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
            ++    FP+G ++K  VR +A +  L  A K DS  ICF+ + ++ D +++     A +
Sbjct: 174 DKIAKTLFPVGALEKPEVRRIAEQYDLATAKKKDSTGICFIGERRFKDFLQQYLP--AQK 231

Query: 243 GDIVHLNGQILGRHNGIINYTIGQR-----RGLGVAMGEPLFVVYLDKNSSRVIV---GP 294
           GDI   +G+ +G H+G++ YT+GQR      G+      P FV++ D +++R+IV     
Sbjct: 232 GDIYTDDGKKIGTHDGLMYYTLGQRGGIGIGGVKDRDEAPWFVLHKDLDNNRLIVGQGHD 291

Query: 295 RESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND---DGVYVD 351
              L+   +   +++W+ D   +     G++C  K R  Q      V   D   D + V 
Sbjct: 292 HPMLQSTELTAYKLDWVVDAPAQLFTAQGYRCTAKTRYRQPDQACTVFALDETGDTIKVV 351

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           F++ +  V  GQ+CVFY  D      LGGG+I 
Sbjct: 352 FDEPQRAVTPGQSCVFYQDDI----CLGGGVIE 380


>gi|237794471|ref|YP_002862023.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Ba4 str. 657]
 gi|229260617|gb|ACQ51650.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Ba4 str. 657]
          Length = 356

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 138/368 (37%), Positives = 209/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY   +         R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIK-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   DDG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQIPSKAIITPIDDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|192361469|ref|YP_001982951.1| tRNA-specific 2-thiouridylase MnmA [Cellvibrio japonicus Ueda107]
 gi|190687634|gb|ACE85312.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cellvibrio japonicus Ueda107]
          Length = 378

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 120/376 (31%), Positives = 195/376 (51%), Gaps = 27/376 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V+V MSGGVDSSV A LL++ GY V G+ ++ ++    ++    C A  D+ DA+RVCD
Sbjct: 20  KVIVGMSGGVDSSVSALLLQQQGYAVEGLFMKNWDEDDGTE---YCTAKADLADAQRVCD 76

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + +  +  ++   + + V   F   Y AG TP P + CNR +KF   +   + LG +++
Sbjct: 77  KLGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKVFMEYAQMLGGELI 136

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R       D     ++ + +D  +DQSYFL A  + +     FP+G+++K  VR
Sbjct: 137 ATGHYVRR-----ADRNGHTLLLKGLDPNKDQSYFLHAVGEAEFAKSLFPVGELEKPEVR 191

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A E GL   +K DS  ICF+ + ++ D +++     A  G+I   +GQ++G H G++ 
Sbjct: 192 RIAEEHGLVTHNKKDSTGICFIGERRFKDFLQQYLP--AQPGEIQTPDGQVIGEHMGLMY 249

Query: 262 YTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLGD 313
           +TIGQR+GLG+        EP FV   D   + +IV           + +  ++ +W+  
Sbjct: 250 HTIGQRQGLGIGGVKGANEEPWFVAQKDLGRNVLIVVQGTDHPLLYTNHLLAQQTHWING 309

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDS 372
                A    F+C  K R  Q      VQ  D+G + V F++ +  V  GQ+ V Y  D+
Sbjct: 310 S----APASEFRCMAKTRYRQPDQACRVQVLDNGRLDVFFDEPQRAVTPGQSLVLYDGDT 365

Query: 373 NEARVLGGGIISGSKR 388
                LGG +I  +  
Sbjct: 366 ----CLGGAVIESTDN 377


>gi|163801953|ref|ZP_02195849.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. AND4]
 gi|159174094|gb|EDP58902.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. AND4]
          Length = 374

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 120/380 (31%), Positives = 195/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +  ++  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LDADYIAMGHYVRRSF---PENGKKPQMLRGLDSNKDQSYFLYTLSNEQIARSLFPVGNL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL            +P FV   D   + +I    +         +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLKRNVLIAVQGKDHPLLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIVPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYEGDV----CLGGGIIE 366


>gi|299822830|ref|ZP_07054716.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria grayi DSM 20601]
 gi|299816359|gb|EFI83597.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria grayi DSM 20601]
          Length = 370

 Score =  360 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 131/381 (34%), Positives = 201/381 (52%), Gaps = 23/381 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+  ++RVVV MSGGVDSSV A LLK+ GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 2   KDNSNIRVVVGMSGGVDSSVTAYLLKQQGYDVVGIFMKNWDD---TDEFGVCTATEDYED 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             RV + I + +Y  ++E+++ + V   F + Y  G TP P V CN+ +KF   L     
Sbjct: 59  VIRVANQIGIPYYAVNFEKQYWDKVFTYFLAEYKLGRTPNPDVMCNKEIKFKAFLEHAES 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R+ +  G+       + R +D  +DQ+YFL   +Q+QL  + FPLG M
Sbjct: 119 LGADYVATGHYARTEIVDGE-----VQLLRGVDNNKDQTYFLNQLSQEQLSKVMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VRD+A++ GL  A+K DS  ICF+ +  +   +       A  G++  L G+ +G+
Sbjct: 174 EKSEVRDIAQKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLTGKRMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   GEP FV   D  ++ + V             +   ++++ 
Sbjct: 232 HDGLMYYTIGQRHGLGIGGDGEPWFVAGKDLENNVLFVEQGFHHDSLYSDMLIATDVSFT 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
            +   E      F C  K R  Q    V V   ++G   V F++    +  GQA VFY  
Sbjct: 292 SNRPKE----MVFHCTAKFRYRQVDSGVTVYLTENGTAKVVFDEPVRAITPGQAVVFYDG 347

Query: 371 DSNEARVLGGGIISGSKRSDA 391
           D      LGG  I    +++ 
Sbjct: 348 DI----CLGGATIDTVYKNEK 364


>gi|323128291|gb|ADX25588.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 373

 Score =  360 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  + RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSNTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DEDGTVHMLRGADNGKDQTYFLSQLSQKQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVRQIAERAGLATAKKKDSTGICFIGEKNFKTFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHESLMSTSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 VHFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y  +      LGGG+I  + R   
Sbjct: 349 YDGE----ECLGGGMIDMAYRDGQ 368


>gi|217964341|ref|YP_002350019.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes HCC23]
 gi|254811452|sp|B8DDZ8|MNMA_LISMH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|217333611|gb|ACK39405.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes HCC23]
 gi|307571093|emb|CAR84272.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes L99]
          Length = 371

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 199/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADFVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  A+K DS  ICF+ +  +   +       A  G++  LNG++L
Sbjct: 173 AMEKTEVREIAKKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLNGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +     A     +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----AKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++ A
Sbjct: 347 DGDI----CLGGGTIDTVWKNGA 365


>gi|319759218|gb|ADV71160.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus suis JS14]
          Length = 419

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 132/387 (34%), Positives = 192/387 (49%), Gaps = 25/387 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 46  MSIDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 102

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 103 KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 162

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 163 MNLGADYVATGHYAQV----TRDEDGTVHMLRGADNGKDQTYFLSQLSQEQLQKTMFPLG 218

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  + + + +     A  G ++ ++G+ +
Sbjct: 219 HLQKPQVREIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTVDGRDM 276

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        EP FVV  D + + + V      ESL    +  
Sbjct: 277 GEHTGLMYYTIGQRGGLGIGGQIGGDNEPWFVVGKDLSKNILYVGQGFYHESLMSTSLQA 336

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
            ++++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA 
Sbjct: 337 SQVHFTRDMPEE----FTLECTAKFRYRQPDSQVTVKVKGDKAEVIFAEPQRAITPGQAV 392

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAV 392
           VFY         LGGG+I  + +    
Sbjct: 393 VFYDG----QECLGGGMIDMAYKDGEA 415


>gi|312864108|ref|ZP_07724343.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus vestibularis F0396]
 gi|322515817|ref|ZP_08068761.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus vestibularis ATCC 49124]
 gi|311100340|gb|EFQ58548.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus vestibularis F0396]
 gi|322125703|gb|EFX97025.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus vestibularis ATCC 49124]
          Length = 373

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 194/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVVR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKTMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A  +GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVREIAERVGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSKNILYVGQGFHHESLMSTSLDASM 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA VF
Sbjct: 293 IHFTRDMPEE----FEMECTAKFRYRQPDSKVTVKVKGDKAEVIFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGGII  + +   V
Sbjct: 349 YDG----QECLGGGIIDQAYKDGKV 369


>gi|310643522|ref|YP_003948280.1| tRNA-specific 2-thiouridylase mnma [Paenibacillus polymyxa SC2]
 gi|309248472|gb|ADO58039.1| tRNA-specific 2-thiouridylase mnmA [Paenibacillus polymyxa SC2]
          Length = 373

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/386 (35%), Positives = 199/386 (51%), Gaps = 24/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K   + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MAKANHETRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGRCTAEEDA 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVC+ I++ +Y  ++E+ + + V   F   Y AG TP P V CNR +KF + L+  
Sbjct: 58  EDVRRVCEQIDIPYYTVNFEKEYFDKVFSYFLDEYKAGRTPNPDVMCNREIKFGEFLNKA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G     R  + R +D  +DQ+YFL A +Q QL    FP+G
Sbjct: 118 LDLGADYVATGHYARVVEEDG-----RFTLLRGVDSNKDQTYFLNALSQAQLSRTMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQI 252
            + K  VR +A   GL  A K DS  +CF+ +  + + +       A  GD+V +  G++
Sbjct: 173 HLPKPEVRRIAEAAGLYTAKKKDSTGVCFIGERNFKEFLSGYLP--AKGGDMVDIATGEV 230

Query: 253 LGRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLR 306
            GRH+G++ YT+GQR+     G   GEP FV   D   + + V   +         +   
Sbjct: 231 KGRHDGLMYYTLGQRQGLGIGGSGSGEPWFVADKDLEKNILYVVQGDRHHSLYSTSLIAT 290

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
           ++NW+     +      F+C  K R  Q    V +Q   DG V+V F+  +  +  GQA 
Sbjct: 291 DVNWIEGA--DARPSGEFRCTAKFRYRQPDQQVTLQWLPDGTVHVVFDIHQKAITPGQAV 348

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY  +    R LGGG I   ++   
Sbjct: 349 VFYDGE----RCLGGGTIDKVEKLQP 370


>gi|254506120|ref|ZP_05118264.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus 16]
 gi|219550938|gb|EED27919.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus 16]
          Length = 374

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 119/383 (31%), Positives = 192/383 (50%), Gaps = 27/383 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGD--DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           L AD +A GHY+R      +  D   +  M R +D  +DQSYFL+  +  Q+    FP+G
Sbjct: 120 LDADYIAMGHYVRRTFPTQEELDAGAKPEMLRGLDSNKDQSYFLYTLSSDQVARSLFPVG 179

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR +A E  L  A K DS  ICF+ + K+ + + +     A  G+I    G+++
Sbjct: 180 ELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPEGKVI 237

Query: 254 GRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRI 303
           G+H G++ +T+GQR+GL            EP FV   D   + +I    +         +
Sbjct: 238 GKHQGLMYHTLGQRKGLHIGGQKGGGGNEEPWFVGDKDLKRNVLIAVQGKDHPLLKSEGL 297

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASG 362
              +++W+        + D  KC VK R  Q  +P  +   DD  + V F++ ++ V  G
Sbjct: 298 IASQLHWVD----RTPITDVLKCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQIAVTPG 353

Query: 363 QACVFYTSDSNEARVLGGGIISG 385
           Q+ VFY  +      LGGGII  
Sbjct: 354 QSAVFYQGEV----CLGGGIIEK 372


>gi|146322015|ref|YP_001201726.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus suis 98HAH33]
 gi|145692821|gb|ABP93326.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Streptococcus suis 98HAH33]
 gi|292559420|gb|ADE32421.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis GZ1]
          Length = 423

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 132/387 (34%), Positives = 192/387 (49%), Gaps = 25/387 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 50  MSIDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 106

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 107 KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 166

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 167 MNLGADYVATGHYAQV----TRDEDGTVHMLRGADNGKDQTYFLSQLSQEQLQKTMFPLG 222

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  + + + +     A  G ++ ++G+ +
Sbjct: 223 HLQKPQVREIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTVDGRDM 280

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        EP FVV  D + + + V      ESL    +  
Sbjct: 281 GEHTGLMYYTIGQRGGLGIGGQIGGDNEPWFVVGKDLSKNILYVGQGFYHESLMSTSLQA 340

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
            ++++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA 
Sbjct: 341 SQVHFTRDMPEE----FTLECTAKFRYRQPDSQVTVKVKGDKAEVIFAEPQRAITPGQAV 396

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAV 392
           VFY         LGGG+I  + +    
Sbjct: 397 VFYDG----QECLGGGMIDMAYKDGEA 419


>gi|331017263|gb|EGH97319.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 366

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPQV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  GDI    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGDIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++   G    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQSDQPCTLEKTAGGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|304407559|ref|ZP_07389211.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus curdlanolyticus YK9]
 gi|304343510|gb|EFM09352.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus curdlanolyticus YK9]
          Length = 376

 Score =  360 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 139/393 (35%), Positives = 196/393 (49%), Gaps = 25/393 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K   + RVVV MSGGVDSSV A LLK++GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MVKTKAETRVVVGMSGGVDSSVTALLLKQEGYDVIGIFMKNWDD---TDEFGHCTAEEDA 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVCD I + +Y  ++E+++ + V   F   Y  G TP P V CNR +KF + L   
Sbjct: 58  EDVRRVCDQIGIPYYTVNFEQQYFDKVFTYFLDEYKRGRTPNPDVMCNREIKFGEFLQKA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R       + K    + R +D  +DQ+YFL    Q QL    FP+G
Sbjct: 118 IDLGADYLATGHYARVERTANGETK----LLRGVDSNKDQTYFLHQLDQSQLAKAMFPIG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH-LNGQI 252
           D+ K  VR +A E GL  A K DS  +CF+ +  +   +       A  G ++   +G+ 
Sbjct: 174 DLPKPEVRRIAEEAGLATAKKKDSTGVCFIGERNFKQFLSGYLP--AQPGPMIDLRSGET 231

Query: 253 LGRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
            G+H+G++ YT+GQR+     G   GEP FV   D   + + V   +S       R+   
Sbjct: 232 KGQHDGLMYYTLGQRQGLGIGGSGNGEPWFVADKDLERNILYVVQGDSHARLYSERLTAE 291

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
            INW+     E  +     C  K R  Q    V V  + DG   V F++ +  +  GQA 
Sbjct: 292 GINWISPNRPEGPIT----CTAKFRYRQADQGVTVTLSADGMAEVVFDQPQKAITPGQAV 347

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           VFY  D      LGGG I      D    +L +
Sbjct: 348 VFYDGDI----CLGGGTIHTVHMVDEASFALQA 376


>gi|257897740|ref|ZP_05677393.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium Com15]
 gi|257835652|gb|EEV60726.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium Com15]
          Length = 373

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +G++V L+G+I G+
Sbjct: 175 EKSEVRAIAERAGLATAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGNMVTLDGEIKGQ 232

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGDSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|152976810|ref|YP_001376327.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|189036217|sp|A7GT74|MNMA_BACCN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|152025562|gb|ABS23332.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cytotoxicus NVH 391-98]
          Length = 371

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 139/382 (36%), Positives = 202/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL    Q+QL    FPLG
Sbjct: 118 MALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLGQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATATKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P FVV  +   + + V      E L    +    +N
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFVVGKNLKENILYVDQGFHNELLYGDEVIATNVN 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ D   E      FKC  K R  Q+   V VQ  +++ + +  ++    +  GQA VFY
Sbjct: 291 WVSDRAKE----KEFKCTAKFRYRQEDNGVTVQIVDENTIRILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      LGG  I    RS 
Sbjct: 347 DGD----ECLGGATIDEVYRSG 364


>gi|15900060|ref|NP_344664.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae TIGR4]
 gi|111656982|ref|ZP_01407790.1| hypothetical protein SpneT_02001784 [Streptococcus pneumoniae
           TIGR4]
 gi|225860166|ref|YP_002741675.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298229174|ref|ZP_06962855.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298255779|ref|ZP_06979365.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298501928|ref|YP_003723868.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae TCH8431/19A]
 gi|24638327|sp|Q97T38|MNMA_STRPN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|254811468|sp|C1CP03|MNMA_STRZT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|14971585|gb|AAK74304.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae TIGR4]
 gi|225726555|gb|ACO22406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|298237523|gb|ADI68654.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae TCH8431/19A]
 gi|327390539|gb|EGE88879.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae GA04375]
          Length = 373

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    +   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|69244797|ref|ZP_00603021.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium DO]
 gi|257879151|ref|ZP_05658804.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,230,933]
 gi|257882042|ref|ZP_05661695.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,502]
 gi|257883775|ref|ZP_05663428.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,501]
 gi|257889981|ref|ZP_05669634.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,410]
 gi|258615538|ref|ZP_05713308.1| tRNA-specific 2-thiouridylase MnmA [Enterococcus faecium DO]
 gi|260560202|ref|ZP_05832379.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium C68]
 gi|293553765|ref|ZP_06674382.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1039]
 gi|293563497|ref|ZP_06677945.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1162]
 gi|293569057|ref|ZP_06680369.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1071]
 gi|293571269|ref|ZP_06682303.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E980]
 gi|294622809|ref|ZP_06701763.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium U0317]
 gi|314947767|ref|ZP_07851174.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0082]
 gi|68196151|gb|EAN10581.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium DO]
 gi|257813379|gb|EEV42137.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,230,933]
 gi|257817700|gb|EEV45028.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,502]
 gi|257819613|gb|EEV46761.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,501]
 gi|257826341|gb|EEV52967.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,231,410]
 gi|260073769|gb|EEW62094.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium C68]
 gi|291588238|gb|EFF20074.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1071]
 gi|291597767|gb|EFF28905.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium U0317]
 gi|291602058|gb|EFF32293.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1039]
 gi|291604499|gb|EFF33985.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1162]
 gi|291608676|gb|EFF37964.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E980]
 gi|313645747|gb|EFS10327.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0082]
          Length = 373

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +G++V L+G++ G+
Sbjct: 175 EKSEVRAIAERAGLATAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 232

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGDSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|262274515|ref|ZP_06052326.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Grimontia hollisae CIP 101886]
 gi|262221078|gb|EEY72392.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Grimontia hollisae CIP 101886]
          Length = 370

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 122/380 (32%), Positives = 191/380 (50%), Gaps = 27/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSSKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNDE---YCSAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLEIPLHTINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  +  Q+    FP+GD+
Sbjct: 120 LEADYIAMGHYVRRTFPT--KTGEKAQMLRGLDSNKDQSYFLYTLSHDQVARSLFPVGDL 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + +     A  G I  ++G+ +G 
Sbjct: 178 EKPEVRRIAEEQGLVTAKKKDSTGICFIGERKFTDFLSKYLP--AQPGIIETVDGKKIGE 235

Query: 256 HNGIINYTIGQRRGL-------GVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYL 305
           H G++ +T+GQR+GL       G     P +VV  D   + +IV             +  
Sbjct: 236 HQGLMYHTLGQRKGLHIGGQKGGNGNEAPWYVVDKDVERNVLIVAQGHDHPRLFSKGLIA 295

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQA 364
            +++W+        + +  KC VK R  Q  +   ++  D D + V F++ +  V  GQ+
Sbjct: 296 AQLHWVD----RKTMTEPLKCTVKTRYRQQDISCTIEPIDGDQIKVIFDEPQAAVTPGQS 351

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY+ D      LGGGII 
Sbjct: 352 AVFYSGDV----CLGGGIIE 367


>gi|52081229|ref|YP_080020.1| tRNA-specific 2-thiouridylase MnmA [Bacillus licheniformis ATCC
           14580]
 gi|52786609|ref|YP_092438.1| tRNA-specific 2-thiouridylase MnmA [Bacillus licheniformis ATCC
           14580]
 gi|319644804|ref|ZP_07999037.1| tRNA-specific 2-thiouridylase mnmA [Bacillus sp. BT1B_CT2]
 gi|73919897|sp|Q65GR9|MNMA_BACLD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|52004440|gb|AAU24382.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus licheniformis ATCC 14580]
 gi|52349111|gb|AAU41745.1| TrmU [Bacillus licheniformis ATCC 14580]
 gi|317392613|gb|EFV73407.1| tRNA-specific 2-thiouridylase mnmA [Bacillus sp. BT1B_CT2]
          Length = 372

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 140/383 (36%), Positives = 198/383 (51%), Gaps = 21/383 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MAKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  +VC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIKVCNQIGIPYYAVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D    R  M R +D  +DQ+YFL   T++QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRTDGRVKMLRGLDENKDQTYFLNQLTEEQLSKVLFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A+E GL  A K DS  ICF+ +  +   + +     A  GD+  + G+  
Sbjct: 173 QLQKSRVREIAKEAGLATAAKKDSTGICFIGERNFKTFLSQYLP--AQPGDMRTMEGEFK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP FVV  D   + + V            +I    ++
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFVVGKDLEKNILYVDQGFDNPLLFSDKITATNVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFY 368
           ++  G+F     +   C  K R  Q    V V+    D   V F++    V  GQA VFY
Sbjct: 291 FVHKGVFGGE--EELACTAKFRYRQADHEVTVRMTGTDEAEVVFKEPVRAVTPGQAVVFY 348

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             +      LGGG I    +   
Sbjct: 349 KGE----ECLGGGTIDDVFKDGQ 367


>gi|227552294|ref|ZP_03982343.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX1330]
 gi|257895129|ref|ZP_05674782.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium Com12]
 gi|293377883|ref|ZP_06624064.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium PC4.1]
 gi|227178565|gb|EEI59537.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX1330]
 gi|257831694|gb|EEV58115.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium Com12]
 gi|292643430|gb|EFF61559.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium PC4.1]
          Length = 373

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +G++V L+G++ G+
Sbjct: 175 EKSEVRAIAERAGLATAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 232

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGDSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|262394626|ref|YP_003286480.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. Ex25]
 gi|262338220|gb|ACY52015.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. Ex25]
          Length = 374

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 126/380 (33%), Positives = 196/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       D   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LDADYIAMGHYVRRSF---PDNGEKPAMLRGLDGNKDQSYFLYTLSHEQIGRSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQGLVTAKKKDSTGICFIGERKFTDFLGRYLP--AQPGNIETPEGEVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            EP FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEEPWFVGEKDLERNVLIAVQGKDHPMLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYKDDV----CLGGGIIE 366


>gi|257886541|ref|ZP_05666194.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,141,733]
 gi|257822595|gb|EEV49527.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium 1,141,733]
          Length = 373

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSQTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +G++V L+G++ G+
Sbjct: 175 EKSEVRAIAERAGLVTAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 232

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGDSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|260768141|ref|ZP_05877075.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio furnissii CIP 102972]
 gi|260616171|gb|EEX41356.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio furnissii CIP 102972]
          Length = 372

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 116/379 (30%), Positives = 189/379 (49%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+    +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTF---PEHGEKPQMLRGLDGNKDQSYFLYTLGHEQVARSLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGL-----GVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL          +P +V   D   + +I            + +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKDGSEDPWYVAEKDLKRNVLIAVQGADHPLLKSNGLIASQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   V   +++ + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RMPMTEPMRCTVKTRYRQTDIQCTVTPVDENTIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEV----CLGGGIIEE 369


>gi|269960819|ref|ZP_06175190.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio harveyi 1DA3]
 gi|269834483|gb|EEZ88571.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio harveyi 1DA3]
          Length = 380

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 122/383 (31%), Positives = 196/383 (51%), Gaps = 28/383 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGD---DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
           L AD +A GHY+R          + + +  M R +D  +DQSYFL+  + +Q+    FP+
Sbjct: 120 LDADYIAMGHYVRRSFPENALPGEEQEKPQMLRGLDGNKDQSYFLYTLSNEQIARSLFPV 179

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           GD++K  VR +A E  L  A K DS  ICF+ + K+ + + R     A  G+I    G++
Sbjct: 180 GDLEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEV 237

Query: 253 LGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHR 302
           +G+H G++ +T+GQR+GL            +P FV   D   + +I         L+   
Sbjct: 238 IGQHQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLERNVLIAVQGKDHPMLKSEG 297

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVAS 361
           +   +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  
Sbjct: 298 LLASQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIIPIDDENIKVIFDEPQIAVTP 353

Query: 362 GQACVFYTSDSNEARVLGGGIIS 384
           GQ+ VFY  D      LGGGII 
Sbjct: 354 GQSAVFYKDDV----CLGGGIIE 372


>gi|296333160|ref|ZP_06875613.1| tRNA-specific 2-thiouridylase MnmA [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675334|ref|YP_003867006.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296149358|gb|EFG90254.1| tRNA-specific 2-thiouridylase MnmA [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413578|gb|ADM38697.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 371

 Score =  360 bits (923), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/382 (35%), Positives = 200/382 (52%), Gaps = 22/382 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYYEKVFQYFLDEYKAGRTPNPDVLCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D    +  M R +D  +DQ+YFL   T+  L  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGGKVRMLRGIDENKDQTYFLNQLTEDTLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 ELQKSRVREIAKEADLATATKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    I+
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+   + +        C  K R  Q+   V V+   +G   V F++    V  GQA VFY
Sbjct: 291 WVRSDIMK---GQEIACTAKFRYRQEDHKVTVRMTGEGEAEVIFDEQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             +      LGGG I    + +
Sbjct: 348 DGE----ECLGGGTIDDVYKDE 365


>gi|168183036|ref|ZP_02617700.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Bf]
 gi|182673881|gb|EDT85842.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Bf]
          Length = 356

 Score =  360 bits (923), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 2   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 62  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY   +         R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 122 DYVATGHYAIIK-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 177 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GL +A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 237 IVYYTIGQRKGLSIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   DDG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 293 TLKEPMEVEAKIRYSQIPSKAIITPIDDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 348

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 349 IGGGIIEK 356


>gi|307131188|ref|YP_003883204.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dickeya dadantii 3937]
 gi|306528717|gb|ADM98647.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dickeya dadantii 3937]
          Length = 370

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 120/385 (31%), Positives = 198/385 (51%), Gaps = 27/385 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYRVEGLFMKNWEEDDDTE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFEHFLAEYRAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + QQL    FP+G++
Sbjct: 120 LGADYIATGHYVRRK-----DVDGKSRLLRGLDGNKDQSYFLYTLSHQQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A ++ L  A K DS  ICF+ + K+ D + R           V  +G+++G 
Sbjct: 175 EKPQVREIAEQLDLATARKKDSTGICFIGERKFRDFLARYLPAQPGPILSVD-DGKVMGE 233

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ + V             +  ++
Sbjct: 234 HQGLMYHTLGQRKGLGIGGVKEGGDDPWYVVDKDVANNVLYVAQGHEHPRLMSVGLIAQQ 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACV 366
           ++W+      + +    +C VK R  Q  +P  +   D D + V F++    V  GQ+ V
Sbjct: 294 LHWVD----REPLTQPLRCAVKTRYRQADIPCLLTPLDADRIEVRFDEPVAAVTPGQSAV 349

Query: 367 FYTSDSNEARVLGGGIISGSKRSDA 391
           FY  ++     LGGGII    R+  
Sbjct: 350 FYQGEA----CLGGGIIEERLRAAQ 370


>gi|296875545|ref|ZP_06899617.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis ATCC 15912]
 gi|296433469|gb|EFH19244.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parasanguinis ATCC 15912]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVVR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTIDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV  D + + + V      E+L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSQNILYVGQGFYHEALMSTSLQSSQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V+   D   V F + +  +  GQA VFY
Sbjct: 294 HFTREMPEE----FTLECTAKFRYRQPDSKVTVKVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
                    LGGGII  + +   V
Sbjct: 350 DG----QECLGGGIIDQAYKDGKV 369


>gi|56963351|ref|YP_175082.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Bacillus clausii KSM-K16]
 gi|81366419|sp|Q5WHN4|MNMA_BACSK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56909594|dbj|BAD64121.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Bacillus clausii KSM-K16]
          Length = 364

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 134/381 (35%), Positives = 204/381 (53%), Gaps = 23/381 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K  +D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    S   G C A +D  D
Sbjct: 2   KKREDTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDSNDS---GFCSATEDYED 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             RV   + + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L+    
Sbjct: 59  VERVAQQLGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLNHAIS 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +   G+       + +  D  +DQ+YFL A +Q+QL  + FPLG +
Sbjct: 119 LGADYVATGHYAQLQELDGE-----YRLIKGADANKDQTYFLNALSQKQLSKVMFPLGHL 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + ++      A  G +  ++G   G+
Sbjct: 174 QKAEVRKIAAEAELATATKKDSTGICFIGERDFKEFLQTFLP--AQPGRMETMDGIDKGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YT+GQR+GLG+   GEP FV+  D   + +IVG            ++  ++NW+
Sbjct: 232 HDGLMYYTLGQRQGLGIGGAGEPWFVIDKDLERNVLIVGQGYHHPGLYSDGLWATDMNWI 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
                ++     F C  K R  Q+   V V   +DG  ++ F++ +  +  GQA V Y  
Sbjct: 292 A----KEERTSPFTCKAKFRYRQEDQGVTVFPKEDGRAFIQFDQPQRAITPGQAVVLYEG 347

Query: 371 DSNEARVLGGGIISGSKRSDA 391
           D    R +GGG+I    R +A
Sbjct: 348 D----RCIGGGVIDKIHRENA 364


>gi|187780204|ref|ZP_02996677.1| hypothetical protein CLOSPO_03800 [Clostridium sporogenes ATCC
           15579]
 gi|187773829|gb|EDU37631.1| hypothetical protein CLOSPO_03800 [Clostridium sporogenes ATCC
           15579]
          Length = 359

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARR
Sbjct: 5   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARR 64

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G 
Sbjct: 65  VANKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGI 124

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 125 DYVATGHYAIIE-----KHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKS 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H G
Sbjct: 180 KIREIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++      D
Sbjct: 240 IVYYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYI----PFD 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     +
Sbjct: 296 TLKEPMEVEAKIRYSQIPSKAIITTVEDGRVRVNFHEKQRAITKGQSVVFYKDD----LL 351

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 352 IGGGIIEK 359


>gi|149191014|ref|ZP_01869275.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio shilonii AK1]
 gi|148835148|gb|EDL52124.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio shilonii AK1]
          Length = 369

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 119/381 (31%), Positives = 193/381 (50%), Gaps = 28/381 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+        +   +  M R +D  +DQSYFL+  +  Q+    FP+G++
Sbjct: 120 LDADYIAMGHYVSRTF---PENGEKPQMLRGLDSNKDQSYFLYTLSHDQVARSLFPVGEL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL            EP +V   +   + +I            + +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGQKGGGGNEEPWYVAEKNLERNVLIAVQGADHPLLKSNGLRA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQA 364
            +++W+      +A+ +  +C VK R  Q  +P  +   +DD + V F++ +V V  GQ+
Sbjct: 295 SQLHWVS----REAIKEPMQCTVKTRYRQQDIPCTIIPIDDDNIKVIFDEPQVAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY+ +      LGGGII  
Sbjct: 351 AVFYSDNV----CLGGGIIEE 367


>gi|15672819|ref|NP_266993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. lactis Il1403]
 gi|12723762|gb|AAK04935.1|AE006317_4 tRNA-methyltransferase [Lactococcus lactis subsp. lactis Il1403]
 gi|326406382|gb|ADZ63453.1| 5-methylaminomethyl-2-thiouridylate-tRNA methyltransferase
           [Lactococcus lactis subsp. lactis CV56]
          Length = 384

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 138/386 (35%), Positives = 194/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 12  KSPAQTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDENGVCTATEDYKD 68

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I V +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L    +
Sbjct: 69  VAAVADQIGVPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME 128

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R  D  +DQ+YFL   TQ+QL    FPLG +
Sbjct: 129 LGADYVATGHYAQVRT----DENGIVHMLRGADNNKDQTYFLSQLTQEQLKKTMFPLGHL 184

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   +       A  G ++ L+G  +G 
Sbjct: 185 EKPEVRKIAEKAGLATAKKKDSTGICFIGEKNFKKFLGEYLP--AQPGKMMTLDGIEMGN 242

Query: 256 HNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           H G++ YTIGQR GLG+         +P FVV  D  ++ + V      E L    +   
Sbjct: 243 HAGLMYYTIGQRGGLGIGGQHGQLTSDPWFVVGKDLTTNTLYVGQGFHHEHLYSTSLDAS 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++++      E        C  K R  Q+   V +  N D V VDF++    +  GQA V
Sbjct: 303 DLSFTR----EMPETFDLHCTAKFRYRQEDTGVTIHVNGDKVTVDFDEPVRAITPGQAVV 358

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAV 392
           FY  +      LGG +I  + ++  V
Sbjct: 359 FYDGE----ECLGGAMIDVAYKAQKV 380


>gi|153835174|ref|ZP_01987841.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio harveyi HY01]
 gi|148868331|gb|EDL67456.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio harveyi HY01]
          Length = 374

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 122/380 (32%), Positives = 195/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDSNKDQSYFLYTLSNEQIARSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            +P FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLERNVLIAVQGKDHPMLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q+ +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQEDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYKDDV----CLGGGIIE 366


>gi|315282423|ref|ZP_07870840.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria marthii FSL S4-120]
 gi|313613928|gb|EFR87655.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria marthii FSL S4-120]
          Length = 371

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 135/382 (35%), Positives = 198/382 (51%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  ADK DS  ICF+ +  +   +       A  G++  L+G++L
Sbjct: 173 GMEKTEVREIAKKAGLATADKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D  ++ + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKANVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      LGGG I    ++ 
Sbjct: 347 DGDI----CLGGGTIDTVWKNG 364


>gi|261208073|ref|ZP_05922748.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TC 6]
 gi|289565497|ref|ZP_06445945.1| tRNA methyl transferase [Enterococcus faecium D344SRF]
 gi|294615054|ref|ZP_06694941.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1636]
 gi|294617680|ref|ZP_06697306.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1679]
 gi|314938375|ref|ZP_07845666.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133a04]
 gi|314942298|ref|ZP_07849146.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133C]
 gi|314951434|ref|ZP_07854484.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133A]
 gi|314993154|ref|ZP_07858539.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133B]
 gi|314996038|ref|ZP_07861116.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133a01]
 gi|260077657|gb|EEW65373.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TC 6]
 gi|289162695|gb|EFD10547.1| tRNA methyl transferase [Enterococcus faecium D344SRF]
 gi|291592089|gb|EFF23711.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1636]
 gi|291596054|gb|EFF27321.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium E1679]
 gi|313589792|gb|EFR68637.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133a01]
 gi|313592331|gb|EFR71176.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133B]
 gi|313596391|gb|EFR75236.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133A]
 gi|313598915|gb|EFR77760.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133C]
 gi|313642273|gb|EFS06853.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecium TX0133a04]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 119 LGADYVATGHYAQV----TRDENGVVHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   +       A +GD+V L+G++ G+
Sbjct: 175 EKSEVRAIAERAGLATAKKKDSTGICFIGEKNFKQFLSNYLP--AKKGDMVTLDGEVKGQ 232

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   EI
Sbjct: 233 HAGLMYYTIGQRQGLGIGGGGDSQEPWFVVGKDLATNTLYVGQGFHHPALYATSLDASEI 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++       + +   FKC  K R  Q  VPV V+  +D+   V F++    +  GQA VF
Sbjct: 293 HFT----TNEPMPKEFKCTAKFRYRQQDVPVTVRLLDDNRAEVVFDEPVRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + +   V
Sbjct: 349 YDG----MECLGGGLIDHAYQETKV 369


>gi|182625650|ref|ZP_02953419.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens D str. JGS1721]
 gi|177909052|gb|EDT71527.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens D str. JGS1721]
          Length = 359

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 139/368 (37%), Positives = 209/368 (56%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----D 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S  P    +   ++  V V FE  +  +  GQ+ VFY  D     V
Sbjct: 294 KLEGPMEVEAKIRYSARPAKATISPMENVRVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|320547685|ref|ZP_08041970.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equinus ATCC 9812]
 gi|320447760|gb|EFW88518.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equinus ATCC 9812]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 131/385 (34%), Positives = 188/385 (48%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D + + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQVGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG +
Sbjct: 119 LGADYVATGHYAQVSR----DEDGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 EKPEVRKIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQQGGDNAPWFVVGKDLSKNILYVGQGFYHESLMSTSLDASS 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++  D   E       +   K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 VHFTRDMPEE----FTMEVTAKFRYRQPDSKVTVHVKGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  +      LGGGII  + +    
Sbjct: 349 YDGE----ECLGGGIIDMAYKDGVA 369


>gi|253688256|ref|YP_003017446.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259495833|sp|C6DFW7|MNMA_PECCP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|251754834|gb|ACT12910.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 368

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 121/379 (31%), Positives = 190/379 (50%), Gaps = 27/379 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYHVEGLFMKNWEEDDDTE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R MD  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRRH-----DVDGKSRLLRGMDGNKDQSYFLYTLSHEQIAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+ L  A K DS  ICF+ + K+ D + R           V  + + +G+
Sbjct: 175 EKPQVRKIAEELELATAKKKDSTGICFIGERKFTDFLARYLPAQPGPILSVD-DNKPMGQ 233

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +VV  D  ++ + V           H +  ++
Sbjct: 234 HQGLMYHTLGQRKGLGIGGVKDGGEDPWYVVDKDVANNILYVAQGHEHPRLMSHGLIAQQ 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V    DD + V F++    V  GQ+ V
Sbjct: 294 LHWVD----RQPLTAELRCTVKTRYRQADIPCTVTPLGDDRITVRFDEPVAAVTPGQSAV 349

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  D      LGGGII  
Sbjct: 350 FYLDDV----CLGGGIIEE 364


>gi|261252577|ref|ZP_05945150.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio orientalis CIP 102891]
 gi|260935968|gb|EEX91957.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio orientalis CIP 102891]
          Length = 378

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 123/384 (32%), Positives = 196/384 (51%), Gaps = 27/384 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ D
Sbjct: 6   TDNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLAD 62

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    +
Sbjct: 63  AQAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADE 122

Query: 136 -LGADVLATGHYIRSRLYVGDD--GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
            L AD +A GHY+R      ++     +  M R +D  +DQSYFL+  +  Q+    FP+
Sbjct: 123 VLDADYIAMGHYVRRTFPTAEELAAGEKPKMLRGLDGNKDQSYFLYTLSSDQVARSLFPV 182

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G+++K  VR +A E  L  A K DS  ICF+ + K+ D + R     A  G+I    G++
Sbjct: 183 GELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTDFLGRYLP--AQPGNIETPEGKV 240

Query: 253 LGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHR 302
           +G+HNG++ +T+GQR+GL            +P FV   D   + +I         L+   
Sbjct: 241 IGQHNGLMYHTLGQRKGLHIGGQKGGGGNEDPWFVGDKDLKRNVLIAVQGKDHPMLKSQG 300

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVAS 361
           +   +++W+      DA+ +  +C VK R  Q  +P  +   DD  + V F++ +V V  
Sbjct: 301 LIASQLHWVD----RDAIKEPLQCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQVAVTP 356

Query: 362 GQACVFYTSDSNEARVLGGGIISG 385
           GQ+ VFY  +      LGGGII  
Sbjct: 357 GQSAVFYKDEV----CLGGGIIEE 376


>gi|183599450|ref|ZP_02960943.1| hypothetical protein PROSTU_02929 [Providencia stuartii ATCC 25827]
 gi|188021697|gb|EDU59737.1| hypothetical protein PROSTU_02929 [Providencia stuartii ATCC 25827]
          Length = 367

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 129/379 (34%), Positives = 200/379 (52%), Gaps = 28/379 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V+G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVVGLFMKNWEEDDDEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F S Y AG TP P + CN+ +KF   L      
Sbjct: 60  QSVCDKLGIELHTINFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R R     D   +  + R +D  +DQSYFL+  +  Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRRR-----DVNGKSQLLRGLDNNKDQSYFLYTLSYAQIAKSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+GL  A K DS  ICF+ + K+ D + R     A  G IV ++G+ +G+
Sbjct: 175 EKPEVRRIAEEVGLVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIVTVDGETIGQ 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        EP +VV  D  ++R+IV             +  ++
Sbjct: 233 HEGLMYHTLGQRKGLGIGGMKEGSDEPWYVVDKDVENNRLIVAQGHEHPRLMSTGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACV 366
           ++W+      + +    +C VK R  Q  +P  V   +DG V V F+     V  GQ+ V
Sbjct: 293 LDWVD----REPLTQTLRCAVKTRYRQADIPCTVTPLNDGKVEVIFDYPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 349 FYLDEV----CLGGGIIES 363


>gi|148996542|ref|ZP_01824260.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP11-BS70]
 gi|307066804|ref|YP_003875770.1| putative tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Streptococcus pneumoniae AP200]
 gi|147757117|gb|EDK64156.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae SP11-BS70]
 gi|306408341|gb|ADM83768.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Streptococcus pneumoniae AP200]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 190/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARV----ARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV    + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKALSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    +   V F + +  +  GQA VFY
Sbjct: 294 HFTRDMPEE----FTLECTAKFRYRQPDSKVTVHVKGEKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|16803552|ref|NP_465037.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes EGD-e]
 gi|47097209|ref|ZP_00234773.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes str. 1/2a F6854]
 gi|224500677|ref|ZP_03669026.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes Finland
           1988]
 gi|224501548|ref|ZP_03669855.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes FSL
           R2-561]
 gi|254828254|ref|ZP_05232941.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL N3-165]
 gi|254898322|ref|ZP_05258246.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes J0161]
 gi|254912186|ref|ZP_05262198.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes J2818]
 gi|254936514|ref|ZP_05268211.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes F6900]
 gi|284801902|ref|YP_003413767.1| hypothetical protein LM5578_1657 [Listeria monocytogenes 08-5578]
 gi|284995044|ref|YP_003416812.1| hypothetical protein LM5923_1609 [Listeria monocytogenes 08-5923]
 gi|24638317|sp|Q8Y714|MNMA_LISMO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|16410941|emb|CAC99590.1| lmo1512 [Listeria monocytogenes EGD-e]
 gi|47014423|gb|EAL05392.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes str. 1/2a F6854]
 gi|258600642|gb|EEW13967.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL N3-165]
 gi|258609108|gb|EEW21716.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes F6900]
 gi|284057464|gb|ADB68405.1| hypothetical protein LM5578_1657 [Listeria monocytogenes 08-5578]
 gi|284060511|gb|ADB71450.1| hypothetical protein LM5923_1609 [Listeria monocytogenes 08-5923]
 gi|293590159|gb|EFF98493.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes J2818]
          Length = 371

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 135/383 (35%), Positives = 197/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  ADK DS  ICF+ +  +   +       A  G++  L+G++L
Sbjct: 173 AMEKTEVREIAKKAGLATADKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++  
Sbjct: 347 DGDV----CLGGGTIDTVWKNGQ 365


>gi|328945150|gb|EGG39305.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK1087]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 196/384 (51%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +   +RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAAVNFDQPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|328554370|gb|AEB24862.1| tRNA-specific 2-thiouridylase MnmA [Bacillus amyloliquefaciens
           TA208]
          Length = 371

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 141/380 (37%), Positives = 198/380 (52%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D       M R +D  +DQ+YFL    Q+QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGDTVRMLRGLDENKDQTYFLNQLNQEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 DLQKSRVREIAKEAELATAAKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    I+
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFY 368
           W   GL +        C  K R  Q+   V V+    D   + F+K    V  GQA VFY
Sbjct: 291 WTRPGLMD---GGEMTCTAKFRYRQEDHKVTVKMTGADEAEIIFDKQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|119476176|ref|ZP_01616528.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2143]
 gi|119450803|gb|EAW32037.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2143]
          Length = 372

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 122/389 (31%), Positives = 200/389 (51%), Gaps = 27/389 (6%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N++     P D +V+V MSGGVDSSV A LL++ GY V G+ ++ ++    S+    C 
Sbjct: 1   MNNIA-ATKPSDQKVIVGMSGGVDSSVSALLLQQQGYQVEGLFMKNWDEDDGSE---YCT 56

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           A  D+ DA+ VCD + ++ +  ++   + + V   F + Y AG TP P V CNR +KF  
Sbjct: 57  AKDDLADAQAVCDQLKITLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDVLCNREIKFKA 116

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
            L     LGAD +ATGHY+R           R  + +  D  +DQSYFL A +  ++   
Sbjct: 117 FLDYALVLGADYIATGHYVRKHQM-----GDRAQLIKGRDNNKDQSYFLHAVSGTEIAKT 171

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
            FP+GD++K  VR +A +  L   +K DS  ICF+ + ++ D +++     A  G I   
Sbjct: 172 LFPVGDLEKPDVRAIAEKYSLTTHNKKDSTGICFIGERRFKDFLQQYLP--AQPGMIEDT 229

Query: 249 NGQILGRHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---V 300
           +G I+G H+G++ +TIGQR+GLG+         P +VV  D   + +I+           
Sbjct: 230 DGSIMGGHSGLMYHTIGQRQGLGIGGVSGAGDAPWYVVDKDLKRNVLIIAQGSQHHRLFK 289

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
             +++ EI+W+      D +    +C  KIR  Q      +++   G  + F+  +  + 
Sbjct: 290 QGLFVSEIHWIN----NDGITLPHRCKAKIRYRQVDQNCEIRKLSVGYEIVFDLPQRAIT 345

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRS 389
            GQ+ VFY ++      LGGG+I  +  +
Sbjct: 346 PGQSVVFYDNEI----CLGGGVIEAAFNA 370


>gi|322412887|gb|EFY03795.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 373

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 191/381 (50%), Gaps = 25/381 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  + RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSNTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DEDGVVHMLRGADNGKDQTYFLSQLSQKQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVRQIAERAGLATAKKKDSTGICFIGEKNFKTFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHESLMSTSLDASI 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++  +   E       KC  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 VHFTREVPEE----FTLKCTAKFRYRQPDSKVTVHVKGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKR 388
           Y  +      LGGG+I  + R
Sbjct: 349 YDGE----ECLGGGMIDMAYR 365


>gi|27366203|ref|NP_761731.1| tRNA-specific 2-thiouridylase MnmA [Vibrio vulnificus CMCP6]
 gi|30173408|sp|Q8CWJ6|MNMA_VIBVU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|27362403|gb|AAO11258.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio vulnificus CMCP6]
          Length = 374

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 128/381 (33%), Positives = 196/381 (51%), Gaps = 28/381 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +     S+    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDDSE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHKINFASEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LDADYIAMGHYVRRSF---PENGEKPQMLRGLDGNKDQSYFLYTLSHEQVARSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G+I    G++LG+
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGNIESPEGEVLGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            EP FV   D   + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEEPWFVAEKDLKRNVLIAVQGQDHPMLKSEGLIA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q  +P  +   DD  + V F++ E+ V  GQ+
Sbjct: 295 SQLHWV----EREPIRDVVKCTVKTRYRQQDIPCTIIPIDDENIKVIFDEPEIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  D      LGGGII  
Sbjct: 351 AVFYQGDV----CLGGGIIEK 367


>gi|331006794|ref|ZP_08330060.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [gamma
           proteobacterium IMCC1989]
 gi|330419412|gb|EGG93812.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [gamma
           proteobacterium IMCC1989]
          Length = 426

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 126/380 (33%), Positives = 205/380 (53%), Gaps = 26/380 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P++ RV+V MSGGVDSSV A LL++ GY V G+ ++ ++    ++    C A  D+ DA+
Sbjct: 58  PQETRVMVGMSGGVDSSVTALLLQQQGYLVEGLFMKNWDEDDGTE---YCSAKDDLADAQ 114

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RVCDT+ ++ +  ++   + + V   F   Y AG TP P + CNR +KF   L   + LG
Sbjct: 115 RVCDTLGITLHTANFAAEYWDNVFEYFLDEYKAGRTPNPDILCNREIKFKVFLDYAQVLG 174

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD++ATGHY+R R    ++      + +  D  +DQSYFL A   +QL    FP+G+++K
Sbjct: 175 ADMIATGHYVR-RDDYFNNSAGSTRLLKGCDNNKDQSYFLHAVGGEQLAKTLFPVGELEK 233

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR LA +  L   +K DS  ICF+ + ++ D +++     A EG+IV   GQ++G+H 
Sbjct: 234 PAVRLLAEQHNLITHNKKDSTGICFIGERRFKDFLEQYLP--AQEGEIVTDKGQVIGKHA 291

Query: 258 GIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G++ +T+GQR+GLG+         P +VV  D + +++IV   +        R+   +++
Sbjct: 292 GLMYHTMGQRQGLGIGGVKNAPDAPWYVVDKDLDKNQLIVVQGDQHPLLYHQRLTATDMH 351

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR----NDDGVYVDFEKSEVGVASGQAC 365
           W+     +      F+C  KIR  Q      V      ND  + V F++ +  V  GQ+ 
Sbjct: 352 WINPSDQD----AVFRCHAKIRYRQADQACEVTVSRDNNDSSISVIFDEPQRAVTPGQSI 407

Query: 366 VFYTSDSNEARVLGGGIISG 385
           V Y  +      LGG +I+ 
Sbjct: 408 VLYDGE----HCLGGAVIAS 423


>gi|261210711|ref|ZP_05925003.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. RC341]
 gi|260840196|gb|EEX66776.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. RC341]
          Length = 371

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 190/379 (50%), Gaps = 26/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD +++  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLDIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTF---PQNGEKPQMLRGLDNNKDQSYFLYTLSHEQVARSLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+GL +        +P +V   D   + +I            H +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGMKESSEQPWYVADKDLKRNVLIAVQGAEHPLLKSHGLVAAQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   V    DD + V F++ +V V  GQ+ V
Sbjct: 299 LHWVD----RTPITEPVRCSVKTRYRQSDIACTVVPVGDDRIKVMFDEPQVAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  +      LGGGII  
Sbjct: 355 FYQGEI----CLGGGIIEE 369


>gi|73662449|ref|YP_301230.1| putative tRNA methyltransferase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|123642746|sp|Q49Y59|MNMA_STAS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|72494964|dbj|BAE18285.1| putative tRNA methyltransferase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 370

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 132/379 (34%), Positives = 198/379 (52%), Gaps = 22/379 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD RVVV MSGGVDSSV A +LK  GYDVIG+ ++ +++   +   G C A +D  D
Sbjct: 1   MSNKDTRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDN---TDENGYCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARVRRH----EDGHVEMLRGVDNNKDQTYFLNQLSQSQLSRVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A E  L  A K DS  ICF+ +  + + + +     A  G++  L G+ +G 
Sbjct: 174 EKKEVRRIAEEQDLATAKKKDSTGICFIGERNFKEFLSQYLP--AQSGEMRTLKGEKIGT 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H G++ YTIGQR GLG+   G+P FVV  + + + + V             +   +I+++
Sbjct: 232 HAGLMYYTIGQRHGLGIGGDGDPWFVVGKNLDDNILYVEQGFHHDALYSDYLIASDISFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTS 370
            D   E+    GF+C  K R  Q    VFV+  N++ + V F +    +  GQ+ V Y  
Sbjct: 292 NDVDLEN----GFECTAKFRYRQKDTKVFVKNENENAIRVIFNEPVRAITPGQSVVLYDG 347

Query: 371 DSNEARVLGGGIISGSKRS 389
           D      LGG  I    + 
Sbjct: 348 DV----CLGGATIDDVYKE 362


>gi|153838264|ref|ZP_01990931.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AQ3810]
 gi|161511058|ref|NP_797509.2| tRNA-specific 2-thiouridylase MnmA [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260364461|ref|ZP_05777086.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus K5030]
 gi|260877061|ref|ZP_05889416.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AN-5034]
 gi|260896850|ref|ZP_05905346.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus Peru-466]
 gi|260902426|ref|ZP_05910821.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AQ4037]
 gi|32130287|sp|Q87QL9|MNMA_VIBPA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|149748319|gb|EDM59178.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AQ3810]
 gi|308087006|gb|EFO36701.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus Peru-466]
 gi|308093683|gb|EFO43378.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AN-5034]
 gi|308110639|gb|EFO48179.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus AQ4037]
 gi|308114601|gb|EFO52141.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio parahaemolyticus K5030]
          Length = 374

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 123/380 (32%), Positives = 196/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LEADYIAMGHYVRRSF---PENGEKPQMLRGLDSNKDQSYFLYTLSHEQVARSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            +P FV   D + + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLDRNVLIAVQGKDHPMLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQQDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYKDDV----CLGGGIIE 366


>gi|89073381|ref|ZP_01159905.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Photobacterium sp. SKA34]
 gi|89050868|gb|EAR56342.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Photobacterium sp. SKA34]
          Length = 371

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 115/381 (30%), Positives = 190/381 (49%), Gaps = 26/381 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL + GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLLQQGYQVEGLFMKNWEEDDNDE---YCSAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY R      +    +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LEADYIAMGHYTRRSFPTAE--GDKPQMLRGVDNNKDQSYFLYTLSHEQIARSLFPVGEL 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + +       +       G+ +G 
Sbjct: 178 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLPAQPGKIVTAD-EGKEIGE 236

Query: 256 HNGIINYTIGQRRGL-------GVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL       G    +  +VV  D  S+ +IVG  +       + +  
Sbjct: 237 HQGLMYHTLGQRKGLLIGGQKGGNGHEDAWYVVDKDVKSNLLIVGQGKDHPRLKSNGLIA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
           ++++W+        + +   C VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 297 KQLHWVA----RKPIRETMACTVKTRYRQQDIPCTIIPVDDETIKVIFDEPQIAVTPGQS 352

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  +      LGGGII  
Sbjct: 353 AVFYNGEI----CLGGGIIEE 369


>gi|328473137|gb|EGF43985.1| tRNA-specific 2-thiouridylase MnmA [Vibrio parahaemolyticus 10329]
          Length = 374

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 123/380 (32%), Positives = 196/380 (51%), Gaps = 28/380 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  + +Q+    FP+GD+
Sbjct: 120 LEADYIAMGHYVRRSF---PENGEKPQMLRGLDSNKDQSYFLYTLSHEQVARSLFPVGDL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ + + R     A  G+I    G+++G+
Sbjct: 177 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTEFLGRYLP--AQPGNIETPEGEVIGK 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           H G++ +T+GQR+GL            +P FV   D + + +I         L+   +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGRKGGGGNEDPWFVGEKDLDRNVLIAVQGKDHPMLKSEGLLA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+      + + D  KC VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----REPIRDVMKCTVKTRYRQQDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D      LGGGII 
Sbjct: 351 AVFYKDDV----CLGGGIIE 366


>gi|329724654|gb|EGG61160.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis VCU144]
          Length = 372

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 135/380 (35%), Positives = 204/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE++ + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEQYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIRRHDD----GHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + + +     A  G+++ LNG+ +G+
Sbjct: 174 EKSEVRRIAEEQNLATAKKKDSTGICFIGERNFKEFLSQYLP--AQSGEMLTLNGKKMGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  + N + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLNDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTS 370
                +  +  GF+C  K R  Q    V VQR N++ + V F +    +  GQA VFY  
Sbjct: 292 NPSEID--LEKGFECTAKFRYRQKDTKVNVQRENENSIRVTFAEPVRAITPGQAVVFYNQ 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGG  I    +++
Sbjct: 350 EV----CLGGATIDDVYKNE 365


>gi|327463811|gb|EGF10127.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK1057]
          Length = 373

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DKDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KTEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I    ++  V
Sbjct: 350 DGD----ECLGGGLIDRVYKNGQV 369


>gi|308070334|ref|YP_003871939.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus polymyxa E681]
 gi|305859613|gb|ADM71401.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paenibacillus polymyxa E681]
          Length = 373

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 134/386 (34%), Positives = 197/386 (51%), Gaps = 24/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K   + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MAKANHETRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGRCTAEEDA 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVC+ I++ +Y  ++E+ + + V   F   Y AG TP P V CNR +KF + L+  
Sbjct: 58  EDVRRVCEQIDIPYYTVNFEKEYFDKVFSYFLDEYKAGRTPNPDVMCNREIKFGEFLNKA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +     G        + R +D  +DQ+YFL A +Q QL    FP+G
Sbjct: 118 LDLGADYVATGHYAQVVEEDG-----HFTLLRGVDSNKDQTYFLNALSQTQLSRAMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQI 252
            + K  VR +A   GL  A K DS  +CF+ +  + + +       A  GD+V +  G++
Sbjct: 173 HLPKPEVRKIAEAAGLYTAKKKDSTGVCFIGERNFKEFLSGYLP--AKGGDMVDIATGEV 230

Query: 253 LGRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLR 306
            GRH+G++ YT+GQR+     G   GEP FV   D   + + V   +         +   
Sbjct: 231 KGRHDGLMYYTLGQRQGLGIGGSGSGEPWFVADKDLEKNILYVVQGDRHHSLYSTSLIAT 290

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQAC 365
           ++NW+     +      F+C  K R  Q    V +Q   D  V+V F+  +  +  GQA 
Sbjct: 291 DVNWIEGA--DTRPTSEFRCTAKFRYRQPDQQVTLQWLADGTVHVIFDVHQKAITPGQAV 348

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY  +    R LGGG I   ++   
Sbjct: 349 VFYDGE----RCLGGGTIDKVEKLQP 370


>gi|254514300|ref|ZP_05126361.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [gamma
           proteobacterium NOR5-3]
 gi|219676543|gb|EED32908.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [gamma
           proteobacterium NOR5-3]
          Length = 368

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 118/381 (30%), Positives = 190/381 (49%), Gaps = 26/381 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V+V MSGGVDSSV A +L   GY V G+ ++ ++    ++    C A  D  DA+ V D
Sbjct: 6   KVIVGMSGGVDSSVAALMLLEQGYHVEGLFMKNWDEDDGTE---YCTAKADFADAQAVAD 62

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + ++ +  ++   + + V   F + Y +G TP P + CNR +KF   L    +LGAD +
Sbjct: 63  KLQITLHSANFAAEYWDNVFEHFLAEYQSGRTPNPDILCNREIKFRAFLDYALELGADSI 122

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R  +  G     R  + + +D  +DQSYFL A    +L    FPLG++ K  VR
Sbjct: 123 ATGHYARRGVMQG-----RPALLKGLDANKDQSYFLHAVGHAELAKTLFPLGEIAKPEVR 177

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
             A    L   DK DS  ICF+ + ++ D ++R     A  G I  L G  +G H+G++ 
Sbjct: 178 ARAAAADLTTHDKKDSTGICFIGERRFKDFLQRYLP--AQPGVIKTLEGDTIGEHSGLMY 235

Query: 262 YTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLGD 313
           +TIGQR+GLG+         P +V   D  ++ + V             ++ +E+ W+  
Sbjct: 236 HTIGQRQGLGIGGLATHNEAPWYVAGKDLGNNVLWVVQGNDHPALFSDELWAQELFWISG 295

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
               +A     +C  K+R  Q      V ++ D   V F++ +  +  GQ+ VFY  ++ 
Sbjct: 296 ----EAPSLPLRCKAKVRYRQPDQDCTVIQDKDHYRVSFDQPQRAITPGQSVVFYQDNA- 350

Query: 374 EARVLGGGIISGSKRSDAVEE 394
               LGGG+I+ +  + A+  
Sbjct: 351 ---CLGGGVITDTGAALAIAA 368


>gi|227509407|ref|ZP_03939456.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227191119|gb|EEI71186.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 374

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 134/383 (34%), Positives = 196/383 (51%), Gaps = 26/383 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSVVA LLK+ GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSQTRVVVGMSGGVDSSVVAYLLKQQGYDVIGVFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +L
Sbjct: 60  AKVANKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPDPDVICNKEIKFKAFLDYALEL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +    +  D      + R  D  +DQ+YFL   +  QL  + FP+G++ 
Sbjct: 120 GADYIATGHYAQ----LTRDEDGHNHLLRASDGNKDQTYFLSQLSANQLDRVMFPIGNLV 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR++AR+ GL  ADK DS  ICF+ +  +   +       A  G ++ ++G++ G+H
Sbjct: 176 KPEVREIARKAGLATADKKDSVGICFIGEKNFKQFLGHYLP--ATPGKMMTVDGEVKGQH 233

Query: 257 NGIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQRRGLG+       +P FVV  D   + + V      E L    +   +I+
Sbjct: 234 DGLMYYTIGQRRGLGIGGDGVDNQPWFVVGKDLKKNILYVGKGYHNELLYADYLEASDIH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           W+            F C  K R  Q    V V  +DDG  V VDF+     +  GQA VF
Sbjct: 294 WVN----NLDRGQDFHCTAKFRYRQKDTGVTVHLSDDGQKVRVDFDAPVRAITPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSKRSD 390
           Y  +      LG  II  + +  
Sbjct: 350 YDGE----ECLGSAIIDAAYKQA 368


>gi|330446458|ref|ZP_08310110.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490649|dbj|GAA04607.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 371

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 115/381 (30%), Positives = 191/381 (50%), Gaps = 26/381 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL + GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLLQQGYQVEGLFMKNWEEDDNDE---YCSAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY R      +    +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LEADYIAMGHYTRRSFPTAE--GEKPQMLRGVDNNKDQSYFLYTLSHEQIARSLFPVGEL 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ + + +       +       G+ +G 
Sbjct: 178 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTEFLGKYLPAQPGKIVTAD-EGKEIGE 236

Query: 256 HNGIINYTIGQRRGL-------GVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL       G    +  +VV  D  ++ +IVG  +       + +  
Sbjct: 237 HQGLMYHTLGQRKGLHIGGQKGGNGHEDAWYVVDKDVENNLLIVGQGKDHPRLKSNGLIA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
           ++++W+        + +   C VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 297 KQLHWVD----RQPIRETMACTVKTRYRQQDIPCTIIPVDDETIKVIFDEPQIAVTPGQS 352

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  +      LGGGII  
Sbjct: 353 AVFYNGEI----CLGGGIIEE 369


>gi|222055075|ref|YP_002537437.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. FRC-32]
 gi|221564364|gb|ACM20336.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. FRC-32]
          Length = 370

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 158/378 (41%), Positives = 215/378 (56%), Gaps = 18/378 (4%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS----CCA 69
           ++K     RVV+AMSGGVDSSV AALL+  G++VIG+++Q+++  K +  +G     CC+
Sbjct: 1   MNKEKSKKRVVIAMSGGVDSSVSAALLQEQGFEVIGISMQVWDYGKFAAAEGEKFDTCCS 60

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
             D++DARRV + + +  YV ++E+ F + VI  F   Y  G TP PCV CN+ +KF  L
Sbjct: 61  LDDIHDARRVAEQLGIPFYVVNFEDEFEDLVIKDFVDEYLKGRTPNPCVRCNQWIKFELL 120

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   R LGAD +ATGHY R+      D   R  + + +D  +DQSYFLF  TQ+QL    
Sbjct: 121 LKKARGLGADFIATGHYART----LRDDTGRFHLLKGVDQTKDQSYFLFTLTQEQLAMTL 176

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG+M K  VR LA    L +A+K +SQ+ICFV    Y   ++       L G+IV  +
Sbjct: 177 FPLGEMTKTQVRALAARYNLRVAEKGESQEICFVPDNDYVRFIEEERGKELLSGNIVDRS 236

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G+ILGRH G   YTIGQRRGLG+A  EPL V+ L+  +  V+VGP+++L  H +     N
Sbjct: 237 GKILGRHRGTYRYTIGQRRGLGIAHPEPLHVLELNAETKEVVVGPKDALFSHGLVAANTN 296

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFY 368
           W+       A         KIR    PV   V+      V V F + E  V  GQA VFY
Sbjct: 297 WINP-----APDAAIVATCKIRYRHQPVSCTVKPLPCSRVEVRFAEREKSVTPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGS 386
             D+    VLGGG I  +
Sbjct: 352 EGDT----VLGGGWIEKA 365


>gi|227512195|ref|ZP_03942244.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus buchneri ATCC 11577]
 gi|227084589|gb|EEI19901.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus buchneri ATCC 11577]
          Length = 374

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 133/383 (34%), Positives = 196/383 (51%), Gaps = 26/383 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSVVA LLK+ GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSQTRVVVGMSGGVDSSVVAYLLKQQGYDVIGVFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +L
Sbjct: 60  AKVANKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPDPDVICNKEIKFKAFLDYALEL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +    +  D      + R  D  +DQ+YFL   +  QL  + FP+G++ 
Sbjct: 120 GADYIATGHYAQ----LTRDEDGHNHLLRASDGNKDQTYFLSQLSANQLDRVMFPIGNLV 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR++AR+ GL  ADK DS  ICF+ +  +   +       A  G ++ ++G++ G+H
Sbjct: 176 KPEVREIARKAGLATADKKDSVGICFIGEKNFKQFLGHYLP--ATPGKMMTVDGEVKGQH 233

Query: 257 NGIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQRRGLG+       +P FV+  D   + + V      E L    +   +I+
Sbjct: 234 DGLMYYTIGQRRGLGIGGDGVDNQPWFVIGKDLKKNILYVGKGYHNELLYADYLEASDIH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           W+            F C  K R  Q    V V  +DDG  V VDF+     +  GQA VF
Sbjct: 294 WVN----NLDRGQDFHCTAKFRYRQKDTGVTVHLSDDGQKVRVDFDAPVRAITPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSKRSD 390
           Y  +      LG  II  + +  
Sbjct: 350 YDGE----ECLGSAIIDAAYKQA 368


>gi|90579124|ref|ZP_01234934.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio angustum S14]
 gi|90439957|gb|EAS65138.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio angustum S14]
          Length = 371

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 114/381 (29%), Positives = 190/381 (49%), Gaps = 26/381 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL + GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLLQQGYQVEGLFMKNWEEDDNDE---YCSAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIPLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY R      +    +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LEADYIAMGHYTRRSFPTAE--GEKPQMLRGVDNNKDQSYFLYTLSHEQIARSLFPVGEL 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + +       +       G+ +G 
Sbjct: 178 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLPAQPGKIVTAD-EGKEIGE 236

Query: 256 HNGIINYTIGQRRGL-------GVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL       G    +  +VV  D  ++ +IVG  +       + +  
Sbjct: 237 HQGLMYHTLGQRKGLHIGGQKGGNGHEDAWYVVDKDVKNNLLIVGQGKDHPRLKSNGLIA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
           ++++W+        + +   C VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 297 KQLHWVD----RQPIRETMACTVKTRYRQQDIPCTIIPVDDETIKVIFDEPQIAVTPGQS 352

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  +      LGGGII  
Sbjct: 353 AVFYNGEI----CLGGGIIEE 369


>gi|281491325|ref|YP_003353305.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. lactis KF147]
 gi|14195271|sp|Q9CHA1|MNMA_LACLA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|281375066|gb|ADA64584.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. lactis KF147]
          Length = 376

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 138/386 (35%), Positives = 194/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 4   KSPAQTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDENGVCTATEDYKD 60

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I V +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L    +
Sbjct: 61  VAAVADQIGVPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME 120

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R  D  +DQ+YFL   TQ+QL    FPLG +
Sbjct: 121 LGADYVATGHYAQVRT----DENGIVHMLRGADNNKDQTYFLSQLTQEQLKKTMFPLGHL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   +       A  G ++ L+G  +G 
Sbjct: 177 EKPEVRKIAEKAGLATAKKKDSTGICFIGEKNFKKFLGEYLP--AQPGKMMTLDGIEMGN 234

Query: 256 HNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           H G++ YTIGQR GLG+         +P FVV  D  ++ + V      E L    +   
Sbjct: 235 HAGLMYYTIGQRGGLGIGGQHGQLTSDPWFVVGKDLTTNTLYVGQGFHHEHLYSTSLDAS 294

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++++      E        C  K R  Q+   V +  N D V VDF++    +  GQA V
Sbjct: 295 DLSFTR----EMPETFDLHCTAKFRYRQEDTGVTIHVNGDKVTVDFDEPVRAITPGQAVV 350

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAV 392
           FY  +      LGG +I  + ++  V
Sbjct: 351 FYDGE----ECLGGAMIDVAYKAQKV 372


>gi|318606118|emb|CBY27616.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 373

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 197/382 (51%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDGEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVNGKSRLLRGLDGNKDQSYFLYTLSHEQLTQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGQHVGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGGDDPWYVVDKDVANNILLVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+      + V   F+C VK R  Q  +P  V   DD  V V F++    V  GQ+ V
Sbjct: 293 LHWVD----REPVTAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|225869459|ref|YP_002745407.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equi subsp. zooepidemicus]
 gi|259495839|sp|C0MGQ2|MNMA_STRS7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225702735|emb|CAX00880.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equi subsp. zooepidemicus]
          Length = 374

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 130/380 (34%), Positives = 187/380 (49%), Gaps = 19/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 1   MMTDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y +G TP P V CN+ +KF   L   
Sbjct: 58  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 MTLGADYVATGHYAQIKR----DENGVVHMLRGFDKGKDQTYFLSQLSQKQLQKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A + GL  A K DS  ICF+ +  +   +       A +G ++ ++G+ +
Sbjct: 174 HLQKSEVRAIAEQAGLATAKKKDSTGICFIGEKNFKTFLSHYLP--AQKGRMMTVDGRDM 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           G H G++ YTIGQR GLG+        +P FVV  D + + + VG     E       + 
Sbjct: 232 GEHAGLMYYTIGQRGGLGIGGQQGGDNKPWFVVGKDLSQNILYVGQGFYHESLMSTSLDA 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           + +     E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 292 S-VIQFTREVPEEFTLECTAKFRYRQPDSKVTVHVKKDKAKVVFAEPQRAITPGQAVVFY 350

Query: 369 TSDSNEARVLGGGIISGSKR 388
                    LGGGII  + +
Sbjct: 351 DG----HECLGGGIIDMAYK 366


>gi|154686891|ref|YP_001422052.1| tRNA-specific 2-thiouridylase MnmA [Bacillus amyloliquefaciens
           FZB42]
 gi|166234844|sp|A7Z745|MNMA_BACA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|154352742|gb|ABS74821.1| TrmU [Bacillus amyloliquefaciens FZB42]
          Length = 371

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 141/380 (37%), Positives = 198/380 (52%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R     G        M R +D  +DQ+YFL    Q+QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARVDRSAGT-----VRMLRGLDENKDQTYFLNQLNQEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 DLQKSRVREIAKEAELATAAKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    ++
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNVS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFY 368
           W   GL +        C  K R  Q+   V V+   DD   V F+     V  GQA VFY
Sbjct: 291 WTRPGLMD---GGEMTCTAKFRYRQEDHKVTVKMTGDDEAEVIFDGQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|86147101|ref|ZP_01065418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. MED222]
 gi|218710012|ref|YP_002417633.1| tRNA-specific 2-thiouridylase MnmA [Vibrio splendidus LGP32]
 gi|85835166|gb|EAQ53307.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio sp. MED222]
 gi|218323031|emb|CAV19208.1| Probable tRNA(5-methylaminomethyl-2-thiouridylate)-
           methyltransferase [Vibrio splendidus LGP32]
          Length = 378

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 119/387 (30%), Positives = 192/387 (49%), Gaps = 27/387 (6%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQD 72
           D+     + +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D
Sbjct: 3   DISSGNSEKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAED 59

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           + DA+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L  
Sbjct: 60  LADAQAVCDKLGIHLHTINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEF 119

Query: 133 TRQ-LGADVLATGHYIRSRLYVGD--DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
             + L AD +A GHY+R      +  D   +  M R +D  +DQSYFL+  +  Q+    
Sbjct: 120 ADEVLDADYIAMGHYVRRTFPTQEELDAGAKPEMLRGLDGNKDQSYFLYTLSSDQVARSL 179

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FP+G+++K  VR +A E  L  A K DS  ICF+ + K+ + + +     A  G+I    
Sbjct: 180 FPVGELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPE 237

Query: 250 GQILGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE--- 299
           GQ++G+H G++ +T+GQR+GL            EP FV   D   + +I    +      
Sbjct: 238 GQVIGQHQGLMYHTLGQRKGLHIGGTKGGGGNEEPWFVGEKDLKRNVLIAVQGKDHPLLK 297

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVG 358
              +   +++W+        + +   C VK R  Q  +P  +   DD  + V F++ ++ 
Sbjct: 298 SEGLIASQLHWVN----RTPITEVMTCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQIA 353

Query: 359 VASGQACVFYTSDSNEARVLGGGIISG 385
           V  GQ+ VFY  +      LGGGII  
Sbjct: 354 VTPGQSAVFYLDNV----CLGGGIIEK 376


>gi|294650884|ref|ZP_06728231.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter haemolyticus ATCC 19194]
 gi|292823302|gb|EFF82158.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter haemolyticus ATCC 19194]
          Length = 377

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 123/379 (32%), Positives = 204/379 (53%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTALEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRSRLYVGDD-GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R    + +  G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRGASMQNSRGETYAPLLRGVDNNKDQTYFLHAVHGREINKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A E+ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 QVRKIAEELDLATAKKKDSTGICFIGERRFSDFLKQYLP--AQAGKIVLDNGKEVGEHHG 236

Query: 259 IINYTIGQR-----RGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+GQR      G+  A     FV++ D  ++R+++        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGIGGMKGAQEGAWFVLHKDVANNRLVIGQGHEHPLMQSTQLWSESIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND---DGVYVDFEKSEVGVASGQACVF 367
           +     ++    GF+C  K R  Q      + R+D   +G+ V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QEIPTSGFRCTAKTRYRQPDQACTIYRDDHNENGIRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSGEV----CLGGGVIHHT 369


>gi|146319824|ref|YP_001199536.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus suis 05ZYH33]
 gi|253752800|ref|YP_003025941.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis SC84]
 gi|253754625|ref|YP_003027766.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis P1/7]
 gi|253756558|ref|YP_003029698.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis BM407]
 gi|205828994|sp|A4VYE7|MNMA_STRSY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205829102|sp|A4W4N7|MNMA_STRS2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|145690630|gb|ABP91136.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Streptococcus suis 05ZYH33]
 gi|251817089|emb|CAZ52741.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis SC84]
 gi|251819022|emb|CAZ56869.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis BM407]
 gi|251820871|emb|CAR47637.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis P1/7]
          Length = 374

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 132/387 (34%), Positives = 192/387 (49%), Gaps = 25/387 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSIDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 MNLGADYVATGHYAQV----TRDEDGTVHMLRGADNGKDQTYFLSQLSQEQLQKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  + + + +     A  G ++ ++G+ +
Sbjct: 174 HLQKPQVREIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTVDGRDM 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        EP FVV  D + + + V      ESL    +  
Sbjct: 232 GEHTGLMYYTIGQRGGLGIGGQIGGDNEPWFVVGKDLSKNILYVGQGFYHESLMSTSLQA 291

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
            ++++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA 
Sbjct: 292 SQVHFTRDMPEE----FTLECTAKFRYRQPDSQVTVKVKGDKAEVIFAEPQRAITPGQAV 347

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAV 392
           VFY         LGGG+I  + +    
Sbjct: 348 VFYDG----QECLGGGMIDMAYKDGEA 370


>gi|262372981|ref|ZP_06066260.1| tRNA methyl transferase [Acinetobacter junii SH205]
 gi|262313006|gb|EEY94091.1| tRNA methyl transferase [Acinetobacter junii SH205]
          Length = 377

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 121/379 (31%), Positives = 204/379 (53%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTALEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRSRLYVGDD-GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +   +  G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRGVSTQNSRGETYAPLLRGVDNNKDQTYFLHAVHGREINKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A ++ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 EVRRIAEQLDLATAKKKDSTGICFIGERRFTDFLKQYLP--AQAGKIVLDNGKEVGEHHG 236

Query: 259 IINYTIGQR-----RGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+GQR      G+  A     FV++ D  ++R+++        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGIGGMKGAQEGAWFVLHKDIANNRLVIGQGHEHPLMQSKQLWSEAIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN---DDGVYVDFEKSEVGVASGQACVF 367
           +     ++    GF+C  K R  Q      + R+   ++G+ V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QEIPTTGFRCTAKTRYRQPDQACTIYRDEHTENGIRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSGEV----CLGGGVIHHT 369


>gi|195979019|ref|YP_002124263.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|229487422|sp|B4U0P1|MNMA_STREM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|195975724|gb|ACG63250.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase TrmU
           [Streptococcus equi subsp. zooepidemicus MGCS10565]
          Length = 374

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 130/380 (34%), Positives = 188/380 (49%), Gaps = 19/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 1   MMTDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y +G TP P V CN+ +KF   L   
Sbjct: 58  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 MTLGADYVATGHYAQIKR----DENGVVHMLRGLDKGKDQTYFLSQLSQEQLQKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A + GL  A K DS  ICF+ +  +   +       A +G ++ ++G+ +
Sbjct: 174 HLQKSEVRAIAEQAGLATAKKKDSTGICFIGEKNFKTFLSHYLP--AQKGRMMTVDGRDM 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           G H G++ YTIGQR GLG+        +P FVV  D + + + VG     E       + 
Sbjct: 232 GEHAGLMYYTIGQRGGLGIGGQQGGDNKPWFVVGKDLSQNILYVGQGFYHESLMSTSLDA 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           + +     E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 292 S-VIQFTREVPEEFTLECTAKFRYRQPDSKVTVHVKKDKAKVVFAEPQRAITPGQAVVFY 350

Query: 369 TSDSNEARVLGGGIISGSKR 388
                    LGGGII  + +
Sbjct: 351 DG----HECLGGGIIDMAYK 366


>gi|258424047|ref|ZP_05686929.1| tRNA methyl transferase [Staphylococcus aureus A9635]
 gi|257845668|gb|EEV69700.1| tRNA methyl transferase [Staphylococcus aureus A9635]
          Length = 372

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 202/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHNALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F++    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFDEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|226951365|ref|ZP_03821829.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter sp. ATCC 27244]
 gi|226837887|gb|EEH70270.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter sp. ATCC 27244]
          Length = 377

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 123/379 (32%), Positives = 204/379 (53%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTALEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRSRLYVGDD-GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R    + +  G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRGASMQNSRGETYAPLLRGVDNNKDQTYFLHAVHGREISKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A E+ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 QVRKIAEELDLATAKKKDSTGICFIGERRFSDFLKQYLP--AQAGKIVLDNGKEVGEHHG 236

Query: 259 IINYTIGQR-----RGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+GQR      G+  A     FV++ D  ++R+++        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGIGGMKGAQEGAWFVLHKDVANNRLVIGQGHEHPLMQSTQLWSESIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND---DGVYVDFEKSEVGVASGQACVF 367
           +     ++    GF+C  K R  Q      + R+D   +G+ V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QEIPTSGFRCTAKTRYRQPDQACTIYRDDHNENGIRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSGEV----CLGGGVIHHT 369


>gi|251789549|ref|YP_003004270.1| tRNA-specific 2-thiouridylase MnmA [Dickeya zeae Ech1591]
 gi|247538170|gb|ACT06791.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dickeya zeae Ech1591]
          Length = 372

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 120/385 (31%), Positives = 194/385 (50%), Gaps = 27/385 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 5   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDDTE---YCSAATDLADA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 62  QAVCDKLGIELHTVNFAAEYWDNVFEHFLAEYRAGRTPNPDILCNKEIKFKAFLEFAAED 121

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R +D  +DQSYFL+  + QQL    FP+G++
Sbjct: 122 LGADYIATGHYVRRH-----DIDGKSHLLRGLDGNKDQSYFLYTLSHQQLAQSLFPVGEL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R           V  +G+++G 
Sbjct: 177 EKPQVRKIAEQLSLATARKKDSTGICFIGERKFRDFLARYLPAQPGPILSVD-DGKVMGE 235

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D   + + V             +  ++
Sbjct: 236 HQGLMYHTLGQRKGLGIGGVKEGGDDPWYVVDKDVAGNVLYVAQGHEHPRLMSVGLIAQQ 295

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACV 366
           ++W+      + +    +C VK R  Q  +P  +   D D + V F++    V  GQ+ V
Sbjct: 296 LHWVD----REPLAAPLRCTVKTRYRQADIPCLLTPLDADRIEVRFDEPVAAVTPGQSAV 351

Query: 367 FYTSDSNEARVLGGGIISGSKRSDA 391
           FY  +      LGGGII    R+  
Sbjct: 352 FYLGEV----CLGGGIIEERLRAAQ 372


>gi|225853749|ref|YP_002735261.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pneumoniae JJA]
 gi|254811466|sp|C1CBU0|MNMA_STRZJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225723263|gb|ACO19116.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pneumoniae JJA]
          Length = 373

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 190/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  VAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R       D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYARVVR----DEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR LA E GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H
Sbjct: 176 KPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+         P FVV    + + + V      +SL    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKALSKNILYVGQGFYHDSLMSTSLEASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTCDMPEE----FTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGQV 369


>gi|84500833|ref|ZP_00999068.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola batsensis HTCC2597]
 gi|84390900|gb|EAQ03318.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola batsensis HTCC2597]
          Length = 382

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 195/386 (50%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   + LNSL   K P + RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDRTSDLNSLGFAKPPAETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  FR+AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVAEEMGFPHYVLDYENIFRDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ ++     G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLDADCMATGHYIQRKM-----GAAGAELHSAADAARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGD-MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG    K   R LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLSFLRFPLGHLASKAETRALAAKYGLPVADKPDSQDICFVPNGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV  +G++LG H G+I+YTIGQRRGLG+  + +PL+VV LD ++ RV+VGP+E L
Sbjct: 236 AEPGEIVDTSGRVLGHHEGVIHYTIGQRRGLGIGGLSDPLYVVRLDVDARRVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
              ++ +REINWLG+G F D      +  VK+RS++ P    ++  +D    V+    E 
Sbjct: 296 ATRQVPVREINWLGEGAFTDQP--EREISVKVRSTRPPREAILRPVSDTEAVVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  ++   R+LGGG I
Sbjct: 354 GVSPGQACVFY--ETGGTRILGGGWI 377


>gi|313618826|gb|EFR90711.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria innocua FSL S4-378]
          Length = 371

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 135/383 (35%), Positives = 194/383 (50%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A + GL  A+K DS  ICF+ +  +   +       A  GD+  L+G++L
Sbjct: 173 GMEKTEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGDMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D  ++ + V             +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKNNVLFVEQGFHHDSLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +          F C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNS----EKPKTFVCTAKFRYRQTDTKVTVNLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +  A
Sbjct: 347 DGDI----CLGGGTIDTVWKKGA 365


>gi|241667518|ref|ZP_04755096.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254876064|ref|ZP_05248774.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254842085|gb|EET20499.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 359

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 133/374 (35%), Positives = 203/374 (54%), Gaps = 26/374 (6%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           ++ +++V +SGGVDSSV A LLK+ GYDV GV ++ +      +    C A QD+ DA+ 
Sbjct: 2   QNKKIIVGISGGVDSSVSALLLKQQGYDVTGVFMKNWEEDDTDE---FCSAEQDIADAQA 58

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           VCD+I +     ++   + + V   F + Y AG TP P + CN+ +KF   LS    LG 
Sbjct: 59  VCDSIGIPFKKINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLSYVHLLGG 118

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R++  V DDG     + + +D  +DQ+YFL+   Q+QL    FP+GD++K 
Sbjct: 119 DYIATGHYARTK--VADDGS--VQLVKGLDDSKDQTYFLYTLGQEQLKQTMFPIGDIEKS 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++A+E  L   DK DS  ICF+ + K+ D + +     A +G+I   NG  +G H+G
Sbjct: 175 RVREIAKENNLVTFDKKDSTGICFIGERKFKDFLSKFLP--AQKGEIHDENGIKIGMHDG 232

Query: 259 IINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YTIGQR+GLG+         P F    D  ++ +I         L    +   +++W
Sbjct: 233 LMYYTIGQRQGLGIGGVKNRPEIPWFAAQKDLENNVLIAVQGHDHPMLFKDTLQAIDLSW 292

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYT 369
           +       A  D F+C  K+R  Q      V+ N+DG V V F++ +  +  GQ+ VFY 
Sbjct: 293 VAGS----APADSFRCSAKVRYRQKDQSCSVEVNNDGSVNVVFDEPQRAITPGQSVVFYD 348

Query: 370 SDSNEARVLGGGII 383
           +D      LGGGII
Sbjct: 349 NDV----CLGGGII 358


>gi|227111563|ref|ZP_03825219.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
 gi|227327064|ref|ZP_03831088.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 368

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 190/379 (50%), Gaps = 27/379 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYHVEGLFMKNWEEDDDTE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R MD  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRRH-----DVDGKSRLLRGMDGNKDQSYFLYTLSHEQIAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+ L  A K DS  ICF+ + K+ D + R           V  + + +G+
Sbjct: 175 EKPQVRKIAEELELATAKKKDSTGICFIGERKFTDFLARYLPAQPGPILSVD-DNKPMGQ 233

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +VV  D  ++ + V           + +  ++
Sbjct: 234 HQGLMYHTLGQRKGLGIGGVKDGGEDPWYVVDKDVANNILYVAQGHEHPRLMSYGLIAQQ 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V    DD + V F++    V  GQ+ V
Sbjct: 294 LHWVD----RQPLTAELRCTVKTRYRQADIPCTVTPLGDDRITVRFDEPVAAVTPGQSAV 349

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  D      LGGGII  
Sbjct: 350 FYLDDV----CLGGGIIEE 364


>gi|257866681|ref|ZP_05646334.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC30]
 gi|257872802|ref|ZP_05652455.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC10]
 gi|257800639|gb|EEV29667.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC30]
 gi|257806966|gb|EEV35788.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC10]
          Length = 372

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + ++ RVVV MSGGVDSSV A LLK  GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNENTRVVVGMSGGVDSSVTALLLKEQGYDVVGIFMKNWDD---TDENGVCTATEDYKD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 58  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +  +    D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 118 LGADYVATGHYAQVTV----DENGVTHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  +CF+ +  +   +       A +G++V L+G++ G+
Sbjct: 174 EKSEVRAIAERAGLATAQKKDSTGVCFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 231

Query: 256 HNGIINYTI----GQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H+G++ YTI    G   G G A  EP FVV  D  ++ + VG           R+   +I
Sbjct: 232 HDGLMYYTIGQRQGLGIGGGGATQEPWFVVGKDLATNTLYVGQGFHHPALYADRLEASQI 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVF 367
           ++      E      F C  K R  Q  VPV V+  D D   V F++    +  GQA VF
Sbjct: 292 HFT----TEQDRGTEFSCTAKFRYRQQDVPVTVRLLDGDRAEVIFDEPVRAITPGQAVVF 347

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + +   
Sbjct: 348 YDG----MECLGGGLIDAAYKEAK 367


>gi|27468222|ref|NP_764859.1| (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis ATCC 12228]
 gi|57867112|ref|YP_188761.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus epidermidis
           RP62A]
 gi|282875953|ref|ZP_06284820.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis SK135]
 gi|293366421|ref|ZP_06613099.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis M23864:W2(grey)]
 gi|30173406|sp|Q8CSA5|MNMA_STAES RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71153357|sp|Q5HNS9|MNMA_STAEQ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|27315768|gb|AAO04903.1|AE016748_137 (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis ATCC 12228]
 gi|57637770|gb|AAW54558.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis RP62A]
 gi|281294978|gb|EFA87505.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis SK135]
 gi|291319455|gb|EFE59823.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329735247|gb|EGG71539.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis VCU045]
 gi|329737370|gb|EGG73624.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus epidermidis VCU028]
          Length = 372

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 135/380 (35%), Positives = 204/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE++ + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEQYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIRRHDD----GHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ +  + + +       A  G+++ LNG+ +G+
Sbjct: 174 EKSEVRRIAEEQNLATAKKKDSTGICFIGERNFKEFLSHYLP--AQSGEMLTLNGKKMGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  + N + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLNDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTS 370
                +  +  GF+C  K R  Q    V+VQR N++ + V F +    +  GQA VFY  
Sbjct: 292 NPSEID--LEKGFECTAKFRYRQKDTKVYVQRENENSIRVTFAEPVRAITPGQAVVFYNQ 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           +      LGG  I    +++
Sbjct: 350 EV----CLGGATIDDVYKNE 365


>gi|238920209|ref|YP_002933724.1| tRNA-specific 2-thiouridylase MnmA [Edwardsiella ictaluri 93-146]
 gi|259495829|sp|C5B8B9|MNMA_EDWI9 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|238869778|gb|ACR69489.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase,
           putative [Edwardsiella ictaluri 93-146]
          Length = 367

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 122/378 (32%), Positives = 197/378 (52%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +    + +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDSDE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDRLGIELHTVNFAAEYWDNVFELFLQEYRAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R R     D      + R +D  +DQSYFL+  + QQ+    FP+G++
Sbjct: 120 LGADYIATGHYVRRR-----DINGTTQLLRGVDANKDQSYFLYTLSHQQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ + + R     A  G IV ++G+ +G 
Sbjct: 175 EKPEVRRIAAQLDLATAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIVTVDGETIGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        EP +VV  D +++ ++V           + +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGSEEPWYVVDKDLDNNVLVVAQGHDHPRLFSNGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V    D+ + V F++    V  GQ+ V
Sbjct: 293 LHWVD----RLPLGAPLRCTVKTRYRQADIPCLVTPLADERIEVRFDQPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEV----CLGGGIIE 362


>gi|332162070|ref|YP_004298647.1| tRNA-specific 2-thiouridylase MnmA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666300|gb|ADZ42944.1| tRNA-specific 2-thiouridylase MnmA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860067|emb|CBX70393.1| tRNA-specific 2-thiouridylase mnmA [Yersinia enterocolitica W22703]
          Length = 373

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 197/382 (51%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDGEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVNGKSRLLRGLDGNKDQSYFLYTLSHEQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGQHVGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGGDDPWYVVDKDVANNILLVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+      + V   F+C VK R  Q  +P  V   DD  V V F++    V  GQ+ V
Sbjct: 293 LHWVD----REPVTAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|223933686|ref|ZP_03625662.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis 89/1591]
 gi|223897639|gb|EEF64024.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus suis 89/1591]
          Length = 419

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 132/387 (34%), Positives = 192/387 (49%), Gaps = 25/387 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 46  MSIDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 102

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 103 KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 162

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 163 MNLGADYVATGHYAQVSR----DEDGTVHMLRGADNGKDQTYFLSQLSQEQLQKTMFPLG 218

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  + + + +     A  G ++ ++G+ +
Sbjct: 219 HLQKPQVREIAERAGLATAKKKDSTGICFIGEKNFKEFLGQYLP--AQPGRMMTVDGRDM 276

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        EP FVV  D + + + V      ESL    +  
Sbjct: 277 GEHTGLMYYTIGQRGGLGIGGQIGGDNEPWFVVGKDLSKNILYVGQGFYHESLMSTSLQA 336

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
            ++++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA 
Sbjct: 337 SQVHFTRDMPEE----FKLECTAKFRYRQPDSQVTVKVKGDKAEVIFAEPQQAITPGQAV 392

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAV 392
           VFY         LGGG+I  + +    
Sbjct: 393 VFYDG----QECLGGGMIDMAYKDGEA 415


>gi|157150902|ref|YP_001449344.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|189040513|sp|A8AU84|MNMA_STRGC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157075696|gb|ABV10379.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus gordonii str. Challis substr. CH1]
          Length = 373

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 192/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRSIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|257876279|ref|ZP_05655932.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC20]
 gi|257810445|gb|EEV39265.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus EC20]
          Length = 372

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + ++ RVVV MSGGVDSSV A LLK  GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNENTRVVVGMSGGVDSSVTALLLKEQGYDVVGIFMKNWDD---TDENGVCTATEDYKD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 58  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +  +    D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 118 LGADYVATGHYAQVTV----DENGVTHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  +CF+ +  +   +       A +G++V L+G++ G+
Sbjct: 174 EKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 231

Query: 256 HNGIINYTI----GQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H+G++ YTI    G   G G A  EP FVV  D  ++ + VG           R+   +I
Sbjct: 232 HDGLMYYTIGQRQGLGIGGGGATQEPWFVVGKDLATNTLYVGQGFHHPALYADRLEASQI 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVF 367
           ++      E      F C  K R  Q  VPV V+  D D   V F++    +  GQA VF
Sbjct: 292 HFT----TEQDRGTEFSCTAKFRYRQQDVPVTVRLLDGDRAEVIFDEPVRAITPGQAVVF 347

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + +   
Sbjct: 348 YDG----MECLGGGLIDAAYKEAK 367


>gi|94991468|ref|YP_599568.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes
           MGAS10270]
 gi|94544976|gb|ABF35024.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS10270]
          Length = 379

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 195/386 (50%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 6   FMTDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 63  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 MTLGADYVATGHYAQVKR----DENGTVYMLRGADNGKDQTYFLSQLSQEQLQKTLFPLG 178

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 179 HLQKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDM 236

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +  
Sbjct: 237 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  +   E      F+C  K R  Q    V V   +D   V F + +  +  GQA 
Sbjct: 297 SVIHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVREDKAEVVFAEPQRAITPGQAV 352

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY         LGGG+I  + ++  
Sbjct: 353 VFYDG----KECLGGGMIDMAYKNGQ 374


>gi|168207849|ref|ZP_02633854.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens E str. JGS1987]
 gi|169343749|ref|ZP_02864748.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens C str. JGS1495]
 gi|169298309|gb|EDS80399.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens C str. JGS1495]
 gi|170660837|gb|EDT13520.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens E str. JGS1987]
          Length = 359

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 140/368 (38%), Positives = 210/368 (57%), Gaps = 15/368 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARR 78
             +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARR
Sbjct: 3   KKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GA
Sbjct: 63  VAQKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+
Sbjct: 123 DYVATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKD 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H G
Sbjct: 178 KIREIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D
Sbjct: 238 IVYYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----D 293

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V
Sbjct: 294 KLEGHMEVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LV 349

Query: 378 LGGGIISG 385
           +GGGII  
Sbjct: 350 VGGGIIES 357


>gi|188583764|ref|YP_001927209.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium populi BJ001]
 gi|179347262|gb|ACB82674.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium populi BJ001]
          Length = 395

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 205/384 (53%), Positives = 270/384 (70%), Gaps = 8/384 (2%)

Query: 4   SEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR 63
             +  +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R
Sbjct: 6   PSSPAMNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHR 65

Query: 64  KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT 123
           KG+CCAG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+
Sbjct: 66  KGACCAGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRS 125

Query: 124 VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQ 183
           VKF DLL + R LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +
Sbjct: 126 VKFRDLLGMARDLGAEALATGHYVASRAQP----EGGRALYRALDPARDQSYFLYATTPE 181

Query: 184 QLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEG 243
           QL  LRFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G
Sbjct: 182 QLAFLRFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPG 241

Query: 244 DIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +IV L+G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI
Sbjct: 242 EIVDLDGRRLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRI 301

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVAS 361
            L ++NWLG    +   +      V++RS+++P P  +  N  +  + V+    E GV+ 
Sbjct: 302 RLTDLNWLGSRAPDG--LADLPVAVRVRSTREPRPARLSWNAAEACLEVELVVPEDGVSP 359

Query: 362 GQACVFYTSDSNEARVLGGGIISG 385
           GQACV Y  D   A+VLGGG I  
Sbjct: 360 GQACVIYADDGPRAQVLGGGTIRR 383


>gi|213970042|ref|ZP_03398174.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. tomato T1]
 gi|213925146|gb|EEB58709.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas syringae pv. tomato T1]
          Length = 376

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 12  KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 69  DRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 129 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPQV 183

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  GDI    G+++GRH+G++
Sbjct: 184 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGDIKTTEGEVIGRHSGLM 241

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 242 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++   G    F+  +  V  GQ+ VFY  + 
Sbjct: 302 PI----DLSSPRKLTAKVRYRQSDQPCMLEKTAGGYRATFDDPQRAVTPGQSVVFYDGEI 357

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 358 ----CLGGGVIEIAEPW 370


>gi|327467648|gb|EGF13145.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK330]
          Length = 373

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ +   V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWERVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|148980425|ref|ZP_01816047.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrionales bacterium SWAT-3]
 gi|145961228|gb|EDK26541.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrionales bacterium SWAT-3]
          Length = 378

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 119/387 (30%), Positives = 194/387 (50%), Gaps = 27/387 (6%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQD 72
           D+     + +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D
Sbjct: 3   DISSGNSEKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAED 59

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           + DA+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L  
Sbjct: 60  LADAQAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEF 119

Query: 133 TRQ-LGADVLATGHYIRSRLYVGD--DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
             + L AD +A GHY+R      +  +   +  M R +D  +DQSYFL+  +  Q+    
Sbjct: 120 ADEVLDADYIAMGHYVRRTFPTQEELEAGVKPEMLRGLDSNKDQSYFLYTLSSDQVARSL 179

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FP+G+++K  VR +A E  L  A K DS  ICF+ + K+ + + +     A  GDI    
Sbjct: 180 FPVGELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGDIETPE 237

Query: 250 GQILGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE--- 299
           G+++G+HNG++ +T+GQR+GL            +P FV   D   + +I    +      
Sbjct: 238 GKVIGKHNGLMYHTLGQRKGLHIGGTKGGGGNEDPWFVGEKDLKRNVLIAVQGKDHPLLK 297

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVG 358
              +   +++W+        + +   C VK R  Q  +P  +   DD  + V F++ ++ 
Sbjct: 298 SEGLIASQLHWVN----RTPIAEVMTCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQIA 353

Query: 359 VASGQACVFYTSDSNEARVLGGGIISG 385
           V  GQ+ VFY  D      LGGGII  
Sbjct: 354 VTPGQSAVFYQDDV----CLGGGIIEK 376


>gi|87122222|ref|ZP_01078105.1| tRNA methyltransferase [Marinomonas sp. MED121]
 gi|86162542|gb|EAQ63824.1| tRNA methyltransferase [Marinomonas sp. MED121]
          Length = 377

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 124/397 (31%), Positives = 201/397 (50%), Gaps = 30/397 (7%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M+    T  N++    + K+ +V+V MSGGVDSSV A LL + GY V G+ ++ ++    
Sbjct: 1   MITETNTPENTIH---SIKNTKVIVGMSGGVDSSVSALLLIQQGYQVEGLFMKNWDEDDG 57

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           ++    C A  D+ DA+ VCD + +  +  ++   + + V   F   Y AG TP P + C
Sbjct: 58  TE---YCTAKDDLADAQSVCDKLGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILC 114

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N+ +KF   L     LGAD +ATGHY+R           +  + + +D  +DQSYFL+A 
Sbjct: 115 NKEIKFKAFLEYANALGADYIATGHYVRRTHD-----DNQAKLLKGLDNNKDQSYFLYAV 169

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
            + ++    FP+G+++K  VR LA+E  L   +K DS  ICF+ + ++ D +++     A
Sbjct: 170 GKDEIAKSLFPVGELEKPEVRRLAQEHDLITHNKKDSTGICFIGERRFKDFLEQYLP--A 227

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSS---RVIV 292
             GDI  L G  +GRH+G++ +TIGQR+GLG+        EP +VV  D +++       
Sbjct: 228 QPGDIKTLEGDTIGRHSGLMYHTIGQRQGLGIGGLANYSDEPWYVVEKDLDNNVLLVTQS 287

Query: 293 GPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVD 351
              + L    +    ++W+       A      C  K R  Q      +  N DG + V 
Sbjct: 288 SDDKPLYKTHLNASNMDWVA----RVAPELPLTCKAKCRYRQADQDCTISANPDGSIEVS 343

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKR 388
           F +++  +  GQ+ VFY  +      LGGGII+ +  
Sbjct: 344 FVEAQRAITPGQSVVFYLDE----ECLGGGIINRAFN 376


>gi|290581402|ref|YP_003485794.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Streptococcus mutans NN2025]
 gi|254998301|dbj|BAH88902.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Streptococcus mutans NN2025]
          Length = 373

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 130/385 (33%), Positives = 195/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG +
Sbjct: 119 LGADYVATGHYAQVSR----DADGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A + GL  A K DS  ICF+ +  + + +       A +G ++ ++G+ +G 
Sbjct: 175 QKPRVREIAEKAGLVTAKKKDSTGICFIGEKNFKEFLSSYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ++L    +   +
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSQNILYVGQGFYHDALMSTSLTASQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++               C  K R  Q    V V+ N D   V F++ +  +  GQA VF
Sbjct: 293 VHFT----QNMPDKFTLNCTAKFRYRQPDSKVTVKVNGDKAEVIFDEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  D      LGGG+I  + + + +
Sbjct: 349 YDGD----ECLGGGLIDNAYQEEKI 369


>gi|253989217|ref|YP_003040573.1| tRNA -specific 2-thiouridylase MnmA [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253780667|emb|CAQ83829.1| trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Photorhabdus asymbiotica]
          Length = 367

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 125/378 (33%), Positives = 196/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDNEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD +++  +  ++   + + V   F S Y AG TP P + CN+ +KF   L      
Sbjct: 60  QSVCDKLDIELHTVNFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+    QQ+    FP+G++
Sbjct: 120 LGADYIATGHYVRRK-----DINGKSQLLRGLDNNKDQSYFLYTLNHQQIAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++GL  A K DS  ICF+ + K+ D + R     A  G IV ++G+ LG 
Sbjct: 175 EKPEVRRIAEKIGLVTAKKKDSTGICFIGERKFRDFLGRYLP--AKPGPIVTVDGKNLGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         EP +V+  D  ++ +IV             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGNEEPWYVIDKDIQNNILIVAQGHEHPSLMSTGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+     +  + +   C VK R  Q  +P  V   N+D + V F      V  GQ+ V
Sbjct: 293 LHWVD----KQPLTEEIHCVVKTRYRQQDIPCTVTPINEDKIKVRFANPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGG+I 
Sbjct: 349 FYQGEI----CLGGGVIE 362


>gi|299131958|ref|ZP_07025153.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Afipia sp. 1NLS2]
 gi|298592095|gb|EFI52295.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Afipia sp. 1NLS2]
          Length = 393

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 213/380 (56%), Positives = 266/380 (70%), Gaps = 4/380 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P   RVVVAMSGGVDSS  AALLK +GYDVIG+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGPPSGTRVVVAMSGGVDSSTTAALLKAEGYDVIGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SY  GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDRFAESYVLGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR          R M    D +RDQSYFLFATTQ QL DL
Sbjct: 122 LLTTARELGAKALATGHYVASRRQAD----GSRAMVCAADADRDQSYFLFATTQDQLNDL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR   L +A+K DSQDICFV  G+Y DV++R+       GDIV L
Sbjct: 178 RFPLGDMTKTQTRELARRFDLPVAEKHDSQDICFVPTGRYTDVIERMKPNALQPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
            G++LG H GI+N+TIGQRRG+G+A  EPL+VV LD  + RVIVGPR +L    I LR+I
Sbjct: 238 RGRVLGHHQGIVNFTIGQRRGIGIAAAEPLYVVALDAAARRVIVGPRAALRKSVITLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG FE A  +G   ++K+RS++ P    ++ N D   V+    E G++ GQACVFY
Sbjct: 298 NWIGDGSFERAATEGRDLYIKVRSTRPPQAAHLRMNGDHCEVELLAGEEGISPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKR 388
            + + +ARVLGGG I+ +  
Sbjct: 358 DAPAGQARVLGGGFITHAFN 377


>gi|218232235|ref|YP_002369206.1| tRNA-specific 2-thiouridylase MnmA [Bacillus cereus B4264]
 gi|218160192|gb|ACK60184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus B4264]
          Length = 372

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 202/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P++ RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPQETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVSNKEKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|261821429|ref|YP_003259535.1| tRNA-specific 2-thiouridylase MnmA [Pectobacterium wasabiae WPP163]
 gi|261605442|gb|ACX87928.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pectobacterium wasabiae WPP163]
          Length = 368

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 189/379 (49%), Gaps = 27/379 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYHVEGLFMKNWEEDDDTE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       D   +  + R MD  +DQSYFL+    +Q+    FP+G++
Sbjct: 120 LGADYIATGHYVRRH-----DVDGKSRLLRGMDGNKDQSYFLYTLGHEQIAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E+ L  A K DS  ICF+ + K+ D + R           V  + + +G+
Sbjct: 175 EKPQVRKIAEELELATAKKKDSTGICFIGERKFTDFLARYLPAQPGPILSVD-DNKPMGQ 233

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +VV  D  ++ + V           + +  ++
Sbjct: 234 HQGLMYHTLGQRKGLGIGGVKDGGEDPWYVVDKDVANNILYVAQGHEHPRLMSYGLIAQQ 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V    DD + V F++    V  GQ+ V
Sbjct: 294 LHWVD----RQPLTAELRCTVKTRYRQADIPCTVTPLGDDRITVRFDEPVAAVTPGQSAV 349

Query: 367 FYTSDSNEARVLGGGIISG 385
           FY  D      LGGGII  
Sbjct: 350 FYLDDV----CLGGGIIEE 364


>gi|158319927|ref|YP_001512434.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alkaliphilus oremlandii OhILAs]
 gi|205811148|sp|A8MEV9|MNMA_ALKOO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|158140126|gb|ABW18438.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Alkaliphilus oremlandii OhILAs]
          Length = 364

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 130/378 (34%), Positives = 195/378 (51%), Gaps = 25/378 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K PKD +VV+ MSGGVDSSV A LLK+ GYDV+G+ ++ ++        G C + +D 
Sbjct: 1   MSKAPKDTKVVIGMSGGVDSSVAALLLKQQGYDVVGIFMKNWDESDEL---GYCTSAEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D RRVCD I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVRRVCDQIGIPYYSVNFEKEYWDRVFTYFLNEYKAGRTPNPDVMCNKEIKFKAFLDHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            +LGAD LATGHY +     G+       + R +D  +DQ+YFL    Q QL    FP+G
Sbjct: 118 IKLGADYLATGHYAQVDYSDGE-----YRLLRGVDTNKDQTYFLNQLNQYQLSKAMFPVG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K+ +R +A + GL  A K DS  ICF+ +  + + +       A  G I+ L+G++ 
Sbjct: 173 HLQKKDLRQIALDAGLATASKKDSTGICFIGERNFKEFLSNYLP--AKPGKIISLDGEVK 230

Query: 254 GRHNGIINYTIGQRR---GLGVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           G+H+G++ YT+GQR+     G   GEP FVV  D   + + V   E+        +   +
Sbjct: 231 GKHDGLMYYTLGQRKGLGIGGAGTGEPWFVVDKDLEKNILYVTQGETHPSLYSRGLIGAD 290

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACV 366
           + W+     E+      KC  K R  Q    V V   + +   V F++ +  +  GQA V
Sbjct: 291 LQWVS----ENPKPSVIKCTAKFRYRQPDQGVTVYVEEGNTCRVMFDEPQKAITPGQAVV 346

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY         LGG  I 
Sbjct: 347 FYDG----VVCLGGATID 360


>gi|55821970|ref|YP_140412.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus thermophilus LMG
           18311]
 gi|55823887|ref|YP_142328.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus thermophilus
           CNRZ1066]
 gi|81558821|sp|Q5LXJ9|MNMA_STRT1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|81560008|sp|Q5M249|MNMA_STRT2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|55737955|gb|AAV61597.1| tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Streptococcus thermophilus LMG 18311]
 gi|55739872|gb|AAV63513.1| tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Streptococcus thermophilus CNRZ1066]
 gi|312279316|gb|ADQ63973.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Streptococcus thermophilus ND03]
          Length = 373

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 193/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I++ +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIDIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVVR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKTMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G 
Sbjct: 175 QKPEVREIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSKNILYVGQGFHHESLMSTSLDASM 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA VF
Sbjct: 293 IHFTRDMPEE----FEMECTAKFRYRQPDSKVTVKVKGDKSEVIFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGGII  + +   V
Sbjct: 349 YDG----QECLGGGIIDQAYKDGKV 369


>gi|325567216|ref|ZP_08143883.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus ATCC 12755]
 gi|325158649|gb|EGC70795.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus casseliflavus ATCC 12755]
          Length = 372

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 192/381 (50%), Gaps = 19/381 (4%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + ++ RVVV MSGGVDSSV A LLK  GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNENTRVVVGMSGGVDSSVTALLLKEQGYDVVGIFMKNWDD---TDENGVCTATEDYKD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 58  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +  +    D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 118 LGADYVATGHYAQVTV----DENGVTHMLRGVDNNKDQTYFLSQLSQEQLSKTMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  +CF+ +  +   +       A +G++V L+G++ G+
Sbjct: 174 EKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 231

Query: 256 HNGIINYTI----GQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           H+G++ YTI    G   G G A  EP FVV  D  ++ + VG          Y  E + +
Sbjct: 232 HDGLMYYTIGQRQGLGIGGGGATQEPWFVVGKDLATNTLYVGQGFHHPALYAYRLEASQI 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTS 370
                E      F C  K R  Q  VPV V+  D D   V F++    +  GQA VFY  
Sbjct: 292 H-FTTEQDRGTEFSCTAKFRYRQQDVPVTVRLLDGDRAEVIFDEPVRAITPGQAVVFYDG 350

Query: 371 DSNEARVLGGGIISGSKRSDA 391
                  LGGG+I  + +   
Sbjct: 351 ----MECLGGGLIDAAYKEAK 367


>gi|227524073|ref|ZP_03954122.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus hilgardii ATCC 8290]
 gi|227088812|gb|EEI24124.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus hilgardii ATCC 8290]
          Length = 374

 Score =  359 bits (920), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 133/383 (34%), Positives = 196/383 (51%), Gaps = 26/383 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSVVA LLK+ GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSQTRVVVGMSGGVDSSVVAYLLKQQGYDVIGVFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +L
Sbjct: 60  AKVANKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPDPDVICNKEIKFKAFLDYALEL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +    +  D      + R  D  +DQ+YFL   +  QL  + FP+G++ 
Sbjct: 120 GADYIATGHYAQ----LTRDEDGHNHLLRASDGNKDQTYFLSQLSANQLDRVMFPIGNLV 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR++AR+ GL  ADK DS  ICF+ +  +   +       A  G ++ ++G++ G+H
Sbjct: 176 KPEVREIARKAGLATADKKDSVGICFIGEKNFKQFLGHYLP--ATPGKMMTVDGEVKGQH 233

Query: 257 NGIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQRRGLG+       +P FV+  D   + + V      E L    +   +I+
Sbjct: 234 DGLMYYTIGQRRGLGIGGDGVDNQPWFVIGKDLKKNILYVGKGYHNELLYADYLEASDIH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           W+            F C  K R  Q    V V  +DDG  V VDF+     +  GQA VF
Sbjct: 294 WVN----NLDRGQDFHCTAKFRYRQRDTGVTVHLSDDGQKVRVDFDAPVRAITPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSKRSD 390
           Y  +      LG  II  + +  
Sbjct: 350 YDGE----ECLGSAIIDAAYKQA 368


>gi|269139398|ref|YP_003296099.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Edwardsiella tarda EIB202]
 gi|267985059|gb|ACY84888.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Edwardsiella tarda EIB202]
 gi|304559294|gb|ADM41958.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Edwardsiella tarda FL6-60]
          Length = 367

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 123/378 (32%), Positives = 198/378 (52%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +    + +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDSDE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDRLGIELHTVNFAAEYWDNVFELFLQEYRAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R R     D      + R +D  +DQSYFL+  + QQ+    FP+G++
Sbjct: 120 LGADYIATGHYVRRR-----DINGTTQLLRGVDANKDQSYFLYTLSHQQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ + + R     A  G IV ++G+ +G 
Sbjct: 175 EKPEVRRIAAQLDLATAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIVTVDGETIGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        EP +VV  D +++ ++V           + +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGSEEPWYVVDKDLDNNVLVVAQGHDHPRLFSNGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +P  V   +DD + V F++    V  GQ+ V
Sbjct: 293 LHWVD----RRPLGAPLRCTVKTRYRQADIPCLVTPLSDDRIAVRFDQPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEV----CLGGGIIE 362


>gi|291550046|emb|CBL26308.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus torques L2-14]
          Length = 358

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 141/368 (38%), Positives = 208/368 (56%), Gaps = 15/368 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDA 76
              +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   +    +  G CC    V DA
Sbjct: 2   SKGKVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEENEVQEENGGCCGLSAVDDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV  +I + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +
Sbjct: 62  RRVASSIGIPYYVMNFKQEFQKNVIDYFTKEYLNGRTPNPCIACNRYVKWEALLQRSLSI 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R           R  + R   L +DQ+Y L+  TQ+QL     P+G+  
Sbjct: 122 GADYIATGHYARIDKL----SNGRYAIRRSATLAKDQTYALYNLTQEQLEHTLMPVGNYS 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ +R++A ++GL +A+K DSQDICFV  G Y   ++        +G+ V  +G+ILG+H
Sbjct: 178 KDQIREMAEKIGLQVANKPDSQDICFVPDGDYASFIEENADTPIRQGNFVTPDGKILGKH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YT+GQR+GLG+A+G P FV+ +   +  V++G  E    H +   E+N++     
Sbjct: 238 KGIIHYTVGQRKGLGLALGYPAFVLEIRPETDEVVIGTYEESLTHTLRANELNFMS---- 293

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            + + +  + F KIR +       V++  +D +   F++    V  GQA V Y  +    
Sbjct: 294 VEDLTEPMRVFAKIRYNHKGAWCTVEKTGEDEITCTFDEPIRAVTPGQAVVLYDGE---- 349

Query: 376 RVLGGGII 383
            VLGGG I
Sbjct: 350 YVLGGGTI 357


>gi|301381398|ref|ZP_07229816.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058396|ref|ZP_07249937.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. tomato
           K40]
 gi|302130355|ref|ZP_07256345.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 366

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 125/377 (33%), Positives = 195/377 (51%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
            RV+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VC
Sbjct: 2   KRVIVGMSGGVDSSVSAVLLMEQGYQVEGLFMKNWEEDDGTE---YCTAREDLADAQAVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D I +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     LGAD+
Sbjct: 59  DRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYALMLGADL 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  V
Sbjct: 119 IATGHYVRRR-----DIDGRTELLKGLDPNKDQSYFLHAVGGEQIARTLFPVGELEKPQV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A K DS  ICF+ + ++ D +++     A  GDI    G+++GRH+G++
Sbjct: 174 RAIAEKHGLATAKKKDSTGICFIGERRFTDFLRQYLP--AQPGDIKTTEGEVIGRHSGLM 231

Query: 261 NYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLG 312
            +TIGQR+GLG+        +P +V+  D +++ +IV        L    +   EI W+ 
Sbjct: 232 YHTIGQRQGLGIGGLKDASDDPWYVLVKDLDNNELIVGQGNDHPWLFSRALVSSEIYWVN 291

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
                  +    K   K+R  Q   P  +++   G    F+  +  V  GQ+ VFY  + 
Sbjct: 292 PI----DLSSPRKLTAKVRYRQSDQPCMLEKTAGGYRATFDDPQRAVTPGQSVVFYDGEI 347

Query: 373 NEARVLGGGIISGSKRS 389
                LGGG+I  ++  
Sbjct: 348 ----CLGGGVIEIAEPW 360


>gi|94499665|ref|ZP_01306202.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanobacter sp. RED65]
 gi|94428419|gb|EAT13392.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanobacter sp. RED65]
          Length = 369

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 117/383 (30%), Positives = 192/383 (50%), Gaps = 26/383 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           ++  + +V+V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ D
Sbjct: 4   ESNVNTKVIVGMSGGVDSSVSAYLLMEQGYHVEGLFMKNWEEDDGTE---YCTAKEDLAD 60

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD + +  +  ++   + + V   F   Y AG TP P + CNR +KF   L   + 
Sbjct: 61  AQAVCDKLGIKLHSANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDYAKI 120

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R       +      + + +D  +DQSYFL A  + ++    FP+G++
Sbjct: 121 LGADYIATGHYVRR-----YEKDGSTYLLKGLDNNKDQSYFLHAVGEDEIKQTLFPVGEL 175

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + ++ D +K+     A  G I    G+ +GR
Sbjct: 176 EKPEVRRIAEEQGLATAKKKDSTGICFIGERRFKDFLKQYIP--AQPGTIKTPEGEEMGR 233

Query: 256 HNGIINYTIGQRRGL-----GVAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ YT+GQR+G+           P +VV  D   + ++VG  +         +    
Sbjct: 234 HEGLMYYTLGQRQGIGIGGSKHHGEAPWYVVGKDLERNELMVGQGKDHPLLFSKSLDCFN 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I W+      +      +C  K+R  Q      + + D G ++ F++ +  V  GQ+ V 
Sbjct: 294 IYWVNG----EPADLPKRCKAKVRYRQADQDCTIDKTDSGYHIIFDEPQRAVTPGQSLVL 349

Query: 368 YTSDSNEARVLGGGIISGSKRSD 390
           Y  +      LGGGII  ++ ++
Sbjct: 350 YDGEI----CLGGGIIERTQLAE 368


>gi|205829105|sp|Q1JED4|MNMA_STRPD RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 373

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DENGTVYMLRGADNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  +   E      F+C  K R  Q    V V   +D   V F + +  +  GQA VF
Sbjct: 293 IHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVREDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + ++  
Sbjct: 349 YDG----KECLGGGMIDMAYKNGQ 368


>gi|228475220|ref|ZP_04059946.1| tRNA-methyltransferase [Staphylococcus hominis SK119]
 gi|228270831|gb|EEK12233.1| tRNA-methyltransferase [Staphylococcus hominis SK119]
          Length = 370

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 133/379 (35%), Positives = 199/379 (52%), Gaps = 22/379 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDSHVEMLRGIDNNKDQTYFLNQLSQKQLSKVMFPIGDL 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A E  L  A K DS  ICF+ +  +   + +     A  G++  LNG+ +G 
Sbjct: 174 EKKEVRKIAEEQDLATAKKKDSTGICFIGERNFKSFLSQYLP--AQSGEMRTLNGKKMGI 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLEDNILYVEQGFHHDALYSDYLIASDASFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                E+    GF+C  K R  Q    VFVQ+ D+  + V F++    +  GQA VFY  
Sbjct: 292 NPVDLEN----GFECTAKFRYRQKDTKVFVQKEDEQSIRVTFDEPVRAITPGQAVVFYNG 347

Query: 371 DSNEARVLGGGIISGSKRS 389
           +      LGG  I    ++
Sbjct: 348 EV----CLGGATIDDVYKT 362


>gi|47566584|ref|ZP_00237406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus G9241]
 gi|49481478|ref|YP_038446.1| tRNA-specific 2-thiouridylase MnmA [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52141111|ref|YP_085718.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus E33L]
 gi|222097839|ref|YP_002531896.1| tRNA-specific 2-thiouridylase mnma [Bacillus cereus Q1]
 gi|254724677|ref|ZP_05186460.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. A1055]
 gi|300119218|ref|ZP_07056915.1| tRNA-specific 2-thiouridylase MnmA [Bacillus cereus SJ1]
 gi|301055904|ref|YP_003794115.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis CI]
 gi|71658010|sp|Q634E9|MNMA_BACCZ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|73919896|sp|Q6HDD0|MNMA_BACHK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205814924|sp|A0RJ05|MNMA_BACAH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|254811444|sp|B9IYG1|MNMA_BACCQ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|47556614|gb|EAL14946.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus G9241]
 gi|49333034|gb|AAT63680.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51974580|gb|AAU16130.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus E33L]
 gi|221241897|gb|ACM14607.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Q1]
 gi|298723438|gb|EFI64183.1| tRNA-specific 2-thiouridylase MnmA [Bacillus cereus SJ1]
 gi|300378073|gb|ADK06977.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus biovar anthracis str. CI]
          Length = 371

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 291 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 347 DGD----ECLGGATIDEVYRSGK 365


>gi|260772624|ref|ZP_05881540.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio metschnikovii CIP 69.14]
 gi|260611763|gb|EEX36966.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio metschnikovii CIP 69.14]
          Length = 372

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 115/378 (30%), Positives = 187/378 (49%), Gaps = 26/378 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 7   ANSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 64  QAVCDKLGIYLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R           +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 124 LDADYIAMGHYVRRTFPTQ---GEKPQMLRGLDSNKDQSYFLYTLSHEQVARSLFPVGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ + K+ D + R     A  G I    G+++G 
Sbjct: 181 EKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIGE 238

Query: 256 HNGIINYTIGQRR-----GLGVAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLRE 307
           H G++ +T+GQR+     GL     +P +V   D   + +I              +   +
Sbjct: 239 HQGLMYHTLGQRKGLHIGGLKDGSEQPWYVAEKDLQRNVLIAVQGADHPLLKSQGLVASQ 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +   +   D+  + V F++ ++ V  GQ+ V
Sbjct: 299 LHWVS----RQTITEPTRCTVKTRYRQTDIACTIIPLDEQNIKVMFDEPQIAVTPGQSAV 354

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 355 FYQGEV----CLGGGIIE 368


>gi|125624516|ref|YP_001032999.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. cremoris MG1363]
 gi|124493324|emb|CAL98297.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. cremoris MG1363]
 gi|300071310|gb|ADJ60710.1| tRNA-specific 2-thiouridylase MnmA [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 384

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 138/386 (35%), Positives = 193/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 12  KSPAQTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDENGVCTATEDYKD 68

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I V +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L    +
Sbjct: 69  VAAVADQIGVPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME 128

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R  D  +DQ+YFL   TQ+QL    FPLG +
Sbjct: 129 LGADYVATGHYAQVRT----DEDGTVHMLRGADNNKDQTYFLSQLTQEQLKKTMFPLGHL 184

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   +       A  G ++ L+G  +G 
Sbjct: 185 EKPEVRRIAEKAGLATAKKKDSTGICFIGEKNFKKFLGEYLP--AQPGKMMTLDGVEMGN 242

Query: 256 HNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           H G++ YTIGQR GLG+         +P FVV  D  ++ + V      E L    +   
Sbjct: 243 HAGLMYYTIGQRGGLGIGGQHGQLTSDPWFVVGKDLTTNTLYVGQGFHHEHLYSTSLDAS 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++++      E        C  K R  Q+   V +  N D V VDF++    +  GQA V
Sbjct: 303 DLSFTR----EMPETFDLHCTAKFRYRQEDTGVTIHVNGDKVTVDFDEPVRAITPGQAVV 358

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAV 392
           FY  +      LGG +I  + +   V
Sbjct: 359 FYDGE----ECLGGAMIDVAYKEQKV 380


>gi|238789081|ref|ZP_04632870.1| tRNA-specific 2-thiouridylase mnmA [Yersinia frederiksenii ATCC
           33641]
 gi|238722845|gb|EEQ14496.1| tRNA-specific 2-thiouridylase mnmA [Yersinia frederiksenii ATCC
           33641]
          Length = 373

 Score =  358 bits (918), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 196/382 (51%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDDEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVDGKSRLLRGLDGNKDQSYFLYTLSHEQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGQPMGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +V   D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGGDDPWYVADKDVANNILVVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+      + V + F+C VK R  Q  +P  V   DD  V V F++    V  GQ+ V
Sbjct: 293 LHWVD----REPVTEAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|222153939|ref|YP_002563116.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus uberis 0140J]
 gi|254811465|sp|B9DWD3|MNMA_STRU0 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|222114752|emb|CAR43910.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus uberis 0140J]
          Length = 373

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F S Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLSEYKAGRTPNPDVMCNKEIKFKAFLDYAMTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + R     D      M R +D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVRR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLQ 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G H
Sbjct: 176 KSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTVDGRDMGEH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +    I
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSKNILYVGQGFYHESLMSTSLQASVI 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  D   E       +C  K R  Q    V V    +   V F++ +  +  GQA VFY
Sbjct: 294 HFTRDMPSE----FTLECTAKFRYRQPDSKVTVYVKGEHAEVVFDEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
            ++      LGGGII  + +    
Sbjct: 350 DAE----ECLGGGIIDMAFKDGVA 369


>gi|30264466|ref|NP_846843.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. Ames]
 gi|47529924|ref|YP_021273.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187287|ref|YP_030539.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. Sterne]
 gi|254684152|ref|ZP_05148012.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736499|ref|ZP_05194205.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. Western
           North America USA6153]
 gi|254741537|ref|ZP_05199224.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. Kruger
           B]
 gi|254751364|ref|ZP_05203401.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str. Vollum]
 gi|254757696|ref|ZP_05209723.1| tRNA-specific 2-thiouridylase MnmA [Bacillus anthracis str.
           Australia 94]
 gi|73919893|sp|Q81JE5|MNMA_BACAN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|30259124|gb|AAP28329.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. Ames]
 gi|47505072|gb|AAT33748.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181214|gb|AAT56590.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. Sterne]
          Length = 371

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 291 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 347 DGD----ECLGGATIDEVYRSGK 365


>gi|323485784|ref|ZP_08091119.1| hypothetical protein HMPREF9474_02870 [Clostridium symbiosum
           WAL-14163]
 gi|323693136|ref|ZP_08107354.1| hypothetical protein HMPREF9475_02217 [Clostridium symbiosum
           WAL-14673]
 gi|323400772|gb|EGA93135.1| hypothetical protein HMPREF9474_02870 [Clostridium symbiosum
           WAL-14163]
 gi|323502619|gb|EGB18463.1| hypothetical protein HMPREF9475_02217 [Clostridium symbiosum
           WAL-14673]
          Length = 359

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 205/368 (55%), Gaps = 14/368 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDA 76
           +  +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   +    +  G CC    V DA
Sbjct: 2   EKKKVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEEPEIQEENGGCCGLSAVDDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + + + +YV +++  F+  V+  F   Y  G+TP PC+ CNR VK+  LL  +  +
Sbjct: 62  RRVAENLGIPYYVMNFKREFKENVMDYFVQEYIEGKTPNPCIACNRFVKWESLLKRSMDI 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R           R  + +     +DQ+Y L+  TQ QL     P+G+  
Sbjct: 122 GADYIATGHYARIEQL----ENGRYTLRKSATAAKDQTYALYNLTQHQLSHTLMPVGEYT 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ +R +A ++GL++A K DSQ+ICF+    Y   ++        EG+ V  +G++LGRH
Sbjct: 178 KDEIRGMADKIGLNVAHKPDSQEICFIPDHDYAKFIEENTDCRLPEGNFVDKDGRVLGRH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YT+GQR+GL +A+G P+FV  +  +++ V++G  E +   R+   ++NW+     
Sbjct: 238 KGITHYTVGQRKGLNLALGRPVFVTEIRPDTNEVVIGDNEDVFSRRLTCGKLNWMA---V 294

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
           E    DG K   KIR S    P  ++   +D V   F+  +     GQA VFY  +    
Sbjct: 295 EGLPDDGMKVTAKIRYSHKGAPCMIRTIGEDLVECVFDDPQRAATPGQAVVFYDGE---- 350

Query: 376 RVLGGGII 383
            V+GGG I
Sbjct: 351 YVVGGGTI 358


>gi|327439665|dbj|BAK16030.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Solibacillus silvestris StLB046]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 134/376 (35%), Positives = 198/376 (52%), Gaps = 18/376 (4%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           ++P  +RVV+ MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 5   RDPSQIRVVIGMSGGVDSSVAAYLLKQQGYDVIGIFMKNWDD---TDEFGVCTATEDYDD 61

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L     
Sbjct: 62  VIAVCNQIGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLEHALA 121

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD LATGHY R         +    M R +D  +DQ+YFL   T +QL  + FP+G +
Sbjct: 122 LGADYLATGHYARV-----AHDENGVKMLRGIDNNKDQTYFLNQLTSEQLEKVMFPIGHL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR +A E GL  A K DS  ICF+ +  + + + +     A  G++   +G++ G 
Sbjct: 177 PKPEVRKIAEEAGLATAKKKDSTGICFIGERNFKEFLSQYLP--AQPGNMETFDGEVKGT 234

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
           H+G++ YT+GQR GLG+   GEP FVV  D   + + VG  +      +Y   +  +   
Sbjct: 235 HDGLMYYTLGQRHGLGIGGDGEPWFVVGKDLTRNVLYVG--QGFHHDALYSDALTAVKMS 292

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSN 373
              +A    F C  K R  Q+  PV V   +DG  Y++F +    +  GQA V Y  +  
Sbjct: 293 FTGEAKTGTFNCTAKFRYRQEDSPVTVTMREDGTAYIEFAEPVRAITPGQAVVLYDGE-- 350

Query: 374 EARVLGGGIISGSKRS 389
               LGGG I G  ++
Sbjct: 351 --ECLGGGTIDGVFKN 364


>gi|260779096|ref|ZP_05887988.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605260|gb|EEX31555.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio coralliilyticus ATCC BAA-450]
          Length = 373

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 120/382 (31%), Positives = 187/382 (48%), Gaps = 28/382 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ D
Sbjct: 6   TDNSKKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLAD 62

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    +
Sbjct: 63  AQAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADE 122

Query: 136 -LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            L AD +A GHY+R       D   +  M R +D  +DQSYFL+  +  Q+    FP+G+
Sbjct: 123 VLDADYIAMGHYVRRTF---PDNGEKPQMLRGLDGNKDQSYFLYTLSSDQIARSLFPVGE 179

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A E  L  A K DS  ICF+ + K+ D + R     A  G I    G+++G
Sbjct: 180 LEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTDFLSRYLP--AQPGKIETPEGKVIG 237

Query: 255 RHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIY 304
            H G++ +T+GQR+GL            +P +V   D   + +I              + 
Sbjct: 238 EHQGLMYHTLGQRKGLHIGGQKGGGGNEDPWYVADKDLKRNVLIAVQGAEHPLLKSQGLI 297

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQ 363
             +++W+      + +    +C VK R  Q  +P  +   DD  + V F+  +V V  GQ
Sbjct: 298 ASQLHWVD----REIIKAPLQCSVKTRYRQTDIPCTIIPIDDENIKVIFDDPQVAVTPGQ 353

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           + VFY  D      LGGGII  
Sbjct: 354 SAVFYKDDV----CLGGGIIEK 371


>gi|196039389|ref|ZP_03106695.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus NVH0597-99]
 gi|206976034|ref|ZP_03236944.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus H3081.97]
 gi|217961886|ref|YP_002340456.1| tRNA-specific 2-thiouridylase MnmA [Bacillus cereus AH187]
 gi|218905591|ref|YP_002453425.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH820]
 gi|225866378|ref|YP_002751756.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 03BB102]
 gi|196030016|gb|EDX68617.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus NVH0597-99]
 gi|206745786|gb|EDZ57183.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus H3081.97]
 gi|217066211|gb|ACJ80461.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH187]
 gi|218535576|gb|ACK87974.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH820]
 gi|225789110|gb|ACO29327.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 03BB102]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|50915203|ref|YP_061175.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes
           MGAS10394]
 gi|94995352|ref|YP_603450.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes
           MGAS10750]
 gi|50904277|gb|AAT87992.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS10394]
 gi|94548860|gb|ABF38906.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS10750]
          Length = 379

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 194/386 (50%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 6   FMTDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 63  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 MTLGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLG 178

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 179 HLQKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDM 236

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +  
Sbjct: 237 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA 
Sbjct: 297 SVIHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVRGDKAEVVFAEPQRAITPGQAV 352

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY         LGGG+I  + ++  
Sbjct: 353 VFYDG----KECLGGGMIDMAYKNGQ 374


>gi|331701087|ref|YP_004398046.1| tRNA-specific 2-thiouridylase mnmA [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128430|gb|AEB72983.1| tRNA-specific 2-thiouridylase mnmA [Lactobacillus buchneri NRRL
           B-30929]
          Length = 374

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 135/384 (35%), Positives = 195/384 (50%), Gaps = 26/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSVVA LLK+ GYDVIGV ++ ++    +   G C A +D  D 
Sbjct: 3   DNSQTRVVVGMSGGVDSSVVAYLLKQQGYDVIGVFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +L
Sbjct: 60  AKVANKIGIPYYSVNFEKEYWDRVFTYFLDEYKKGRTPDPDVICNKEIKFKAFLDYALEL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +    +  D      + R  D  +DQ+YFL   +  QL  + FP+G++ 
Sbjct: 120 GADYIATGHYAQ----LTRDADGHNHLLRASDGNKDQTYFLSQLSADQLDRVMFPIGNLV 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +ARE GL  ADK DS  ICF+ +  + + +       A  G ++ ++G++ G+H
Sbjct: 176 KPDVRKIAREAGLATADKKDSVGICFIGEKNFKNFLGHYLP--ATPGKMMTVDGEVKGQH 233

Query: 257 NGIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           +G++ YTIGQRRGLG+       +P FVV  D   + + VG            +   +I+
Sbjct: 234 DGLMYYTIGQRRGLGIGGDGVDNQPWFVVGKDLKQNILYVGKGYHNPLLYADYLEASDIH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           W+            F C  K R  Q    V V  +DDG  V VDF+     +  GQA VF
Sbjct: 294 WVN----NLDRGKDFHCTAKFRYRQKDTGVTVHISDDGQSVRVDFDAPVRAITPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y  D      LG  II  + +   
Sbjct: 350 YDGD----ECLGSAIIDAAYKQAK 369


>gi|323497848|ref|ZP_08102859.1| tRNA-specific 2-thiouridylase MnmA [Vibrio sinaloensis DSM 21326]
 gi|323317076|gb|EGA70076.1| tRNA-specific 2-thiouridylase MnmA [Vibrio sinaloensis DSM 21326]
          Length = 369

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 120/381 (31%), Positives = 191/381 (50%), Gaps = 28/381 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R       +   +  M R +D  +DQSYFL+  +  Q+    FP+G++
Sbjct: 120 LDADYIAMGHYVRRTF---PENGEKAQMLRGLDSNKDQSYFLYTLSSDQVERSLFPVGEL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E  L  A K DS  ICF+ + K+ + + +     A  GDI    G+++G+
Sbjct: 177 EKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGDIETPEGKVIGQ 234

Query: 256 HNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYL 305
           H G++ +T+GQR+GL            EP FV   D   + +I    +         +  
Sbjct: 235 HQGLMYHTLGQRKGLHIGGQKGGGGNEEPWFVGDKDLKRNVLIAVQGKDHPLLKSEGLIA 294

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQA 364
            +++W+        + D  KC VK R  Q  +P  +   DD  + V F++ ++ V  GQ+
Sbjct: 295 SQLHWVD----RTPIKDVLKCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQIAVTPGQS 350

Query: 365 CVFYTSDSNEARVLGGGIISG 385
            VFY  +      LGGGII  
Sbjct: 351 AVFYQDEV----CLGGGIIEK 367


>gi|125973240|ref|YP_001037150.1| tRNA-specific 2-thiouridylase MnmA [Clostridium thermocellum ATCC
           27405]
 gi|256003718|ref|ZP_05428706.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 2360]
 gi|281417440|ref|ZP_06248460.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum JW20]
 gi|205813738|sp|A3DDC8|MNMA_CLOTH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|125713465|gb|ABN51957.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum ATCC 27405]
 gi|255992279|gb|EEU02373.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 2360]
 gi|281408842|gb|EFB39100.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum JW20]
 gi|316940529|gb|ADU74563.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 1313]
          Length = 359

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/368 (37%), Positives = 209/368 (56%), Gaps = 14/368 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDA 76
              +V+V MSGGVDSSV AA+L   GY+VIG T+Q++       +  +G CC+   V DA
Sbjct: 2   SKKKVMVGMSGGVDSSVAAAILLEQGYEVIGATMQIWPDTDEETKLVEGGCCSLSAVDDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           R V + + + +YV ++++ F  +VI  F   Y  G TP PC+ CNR VKF  +L+    +
Sbjct: 62  RSVANKLGIPYYVLNFKDIFEKSVINYFKDEYLKGRTPNPCIACNRFVKFESMLNKALSM 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           G D +ATGHY        DD K+R ++ + +  ++DQ+Y L+  TQ+QL  +  P+G+  
Sbjct: 122 GIDYIATGHYAIITY---DDNKKRYLLKKSVTQQKDQTYALYNVTQEQLKHILMPIGNFT 178

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           KE VR  A+E+GL +A K DSQ+ICFV    Y   ++         G  V   G ILG+H
Sbjct: 179 KEQVRAKAKELGLYVASKPDSQEICFVNDNDYGKFIEENTDKEIKPGYFVDTKGNILGKH 238

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YT+GQR+GLG+A+G+P++VV +D  ++ V++G    +    +   ++N++     
Sbjct: 239 RGIIHYTVGQRKGLGIALGKPMYVVRIDAENNTVVLGDENEVYSKELTAYDLNFISI--- 295

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            D + +  +   KIR S       +   +DG V V F+  +  V  GQ+ VFY  D    
Sbjct: 296 -DKLEEPMRVKAKIRYSAKEADAVIYPLEDGKVRVVFDTPQRAVTPGQSVVFYDGDI--- 351

Query: 376 RVLGGGII 383
            V+GGGII
Sbjct: 352 -VVGGGII 358


>gi|314936263|ref|ZP_07843610.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus hominis subsp. hominis C80]
 gi|313654882|gb|EFS18627.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus hominis subsp. hominis C80]
          Length = 370

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 133/379 (35%), Positives = 199/379 (52%), Gaps = 22/379 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQEQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A E  L  A K DS  ICF+ +  +   + +     A  G++  LNG+ +G 
Sbjct: 174 EKKDVRKIAEEQDLATAKKKDSTGICFIGERNFKSFLSQYLP--AQSGEMRTLNGKKMGI 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLEDNILYVEQGFHHDALYSDYLIASDASFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                E+    GF+C  K R  Q    VFVQ+ D+  + V F++    +  GQA VFY  
Sbjct: 292 NPVDLEN----GFECTAKFRYRQKDTKVFVQKEDEQSIRVTFDEPVRAITPGQAVVFYNG 347

Query: 371 DSNEARVLGGGIISGSKRS 389
           +      LGG  I    ++
Sbjct: 348 EV----CLGGATIDDVYKT 362


>gi|228993134|ref|ZP_04153056.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus pseudomycoides DSM 12442]
 gi|228999183|ref|ZP_04158765.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus mycoides Rock3-17]
 gi|229006731|ref|ZP_04164365.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus mycoides Rock1-4]
 gi|228754592|gb|EEM04003.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus mycoides Rock1-4]
 gi|228760800|gb|EEM09764.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus mycoides Rock3-17]
 gi|228766593|gb|EEM15234.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus pseudomycoides DSM 12442]
          Length = 376

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 139/383 (36%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYIDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATATKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    I 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNIG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +D+ V +  ++    +  GQA VFY
Sbjct: 296 WVSNRAKE----KEFKCTAKFRYRQEDNKVTVQIVDDNTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|229032046|ref|ZP_04188029.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH1271]
 gi|228729291|gb|EEL80285.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH1271]
          Length = 376

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 138/383 (36%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P++ RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPQETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMATEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    I 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNIG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|28211134|ref|NP_782078.1| tRNA-specific 2-thiouridylase MnmA [Clostridium tetani E88]
 gi|75542384|sp|Q894S7|MNMA2_CLOTE RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|28203574|gb|AAO36015.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Clostridium tetani E88]
          Length = 358

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 134/367 (36%), Positives = 209/367 (56%), Gaps = 15/367 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
             +V+V MSGGVDSSV A LLK  GY+VIG T+Q++ + ++  +R+G CC+   V DARR
Sbjct: 5   KKKVLVGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQDDKEFIEREGGCCSLSAVADARR 64

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + I +  YV ++++ F+  VI  F   Y  G TP PCV CN+ +KFS  L     LG 
Sbjct: 65  VANKIGIPFYVMNFKDAFKKNVIDYFVDEYMEGRTPNPCVACNKFIKFSSFLDKAMTLGI 124

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY             R I+ +  D ++DQ+Y L+  TQ QL     P G  KK 
Sbjct: 125 DYVATGHYAIIEKQ-----NNRYIVRKSEDDKKDQTYALYNLTQFQLERTLMPCGRYKKS 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+++GL + +K DSQ+ICF+    +   +K        +G+ V  +G +LG H G
Sbjct: 180 EIREIAKKIGLRVHNKKDSQEICFIPDNDHGKYIKNRFPSKVRQGNFVDKSGNVLGTHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GL +A+G+P++VV ++   + V++G  + L    +  +++N++      D
Sbjct: 240 IVYYTIGQRKGLDIALGKPMYVVDINPFRNEVVLGNLDDLLNTELIAKDVNYI----PFD 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   KIR SQ P    +    +D V V+F + +  +  GQ+ VFY  D     +
Sbjct: 296 NLKEPMEVEAKIRYSQIPSKAVITPMENDKVKVNFTEKQRAITKGQSVVFYKGD----LL 351

Query: 378 LGGGIIS 384
           +GGGII 
Sbjct: 352 IGGGIIE 358


>gi|196034345|ref|ZP_03101754.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus W]
 gi|195992887|gb|EDX56846.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus W]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A++ GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKKAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|329116668|ref|ZP_08245385.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parauberis NCFD 2020]
 gi|326907073|gb|EGE53987.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus parauberis NCFD 2020]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 131/381 (34%), Positives = 190/381 (49%), Gaps = 19/381 (4%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  + RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 1   MDNSNTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDELGVCTATEDYKD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 58  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYKAGRTPNPDVMCNKEIKFKAFLDYAMT 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 118 LGADYVATGHYAQIER----DQYGTVHMLRGVDNGKDQTYFLSQLSQKQLQKTLFPLGHL 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 174 QKPEVRAIAEKAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMLTVDGRDMGE 231

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           H G++ YTIGQR GLG+        +P FVV  D + + + VG     E       + + 
Sbjct: 232 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHESLMSTSLDAST 291

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
           +     E       +C  K R  Q    V V    D   V F++ +  +  GQA VFY  
Sbjct: 292 IH-FTKEMPEEFTMECTAKFRYRQPDSKVTVHVKGDKAEVIFDEEQRAITPGQAVVFYDG 350

Query: 371 DSNEARVLGGGIISGSKRSDA 391
                  LGGGII  + ++  
Sbjct: 351 ----QECLGGGIIDMAFKNGQ 367


>gi|323494972|ref|ZP_08100063.1| tRNA-specific 2-thiouridylase MnmA [Vibrio brasiliensis LMG 20546]
 gi|323310767|gb|EGA63940.1| tRNA-specific 2-thiouridylase MnmA [Vibrio brasiliensis LMG 20546]
          Length = 378

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 123/384 (32%), Positives = 195/384 (50%), Gaps = 27/384 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ D
Sbjct: 6   TDNSQKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLAD 62

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L    +
Sbjct: 63  AQAVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLEFADE 122

Query: 136 -LGADVLATGHYIRSRLYVGDD--GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
            L AD +A GHY+R      ++     +  M R +D  +DQSYFL+  +  Q+    FP+
Sbjct: 123 VLDADYIAMGHYVRRTFPTAEELAAGEKPKMLRGLDGNKDQSYFLYTLSSDQVARSLFPV 182

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G+++K  VR +A E  L  A K DS  ICF+ + K+ D + R     A  GDI    G++
Sbjct: 183 GELEKPEVRRIAEEQDLITAKKKDSTGICFIGERKFTDFLGRYLP--AQPGDIETPEGKV 240

Query: 253 LGRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIV---GPRESLEVHR 302
           +G+HNG++ +T+GQR+GL            +P FV   D   + +I         L+   
Sbjct: 241 IGKHNGLMYHTLGQRKGLHIGGQKGGGGNEDPWFVGDKDLKRNVLIAVQGKDHPMLKSQG 300

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVAS 361
           +   +++W+       A+ +  +C VK R  Q  +P  +   DD  + V F++ +V V  
Sbjct: 301 LIASQLHWVD----RAAIKEPLQCTVKTRYRQTDIPCTIIPIDDENIKVIFDEPQVAVTP 356

Query: 362 GQACVFYTSDSNEARVLGGGIISG 385
           GQ+ VFY  +      LGGGII  
Sbjct: 357 GQSAVFYKDEV----CLGGGIIEE 376


>gi|254462137|ref|ZP_05075553.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678726|gb|EDZ43213.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 381

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 197/386 (51%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +  AT+LNSL   K P D RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDTATKLNSLGFAKAPSDTRVVVAMSGGVDSSVVAAQLASEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVAEEMGFPHYVLDYENVFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++     G  +  +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRKM-----GPEKAELHAAADGARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGD-MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            Q+QL  LRFPLG    K++ R+LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 KQEQLDFLRFPLGHLPSKDATRELAAKFGLSVADKPDSQDICFVPNGNYAAVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  GDIV   G +LG+H G+I+YTIGQRRGLG+  +  PL+VV LD +   VIVGP+E L
Sbjct: 236 AEAGDIVDTEGNVLGKHEGVIHYTIGQRRGLGIGGLETPLYVVRLDVDLKHVIVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEV 357
               I +REINWLGD        + +   V++RS++ P P  ++   D    V+    E 
Sbjct: 296 STRTIPVREINWLGDAPLSSK--EEWHVLVRVRSTRPPRPAIIRPISDVEATVELLTPED 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY +DS   R+ GGG I
Sbjct: 354 GVSPGQACVFYDTDS--TRIFGGGWI 377


>gi|73919895|sp|Q812R6|MNMA_BACCR RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 371

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 291 WVSNKEKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 347 DGD----ECLGGATIDEVYRSGK 365


>gi|324328299|gb|ADY23559.1| tRNA-specific 2-thiouridylase MnmA [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 371

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 202/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V++  ++    +  GQA VFY
Sbjct: 291 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVHILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 347 DGD----ECLGGATIDEVYRSGK 365


>gi|165872748|ref|ZP_02217376.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0488]
 gi|167636496|ref|ZP_02394793.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0442]
 gi|167638584|ref|ZP_02396860.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0193]
 gi|170689637|ref|ZP_02880819.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0465]
 gi|170709396|ref|ZP_02899807.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0389]
 gi|177653267|ref|ZP_02935519.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0174]
 gi|190566853|ref|ZP_03019769.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis Tsiankovskii-I]
 gi|227817175|ref|YP_002817184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. CDC 684]
 gi|229601635|ref|YP_002868683.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0248]
 gi|164711524|gb|EDR17073.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0488]
 gi|167513432|gb|EDR88802.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0193]
 gi|167528089|gb|EDR90886.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0442]
 gi|170125695|gb|EDS94611.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0389]
 gi|170666407|gb|EDT17188.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0465]
 gi|172081549|gb|EDT66621.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0174]
 gi|190561844|gb|EDV15813.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis Tsiankovskii-I]
 gi|227004048|gb|ACP13791.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. CDC 684]
 gi|229266043|gb|ACQ47680.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus anthracis str. A0248]
          Length = 372

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|116628661|ref|YP_821280.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus thermophilus
           LMD-9]
 gi|122266745|sp|Q03I88|MNMA_STRTD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116101938|gb|ABJ67084.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus thermophilus LMD-9]
          Length = 373

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 135/385 (35%), Positives = 193/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I++ +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIDIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVVR----DEDGIVHMLRGADNNKDQTYFLSQLSQEQLQKAMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  + + + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQKGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ESL    +    
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSKNILYVGQGFHHESLMSTSLDAST 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V+   D   V F + +  +  GQA VF
Sbjct: 293 IHFTRDMPEE----FEMECTAKFRYRQPDSKVTVKVKGDKSEVIFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGGII  + +   V
Sbjct: 349 YDG----QECLGGGIIDQAYKDGKV 369


>gi|300716270|ref|YP_003741073.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erwinia billingiae Eb661]
 gi|299062106|emb|CAX59222.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erwinia billingiae Eb661]
          Length = 367

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 121/380 (31%), Positives = 195/380 (51%), Gaps = 28/380 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ D
Sbjct: 1   MSLSQKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEE---YCTAAEDLAD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L     
Sbjct: 58  AQAVCDKLGIYLHTVNFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAE 117

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+    +Q+    FP+G+
Sbjct: 118 DLGADFIATGHYVRRQ-----DVDGKSRLLRGLDDNKDQSYFLYTLGHEQIAQSLFPVGE 172

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           + K  VR +A E+ L  A K DS  ICF+ + K+ D + R     A  G I++  G+++G
Sbjct: 173 LAKPDVRRIAEELELITAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPILNAEGEVVG 230

Query: 255 RHNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
            H G++ +T+GQR+GLG+        EP +VV  D  ++ ++V             +  +
Sbjct: 231 EHQGLMYHTLGQRKGLGIGGTKAGSEEPWYVVDKDVANNILVVAQGHEHPRLMSVGLVAQ 290

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           +++W+      + +    +C VK R  Q  +P  V    +D + V F++    V  GQ+ 
Sbjct: 291 QLHWVD----REILTAPLRCTVKTRYRQADIPCTVTPLGEDRIEVRFDEPVAAVTPGQSA 346

Query: 366 VFYTSDSNEARVLGGGIISG 385
           VFY  +      LGGGII  
Sbjct: 347 VFYLDEI----CLGGGIIEA 362


>gi|16800615|ref|NP_470883.1| tRNA-specific 2-thiouridylase MnmA [Listeria innocua Clip11262]
 gi|24638323|sp|Q92BK1|MNMA_LISIN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|16414020|emb|CAC96778.1| lin1547 [Listeria innocua Clip11262]
          Length = 371

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 136/383 (35%), Positives = 194/383 (50%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A + GL  A+K DS  ICF+ +  +   +       A  GD+  LNG++L
Sbjct: 173 GMEKTEVREIATKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGDMRTLNGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  D  ++ + V             +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKDLKNNVLFVEQGFHHDSLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +          F C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNS----EKPKTFVCTAKFRYRQTDTKVTVNMREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +  A
Sbjct: 347 DGDI----CLGGGTIDTVWKKGA 365


>gi|157370264|ref|YP_001478253.1| tRNA-specific 2-thiouridylase MnmA [Serratia proteamaculans 568]
 gi|166991124|sp|A8GDD5|MNMA_SERP5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157322028|gb|ABV41125.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Serratia proteamaculans 568]
          Length = 367

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 122/378 (32%), Positives = 196/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVTAYLLQQQGYQVAGLFMKNWEEDDDEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LGADFIATGHYVRRQ-----DVDSKSRLLRGVDGNKDQSYFLYTLSHEQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G IV ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIVSVDGQTVGE 232

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGMKDSSEDPWYVVDKDVANNVLVVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        +   F+C VK R  Q  +P  V   D+  + V F++    V  GQ+ V
Sbjct: 293 LHWVD----RLPLSGPFRCTVKTRYRQQDIPCTVTPLDEQRIEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQDEI----CLGGGIIE 362


>gi|306826439|ref|ZP_07459751.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes ATCC 10782]
 gi|304431369|gb|EFM34366.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes ATCC 10782]
          Length = 378

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 194/386 (50%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 5   FMTDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 61

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 62  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 121

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 122 MTLGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 178 HLQKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDM 235

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +  
Sbjct: 236 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDA 295

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA 
Sbjct: 296 SVIHFTREMPEE----FTFECTAKFRYRQPDSHVTVHVRGDKAEVVFAEPQRAITPGQAV 351

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY         LGGG+I  + ++  
Sbjct: 352 VFYDG----KECLGGGMIDMAYKNGQ 373


>gi|82751221|ref|YP_416962.1| 5-methylaminomethyl-2-thiouridylate- methyltransferase tRNA
           [Staphylococcus aureus RF122]
 gi|123547857|sp|Q2YT57|MNMA_STAAB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|82656752|emb|CAI81181.1| 5-methylaminomethyl-2-thiouridylate-methyltransferase tRNA
           [Staphylococcus aureus RF122]
          Length = 372

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 135/380 (35%), Positives = 202/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG II    +++
Sbjct: 350 DV----CLGGAIIDDVFKNE 365


>gi|229086959|ref|ZP_04219116.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock3-44]
 gi|228696335|gb|EEL49163.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock3-44]
          Length = 376

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 138/383 (36%), Positives = 202/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYIDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E     GFKC  K R  Q+   V VQ  +D+ + +  ++    +  GQA VFY
Sbjct: 296 WVSNRAKE----KGFKCTAKFRYRQEDNKVTVQIVDDNTIRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|323350805|ref|ZP_08086464.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis VMC66]
 gi|322122979|gb|EFX94682.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis VMC66]
          Length = 373

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 133/384 (34%), Positives = 193/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +   +RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + N V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWNRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQIKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             +      LGGG+I  + R   V
Sbjct: 350 DGE----ECLGGGLIDNAYRDGKV 369


>gi|225871462|ref|YP_002747409.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equi subsp. equi 4047]
 gi|254811462|sp|C0MB53|MNMA_STRE4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225700866|emb|CAW95613.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus equi subsp. equi 4047]
          Length = 374

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 130/380 (34%), Positives = 188/380 (49%), Gaps = 19/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 1   MMTDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y +G TP P V CN+ +KF   L   
Sbjct: 58  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRSGRTPNPDVMCNKEIKFKAFLDYA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 MTLGADYVATGHYAQIKR----DENGVVHMLRGLDKGKDQTYFLSQLSQEQLQKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR +A + GL  A K DS  ICF+ +  +   +       A +G ++ ++G+ +
Sbjct: 174 HLQKSEVRAIAEQAGLATAKKKDSTGICFISEKNFKTFLSHYLP--AQKGRMMTVDGRDM 231

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           G H G++ YTIGQR GLG+        +P FVV  D + + + VG     E       + 
Sbjct: 232 GEHAGLMYYTIGQRGGLGIGGQQGGDNKPWFVVGKDLSQNILYVGQGFYHESLMSTSLDA 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           + +     E       +C  K R  Q    V V    D   V F + +  +  GQA VFY
Sbjct: 292 S-VIQFTREVPEEFTLECTAKFRYRQPDSKVTVHVKKDKAKVVFAEPQRAITPGQAVVFY 350

Query: 369 TSDSNEARVLGGGIISGSKR 388
                    LGGGII  + +
Sbjct: 351 DG----HECLGGGIIDMAYK 366


>gi|30022472|ref|NP_834103.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 14579]
 gi|206969454|ref|ZP_03230408.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH1134]
 gi|296504889|ref|YP_003666589.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis BMB171]
 gi|29898030|gb|AAP11304.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Bacillus cereus ATCC 14579]
 gi|206735142|gb|EDZ52310.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH1134]
 gi|296325941|gb|ADH08869.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis BMB171]
 gi|326942178|gb|AEA18074.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 372

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVSNKEKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|293396528|ref|ZP_06640804.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Serratia odorifera DSM 4582]
 gi|291420792|gb|EFE94045.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Serratia odorifera DSM 4582]
          Length = 370

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 120/378 (31%), Positives = 195/378 (51%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVTAYLLQQQGYQVAGLFMKNWEEDDDEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +   G +      + R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 120 LGADFIATGHYVRRQDVDGKN-----RLLRGVDGNKDQSYFLYTLSHEQVAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G IV ++GQ +G 
Sbjct: 175 EKPQVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIVTVDGQTIGE 232

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  +++++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGMKDSSEDPWYVVDKDVANNQLVVAQGHDHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q  +   V   D + + V F++    V  GQ+ V
Sbjct: 293 LHWVD----RQPLTAPLRCTVKTRYRQQDLACTVTPIDAERIEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 349 FYQGEI----CLGGGIIE 362


>gi|118479554|ref|YP_896705.1| tRNA-specific 2-thiouridylase MnmA [Bacillus thuringiensis str. Al
           Hakam]
 gi|228929441|ref|ZP_04092462.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
 gi|228935717|ref|ZP_04098530.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228948110|ref|ZP_04110394.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228987648|ref|ZP_04147762.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229093467|ref|ZP_04224570.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock3-42]
 gi|229123937|ref|ZP_04253129.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 95/8201]
 gi|229141133|ref|ZP_04269675.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-ST26]
 gi|229158012|ref|ZP_04286083.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 4342]
 gi|118418779|gb|ABK87198.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis str. Al Hakam]
 gi|228625465|gb|EEK82221.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 4342]
 gi|228642411|gb|EEK98700.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-ST26]
 gi|228659239|gb|EEL14887.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 95/8201]
 gi|228689938|gb|EEL43742.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock3-42]
 gi|228772108|gb|EEM20560.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228811468|gb|EEM57805.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228823955|gb|EEM69774.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228830229|gb|EEM75845.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pondicheriensis BGSC
           4BA1]
          Length = 376

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|205822381|sp|A2RLX1|MNMA_LACLM RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 376

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 138/386 (35%), Positives = 193/386 (50%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 4   KSPAQTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDENGVCTATEDYKD 60

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I V +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L    +
Sbjct: 61  VAAVADQIGVPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME 120

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R  D  +DQ+YFL   TQ+QL    FPLG +
Sbjct: 121 LGADYVATGHYAQVRT----DEDGTVHMLRGADNNKDQTYFLSQLTQEQLKKTMFPLGHL 176

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   +       A  G ++ L+G  +G 
Sbjct: 177 EKPEVRRIAEKAGLATAKKKDSTGICFIGEKNFKKFLGEYLP--AQPGKMMTLDGVEMGN 234

Query: 256 HNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           H G++ YTIGQR GLG+         +P FVV  D  ++ + V      E L    +   
Sbjct: 235 HAGLMYYTIGQRGGLGIGGQHGQLTSDPWFVVGKDLTTNTLYVGQGFHHEHLYSTSLDAS 294

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++++      E        C  K R  Q+   V +  N D V VDF++    +  GQA V
Sbjct: 295 DLSFTR----EMPETFDLHCTAKFRYRQEDTGVTIHVNGDKVTVDFDEPVRAITPGQAVV 350

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAV 392
           FY  +      LGG +I  + +   V
Sbjct: 351 FYDGE----ECLGGAMIDVAYKEQKV 372


>gi|139474609|ref|YP_001129325.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes str. Manfredo]
 gi|68053070|sp|Q5X9C1|MNMA_STRP6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166235086|sp|A2RH05|MNMA_STRPG RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205829106|sp|Q1J455|MNMA_STRPF RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|134272856|emb|CAM31137.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes str. Manfredo]
          Length = 373

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 IHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVRGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + ++  
Sbjct: 349 YDG----KECLGGGMIDMAYKNGQ 368


>gi|59712391|ref|YP_205167.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio fischeri ES114]
 gi|71658019|sp|Q5E3W7|MNMA_VIBF1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|59480492|gb|AAW86279.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio fischeri ES114]
          Length = 374

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 116/383 (30%), Positives = 191/383 (49%), Gaps = 27/383 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDD--GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           L AD +A GHY+R      ++     +  M R +D  +DQSYFL+  + +Q+    FP+G
Sbjct: 120 LDADFIAMGHYVRRTFPTAEEIANGIKPQMLRGLDSNKDQSYFLYTLSSEQVARSLFPVG 179

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR +A E GL  A K DS  ICF+ + K+ + + +     A  G+I    G+++
Sbjct: 180 ELEKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPEGKVI 237

Query: 254 GRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRI 303
           G+H G++ +T+GQR+GL            +P FV   D   + +I    +         +
Sbjct: 238 GQHQGLMYHTLGQRKGLHIGGTKGGGGNEDPWFVGEKDLKRNVLIAVQGKDHPLLKSQGL 297

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASG 362
              +++W+        +     C VK R  Q  +P  +   DD  + V F++ ++ V  G
Sbjct: 298 LASQLHWVD----RTPIKAPLSCTVKTRYRQTDIPCTIIPVDDENIKVIFDEPQIAVTPG 353

Query: 363 QACVFYTSDSNEARVLGGGIISG 385
           Q+ VFY  +      LGGGII  
Sbjct: 354 QSAVFYLDEV----CLGGGIIEE 372


>gi|325698055|gb|EGD39936.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK160]
          Length = 373

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 134/384 (34%), Positives = 196/384 (51%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +   +RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I +S+Y  ++E+ +   V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGISYYSVNFEKEYWERVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTIECTAKFRYRQPDSKVTVTVKGDKAVVNFDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|229175070|ref|ZP_04302588.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus MM3]
 gi|228608438|gb|EEK65742.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus MM3]
          Length = 376

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 138/383 (36%), Positives = 200/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P++ RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPQETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMATEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    I 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNIG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  + + V +  ++    +  GQA VFY
Sbjct: 296 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDGNTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|94989481|ref|YP_597582.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes
           MGAS9429]
 gi|94993368|ref|YP_601467.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes
           MGAS2096]
 gi|94542989|gb|ABF33038.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS9429]
 gi|94546876|gb|ABF36923.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS2096]
          Length = 379

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 194/386 (50%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 6   FMTDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 63  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 MTLGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLG 178

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 179 HLQKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDM 236

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +  
Sbjct: 237 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA 
Sbjct: 297 SVIHFTREMPEE----FTFECTAKFRYRQPDSHVTVHVRGDKAEVVFAEPQRAITPGQAV 352

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY         LGGG+I  + ++  
Sbjct: 353 VFYDG----KECLGGGMIDMAYKNGQ 374


>gi|218899565|ref|YP_002447976.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus G9842]
 gi|218543622|gb|ACK96016.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus G9842]
          Length = 372

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 202/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ + + E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVSNKVKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|212638582|ref|YP_002315102.1| tRNA-specific 2-thiouridylase MnmA [Anoxybacillus flavithermus WK1]
 gi|212560062|gb|ACJ33117.1| tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase
           [Anoxybacillus flavithermus WK1]
          Length = 371

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 140/374 (37%), Positives = 197/374 (52%), Gaps = 23/374 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RVVV MSGGVDSSV A LLK+ GYDVIG+ ++ ++    +   G C A +D  D  RVC+
Sbjct: 9   RVVVGMSGGVDSSVAALLLKQQGYDVIGIFMKNWDD---TDENGVCTATEDYEDVVRVCN 65

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L     LGAD L
Sbjct: 66  QIGIPYYAVNFEKQYWEKVFTYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHAMALGADYL 125

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R     G+       + R +D  +DQ+YFL    Q QL  + FP+G+++K  VR
Sbjct: 126 ATGHYARVAYRDGE-----YQLLRGLDANKDQTYFLNQLGQAQLSKVLFPIGELQKSKVR 180

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A+E GL  A K DS  ICF+ +  +   +       A  G++  L+G++ G H+G++ 
Sbjct: 181 EIAKEAGLATAGKKDSTGICFIGERNFKQFLSNYLP--AQPGEMQTLDGEVKGTHDGLMY 238

Query: 262 YTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLGDGLFE 317
           YTIGQR GLG+   GEP FVV  +   + + V      E L    I    +NW+ D    
Sbjct: 239 YTIGQRHGLGIGGSGEPWFVVGKNLKDNILYVAQGFDNELLYSDAIIATNVNWVSDRKPN 298

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           + +     C  K R  Q  VPV V+  D+    V F +    V  GQA VFY  +    +
Sbjct: 299 EPIA----CTAKFRYRQPDVPVTVEMIDETTARVSFSQRVRAVTPGQAVVFYNGE----Q 350

Query: 377 VLGGGIISGSKRSD 390
            LGGG I    R+ 
Sbjct: 351 CLGGGTIDQVFRNG 364


>gi|157693155|ref|YP_001487617.1| tRNA-specific 2-thiouridylase MnmA [Bacillus pumilus SAFR-032]
 gi|194017112|ref|ZP_03055724.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus pumilus ATCC 7061]
 gi|166991121|sp|A8FFP0|MNMA_BACP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157681913|gb|ABV63057.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus pumilus SAFR-032]
 gi|194010980|gb|EDW20550.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus pumilus ATCC 7061]
          Length = 372

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 138/383 (36%), Positives = 197/383 (51%), Gaps = 21/383 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K P+D RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MTKRPEDTRVVVGMSGGVDSSVAALMLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWDKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D       M R +D  +DQ+YFL   TQ+QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRTGDEVKMLRGLDANKDQTYFLNQLTQEQLDKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K+ VR+LA+E  L  A K DS  ICF+ +  +   + +     A  G +  ++G++ 
Sbjct: 173 DLEKKRVRELAKEAELATATKKDSTGICFIGERNFKTFLSQYLP--AQPGVMQTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           G H+G++ YTIGQR+GLG+   G+P FVV  D   + + V             I    I+
Sbjct: 231 GEHDGLMYYTIGQRQGLGIGGSGDPWFVVGKDLEQNILFVEQGFHNPLLYSESISAVNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFY 368
           W    +  +       C  K R  Q+   V V+   +    V F++    V  GQA VFY
Sbjct: 291 WTRPHIVGEN--GELTCTAKFRYRQEDHHVKVKMTGEQEAMVIFDEPVRAVTPGQAVVFY 348

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    +   
Sbjct: 349 DGD----ECLGGGTIDDVFKDGQ 367


>gi|229163345|ref|ZP_04291297.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus R309803]
 gi|228620126|gb|EEK77000.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus R309803]
          Length = 372

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/382 (35%), Positives = 201/382 (52%), Gaps = 23/382 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P++ RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPQETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q    V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVSNKAKE----AEFKCTAKFRYRQADNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSD 390
             D      LGG  I    RS 
Sbjct: 348 DGD----ECLGGATIDEVYRSG 365


>gi|13472503|ref|NP_104070.1| tRNA-specific 2-thiouridylase MnmA [Mesorhizobium loti MAFF303099]
 gi|14023249|dbj|BAB49856.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Mesorhizobium loti MAFF303099]
          Length = 378

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 221/377 (58%), Positives = 272/377 (72%), Gaps = 5/377 (1%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCCAGQD+ DARRV +T+ + 
Sbjct: 1   MSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCCAGQDIDDARRVSETLGIP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+DLL+  ++LGAD LATGHY
Sbjct: 61  HYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFADLLATAKELGADALATGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
           IRS    G +G  R  + RP+D +RDQSYFLFATTQ Q+  LRFPLG + K  VR +A E
Sbjct: 121 IRS----GANGAHR-ALYRPVDADRDQSYFLFATTQAQIDYLRFPLGGLSKPQVRAIAEE 175

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
           MGL +A K DSQDICFV QGKY D++ ++    A  GDIVH++G++LGRH GI+ YTIGQ
Sbjct: 176 MGLTVAAKQDSQDICFVPQGKYSDIIAKLKPAAANPGDIVHIDGRVLGRHEGILRYTIGQ 235

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           RRG+G+A GEPL+VV+LD   +RV+VGPRE+LE H+IYLR +NWLGDG   D    G + 
Sbjct: 236 RRGIGIASGEPLYVVHLDAERARVVVGPREALETHKIYLRNMNWLGDGPLGDIPEGGLEL 295

Query: 327 FVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS 386
           F K+RS++ P P  ++       V+    E G+A GQACV Y+ D NEARV GGG I  S
Sbjct: 296 FAKVRSTRPPRPAVLRYVAGVTSVELADGESGIAPGQACVLYSDDGNEARVFGGGFIERS 355

Query: 387 KRSDAVEESLLSVIGDE 403
           +R    E  L  +    
Sbjct: 356 ERGAEAEAMLTKLAARP 372


>gi|65321763|ref|ZP_00394722.1| COG0482: Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Bacillus anthracis str. A2012]
          Length = 376

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVS----NEAKEKEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|15924611|ref|NP_372145.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|156979939|ref|YP_001442198.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|255006407|ref|ZP_05145008.2| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|24638325|sp|Q931Q6|MNMA_STAAM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166235085|sp|A7X333|MNMA_STAA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|14247392|dbj|BAB57783.1| tRNA-methyltransferase [Staphylococcus aureus subsp. aureus Mu50]
 gi|156722074|dbj|BAF78491.1| 5-methylaminomethyl-2-thiouridylate- methyltransf erase
           [Staphylococcus aureus subsp. aureus Mu3]
          Length = 372

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 201/380 (52%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|209560263|ref|YP_002286735.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus pyogenes NZ131]
 gi|229487429|sp|B5XJA6|MNMA_STRPZ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209541464|gb|ACI62040.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Streptococcus pyogenes NZ131]
          Length = 373

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D   +  M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DENGKVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 IHFTREMPEE----FTFECTAKFRYRQPDSHVTVHVRGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + ++  
Sbjct: 349 YDG----KECLGGGMIDMAYKNGQ 368


>gi|205822346|sp|B1ZGZ6|MNMA_METPB RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 385

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 205/379 (54%), Positives = 269/379 (70%), Gaps = 8/379 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 1   MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 61  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR       +  R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGMARDLGAEALATGHYVASRAQP----EGGRALYRALDPARDQSYFLYATTPEQLAFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G+IV L
Sbjct: 177 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 237 DGRRLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLG    +   +      V++RS+++P P  +  N  +  + V+    E GV+ GQACV
Sbjct: 297 NWLGSRAPDG--LADLPVAVRVRSTREPRPARLSWNAAEACLEVELVVPEDGVSPGQACV 354

Query: 367 FYTSDSNEARVLGGGIISG 385
            Y  D   A+VLGGG I  
Sbjct: 355 IYADDGPRAQVLGGGTIRR 373


>gi|254829729|ref|ZP_05234384.1| tRNA-specific 2-thiouridylase MnmA [Listeria monocytogenes 10403S]
          Length = 371

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 134/383 (34%), Positives = 198/383 (51%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I++ +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIDIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  ADK DS  ICF+ +  +   +       A  G++  L+G++L
Sbjct: 173 AMEKTEVREIAKKAGLATADKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLDGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP FVV  +   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWFVVGKNLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGGG I    ++  
Sbjct: 347 DGDV----CLGGGTIDTVWKNGQ 365


>gi|42783525|ref|NP_980772.1| tRNA-specific 2-thiouridylase MnmA [Bacillus cereus ATCC 10987]
 gi|73919894|sp|Q730D7|MNMA_BACC1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|42739454|gb|AAS43380.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 10987]
          Length = 371

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 118 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 173 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 291 WVSNKAKE----KEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 347 DGD----ECLGGATIDEVYRSGK 365


>gi|197336343|ref|YP_002156606.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio fischeri MJ11]
 gi|229487426|sp|B5FG83|MNMA_VIBFM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|197317833|gb|ACH67280.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Vibrio fischeri MJ11]
          Length = 374

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 116/383 (30%), Positives = 191/383 (49%), Gaps = 27/383 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDD--GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           L AD +A GHY+R      ++     +  M R +D  +DQSYFL+  + +Q+    FP+G
Sbjct: 120 LDADFIAMGHYVRRTFPTAEEIANGVKPQMLRGLDSNKDQSYFLYTLSSEQVARSLFPVG 179

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           +++K  VR +A E GL  A K DS  ICF+ + K+ + + +     A  G+I    G+++
Sbjct: 180 ELEKPEVRRIAEEQGLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPEGKVI 237

Query: 254 GRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRI 303
           G+H G++ +T+GQR+GL            +P FV   D   + +I    +         +
Sbjct: 238 GQHQGLMYHTLGQRKGLHIGGTKGGGGNEDPWFVGEKDLKRNVLIAVQGKDHPLLKSQGL 297

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASG 362
              +++W+        +     C VK R  Q  +P  +   DD  + V F++ ++ V  G
Sbjct: 298 LASQLHWVD----RTPIKAPLSCTVKTRYRQTDIPCTIIPVDDENIKVIFDEPQIAVTPG 353

Query: 363 QACVFYTSDSNEARVLGGGIISG 385
           Q+ VFY  +      LGGGII  
Sbjct: 354 QSAVFYLDEV----CLGGGIIEE 372


>gi|313608681|gb|EFR84517.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Listeria monocytogenes FSL F2-208]
          Length = 371

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 133/383 (34%), Positives = 195/383 (50%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           +  N  D+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MSTNNSDIRVVVGMSGGVDSSVTAHILKEQGYDVIGIFMKNWDD---TDEFGVCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RV + I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L   
Sbjct: 58  DDVIRVANQIGIPYYAVNFEKEYWDKVFTYFLDEYKLGRTPNPDVMCNKEIKFKAFLEHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +    +       + R +D  +DQ+YFL   +Q QL  + FPLG
Sbjct: 118 ESLGADYVATGHYAQVKKVGDE-----IELLRGVDNNKDQTYFLNQLSQDQLKKVMFPLG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            M+K  VR++A++ GL  A+K DS  ICF+ +  +   +       A  G++  LNG++L
Sbjct: 173 GMEKTEVREIAKKAGLATANKKDSTGICFIGERNFKQFLSEYLP--AQPGEMRTLNGEVL 230

Query: 254 GRHNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   GEP   V  D   + + V      E+L    +   +I+
Sbjct: 231 GKHDGLMYYTIGQRHGLGIGGDGEPWXXVGKDLKENVLFVEQGFHHETLYSDSLIATDIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           +  +           +C  K R  Q    V V   +DG   V F      +  GQA VFY
Sbjct: 291 FTTNA----EKPKTIECTAKFRYRQTDTKVTVHLREDGTAEVVFADPVRAITPGQAVVFY 346

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D       GGG I    ++ A
Sbjct: 347 DGDI----CFGGGTIDTVWKNGA 365


>gi|319940179|ref|ZP_08014532.1| tRNA-specific 2-thiouridylase mnmA [Streptococcus anginosus
           1_2_62CV]
 gi|319810650|gb|EFW06980.1| tRNA-specific 2-thiouridylase mnmA [Streptococcus anginosus
           1_2_62CV]
          Length = 373

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 130/384 (33%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
              RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D   
Sbjct: 5   SKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDVAA 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     LGA
Sbjct: 62  VADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLGA 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R++     D      M R +D  +DQ+YFL   +Q+QL    FPLG ++K 
Sbjct: 122 DYVATGHYARAKR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKS 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A + GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H G
Sbjct: 178 EVRAIAEKAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTVDGRDMGEHAG 235

Query: 259 IINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++++
Sbjct: 236 LMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYNDNLMSTSLDASQVHF 295

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
                 E       +C  K R  Q    V V    D   V+F + +  +  GQA VFY  
Sbjct: 296 TRKMPAE----FTMECTAKFRYRQPDSKVTVTVKGDKAIVNFAEPQRAITPGQAVVFYDG 351

Query: 371 DSNEARVLGGGIISGSKRSDAVEE 394
           +      LGGG+I  + +   +++
Sbjct: 352 E----ECLGGGLIDNAYKDGKLQQ 371


>gi|313889493|ref|ZP_07823139.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122105|gb|EFR45198.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 373

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 133/381 (34%), Positives = 192/381 (50%), Gaps = 25/381 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDKSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALN 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D   R  M R +D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVER----DSDGRVHMLRGVDNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A    L  A K DS  ICF+ +  +   + +     A +G +  ++G+ +G 
Sbjct: 175 QKSQVREIAARADLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMKTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      ESL    +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNVLYVGQGFYHESLMSTSLDASM 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++  D   E       +C  K R  Q    V V+ + D   V F + +  +  GQA VF
Sbjct: 293 VHFTHDMPKE----FTLECTAKFRYRQPDCKVSVKVSGDKAKVLFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKR 388
           Y +       LGGGII  + +
Sbjct: 349 YDN----QECLGGGIIDQAYK 365


>gi|228917030|ref|ZP_04080590.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228842637|gb|EEM87725.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 376

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 138/383 (36%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  QD   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVS----NEAKEKEFKCTAKFRYRQDDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|308174451|ref|YP_003921156.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus amyloliquefaciens DSM 7]
 gi|307607315|emb|CBI43686.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus amyloliquefaciens DSM 7]
 gi|328912774|gb|AEB64370.1| tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Bacillus amyloliquefaciens LL3]
          Length = 371

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 140/380 (36%), Positives = 197/380 (51%), Gaps = 22/380 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P+D RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 1   MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGFCTATEDY 57

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D  RVC+ I + +Y  ++E+++   V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 58  EDVIRVCNQIGIPYYAVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDHA 117

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD LATGHY R      D       M R +D  +DQ+YFL    Q+QL  + FP+G
Sbjct: 118 LSLGADYLATGHYARV-----DRSGDTVRMLRGLDENKDQTYFLNQLNQEQLSKVMFPIG 172

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR++A+E  L  A K DS  ICF+ +  +   + +     A  GD++ ++G++ 
Sbjct: 173 DLQKSRVREIAKEAELATAAKKDSTGICFIGERNFKTFLSQYLP--AQPGDMMTMDGEVK 230

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
           GRH+G++ YTIGQR GLG+   GEP F V  D   + + V            +I    I+
Sbjct: 231 GRHDGLMYYTIGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNIS 290

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFY 368
           W   GL +        C  K R  Q+   V V+    D   + F+     V  GQA VFY
Sbjct: 291 WTRPGLMD---GGEMTCTAKFRYRQEDHKVTVKMTGADEAEIIFDGQVRAVTPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKR 388
             +      LGGG I    +
Sbjct: 348 DGE----ECLGGGTIDDVYK 363


>gi|228923148|ref|ZP_04086439.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228941564|ref|ZP_04104113.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228954681|ref|ZP_04116704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228960668|ref|ZP_04122313.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228974494|ref|ZP_04135061.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228981088|ref|ZP_04141389.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis Bt407]
 gi|229048104|ref|ZP_04193677.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH676]
 gi|229071905|ref|ZP_04205116.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus F65185]
 gi|229081661|ref|ZP_04214156.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock4-2]
 gi|229111869|ref|ZP_04241415.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock1-15]
 gi|229129677|ref|ZP_04258645.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-Cer4]
 gi|229146967|ref|ZP_04275331.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-ST24]
 gi|229152600|ref|ZP_04280789.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus m1550]
 gi|229180672|ref|ZP_04308012.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 172560W]
 gi|229192608|ref|ZP_04319569.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 10876]
 gi|228590915|gb|EEK48773.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus ATCC 10876]
 gi|228602817|gb|EEK60298.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 172560W]
 gi|228630861|gb|EEK87501.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus m1550]
 gi|228636566|gb|EEK93032.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-ST24]
 gi|228653794|gb|EEL09664.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus BDRD-Cer4]
 gi|228671625|gb|EEL26923.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock1-15]
 gi|228701665|gb|EEL54156.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus Rock4-2]
 gi|228711201|gb|EEL63165.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus F65185]
 gi|228723259|gb|EEL74631.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus AH676]
 gi|228778629|gb|EEM26895.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis Bt407]
 gi|228785211|gb|EEM33223.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228799032|gb|EEM46004.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228805008|gb|EEM51604.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228818120|gb|EEM64196.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228836527|gb|EEM81877.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 376

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVSNKEKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|261856534|ref|YP_003263817.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halothiobacillus neapolitanus c2]
 gi|261837003|gb|ACX96770.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halothiobacillus neapolitanus c2]
          Length = 377

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 125/380 (32%), Positives = 195/380 (51%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K P+D RV+V +SGGVDSSV A  L   GY V G+ ++ +      +    C A  D+ D
Sbjct: 7   KRPQDTRVIVGLSGGVDSSVAALRLIEAGYQVEGLFMKNWEGDDNDE---YCAAKADMLD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           A  V D + +  +  ++ + + + V   F   Y AG TP P + CNR +KF   L   R 
Sbjct: 64  ALSVADRLGIEFHFVNFAQDYWDRVFAHFLDEYRAGRTPNPDILCNREIKFRAFLDHART 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R +  + DD      + + +D  +DQSYFL A +++QL    FP+G+M
Sbjct: 124 LGADYIATGHYARVQHALPDDS-GETCLLKGLDANKDQSYFLHALSREQLASALFPIGEM 182

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + G   A K DS  ICF+ + ++ + +K      A  GDIV ++GQ++G+
Sbjct: 183 EKPEVRRIAEQAGFKTATKKDSTGICFIGERRFSEFLKTYLP--AQPGDIVTVDGQVVGQ 240

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +TIGQR+GLG+        +P +V   +   + +IV   +         +   +
Sbjct: 241 HQGLMYHTIGQRQGLGIGGLRDQGDQPWYVAGKNLGDNTLIVAQGQDHPALFAPALRAGQ 300

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACV 366
           I+W+ D           +   KIR  Q   P  V   + D + V F++ +  +  GQ+ V
Sbjct: 301 IHWINDPTKLVGPY-PLRLTAKIRYRQPDQPCTVMTISKDQLQVVFDQPQRAITPGQSIV 359

Query: 367 FYTSDSNEARVLGGGIISGS 386
           FY  D      LGG +I  +
Sbjct: 360 FYHGDV----CLGGAVIEEA 375


>gi|315640033|ref|ZP_07895158.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus italicus DSM 15952]
 gi|315484161|gb|EFU74632.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus italicus DSM 15952]
          Length = 378

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 136/385 (35%), Positives = 201/385 (52%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+  + RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 7   KDNSNTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 64  VAKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALD 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG M
Sbjct: 124 LGADYVATGHYAQVVR----DEDGLTHMLRGVDNNKDQTYFLSQLSQEQLAKTMFPLGGM 179

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A+   L  A K DS  +CF+ +  +   +       A +G++V L+G++ G+
Sbjct: 180 EKSEVRAIAQRANLATAKKKDSTGVCFIGEKNFKQFLSHYLP--AQKGNMVTLDGEVKGQ 237

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H+G++ YTIGQR+GLG+       EP FVV  D  ++ + VG            +   +I
Sbjct: 238 HDGLMYYTIGQRQGLGIGGGGKTQEPWFVVGKDLATNTLYVGQGFHHPALYADHLDASDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVF 367
           ++      +    + FKC  K R  Q  VPV V+   D+   V F++    +  GQA VF
Sbjct: 298 HFTN----QSGQPEEFKCTAKFRYRQQDVPVTVRLLADNRAEVYFDEPVRAITPGQAVVF 353

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y         LGGG+I  + + + V
Sbjct: 354 YDG----MECLGGGLIDRAFQENKV 374


>gi|169632892|ref|YP_001706628.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii SDF]
 gi|229486328|sp|B0VUD6|MNMA_ACIBS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|169151684|emb|CAP00474.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii]
          Length = 377

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 198/379 (52%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTAMEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRS-RLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R         G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRAETAYNSKGEAYAPLLRGLDNNKDQTYFLHAVHGREINKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A E+ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 EVRRIAEELDLATAKKKDSTGICFIGERRFNDFLKQYLP--AQPGKIVLDNGKEVGEHHG 236

Query: 259 IINYTI-----GQRRGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+         G+  A     FV++ D  ++R++V        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGLGGMKGASEGAWFVLHKDVTNNRLVVGQGHDHPLMQSTQLWSESIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD---GVYVDFEKSEVGVASGQACVF 367
           +     ++   +G +C  K R  Q      V  +++   GV V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QNIPAEGLRCTAKTRYRQPDQACTVFIDENSEHGVRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSDEV----CLGGGVIHHT 369


>gi|15927201|ref|NP_374734.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus N315]
 gi|49483866|ref|YP_041090.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|57650503|ref|YP_186516.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus COL]
 gi|148268102|ref|YP_001247045.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150394170|ref|YP_001316845.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151221735|ref|YP_001332557.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509848|ref|YP_001575507.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253316605|ref|ZP_04839818.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732278|ref|ZP_04866443.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253733127|ref|ZP_04867292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257425746|ref|ZP_05602170.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428406|ref|ZP_05604804.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431044|ref|ZP_05607423.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433730|ref|ZP_05610088.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436645|ref|ZP_05612689.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus M876]
 gi|257793696|ref|ZP_05642675.1| tRNA methyl transferase [Staphylococcus aureus A9781]
 gi|258411005|ref|ZP_05681285.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus A9763]
 gi|258420193|ref|ZP_05683148.1| tRNA methyl transferase [Staphylococcus aureus A9719]
 gi|258438195|ref|ZP_05689479.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A9299]
 gi|258443658|ref|ZP_05691997.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A8115]
 gi|258446865|ref|ZP_05695019.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A6300]
 gi|258448779|ref|ZP_05696891.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus A6224]
 gi|258450551|ref|ZP_05698613.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A5948]
 gi|258453598|ref|ZP_05701576.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A5937]
 gi|262048616|ref|ZP_06021499.1| (5-methylaminomethyl-2-thiouridylate)-methyltran sferase
           [Staphylococcus aureus D30]
 gi|269203247|ref|YP_003282516.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893124|ref|ZP_06301358.1| tRNA methyl transferase [Staphylococcus aureus A8117]
 gi|282904202|ref|ZP_06312090.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus C160]
 gi|282906028|ref|ZP_06313883.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908941|ref|ZP_06316759.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911258|ref|ZP_06319060.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914426|ref|ZP_06322212.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus M899]
 gi|282916890|ref|ZP_06324648.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus D139]
 gi|282919396|ref|ZP_06327131.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus C427]
 gi|282920169|ref|ZP_06327894.1| tRNA methyl transferase [Staphylococcus aureus A9765]
 gi|282924721|ref|ZP_06332389.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus C101]
 gi|282928255|ref|ZP_06335860.1| tRNA methyl transferase [Staphylococcus aureus A10102]
 gi|283958382|ref|ZP_06375833.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284024678|ref|ZP_06379076.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus 132]
 gi|293503501|ref|ZP_06667348.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510518|ref|ZP_06669224.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus M809]
 gi|293531058|ref|ZP_06671740.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus M1015]
 gi|294848651|ref|ZP_06789397.1| tRNA methyl transferase [Staphylococcus aureus A9754]
 gi|295406743|ref|ZP_06816548.1| tRNA methyl transferase [Staphylococcus aureus A8819]
 gi|295428198|ref|ZP_06820830.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275907|ref|ZP_06858414.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245675|ref|ZP_06929540.1| tRNA methyl transferase [Staphylococcus aureus A8796]
 gi|297590835|ref|ZP_06949473.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus MN8]
 gi|304380782|ref|ZP_07363449.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|24638330|sp|Q99TM8|MNMA_STAAN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56749735|sp|Q6GG82|MNMA_STAAR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71153356|sp|Q5HFE1|MNMA_STAAC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|172048920|sp|A6QHG3|MNMA_STAAE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|189040510|sp|A6U290|MNMA_STAA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|189040511|sp|A5ITE6|MNMA_STAA9 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|189040512|sp|A8Z4F9|MNMA_STAAT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205829108|sp|Q2FGA5|MNMA_STAA3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205829109|sp|Q2FXV6|MNMA_STAA8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|13701419|dbj|BAB42713.1| (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Staphylococcus aureus subsp. aureus N315]
 gi|49241995|emb|CAG40692.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|57284689|gb|AAW36783.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus COL]
 gi|147741171|gb|ABQ49469.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946622|gb|ABR52558.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus JH1]
 gi|150374535|dbj|BAF67795.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|160368657|gb|ABX29628.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|253724067|gb|EES92796.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253728883|gb|EES97612.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257271440|gb|EEV03586.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275247|gb|EEV06734.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278247|gb|EEV08889.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257281823|gb|EEV11960.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257283996|gb|EEV14119.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus M876]
 gi|257787668|gb|EEV26008.1| tRNA methyl transferase [Staphylococcus aureus A9781]
 gi|257840155|gb|EEV64619.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus A9763]
 gi|257843904|gb|EEV68298.1| tRNA methyl transferase [Staphylococcus aureus A9719]
 gi|257848239|gb|EEV72230.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A9299]
 gi|257851064|gb|EEV75007.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A8115]
 gi|257854440|gb|EEV77389.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A6300]
 gi|257858057|gb|EEV80946.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus A6224]
 gi|257861709|gb|EEV84508.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A5948]
 gi|257864329|gb|EEV87079.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus A5937]
 gi|259163263|gb|EEW47822.1| (5-methylaminomethyl-2-thiouridylate)-methyltran sferase
           [Staphylococcus aureus D30]
 gi|262075537|gb|ACY11510.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269941107|emb|CBI49493.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313556|gb|EFB43951.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus C101]
 gi|282317206|gb|EFB47580.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus C427]
 gi|282319377|gb|EFB49729.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus D139]
 gi|282321607|gb|EFB51932.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus M899]
 gi|282324953|gb|EFB55263.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327205|gb|EFB57500.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331320|gb|EFB60834.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590062|gb|EFB95144.1| tRNA methyl transferase [Staphylococcus aureus A10102]
 gi|282594517|gb|EFB99502.1| tRNA methyl transferase [Staphylococcus aureus A9765]
 gi|282595820|gb|EFC00784.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus C160]
 gi|282764442|gb|EFC04568.1| tRNA methyl transferase [Staphylococcus aureus A8117]
 gi|283470898|emb|CAQ50109.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ST398]
 gi|283790531|gb|EFC29348.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285817303|gb|ADC37790.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus 04-02981]
 gi|290920326|gb|EFD97392.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291095167|gb|EFE25432.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466882|gb|EFF09402.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus M809]
 gi|294824677|gb|EFG41100.1| tRNA methyl transferase [Staphylococcus aureus A9754]
 gi|294968490|gb|EFG44514.1| tRNA methyl transferase [Staphylococcus aureus A8819]
 gi|295128556|gb|EFG58190.1| tRNA methyl transferase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297177326|gb|EFH36578.1| tRNA methyl transferase [Staphylococcus aureus A8796]
 gi|297575721|gb|EFH94437.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus MN8]
 gi|302333295|gb|ADL23488.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus JKD6159]
 gi|302751450|gb|ADL65627.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304340658|gb|EFM06591.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ATCC BAA-39]
 gi|312437911|gb|ADQ76982.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus TCH60]
 gi|312830008|emb|CBX34850.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129903|gb|EFT85893.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195521|gb|EFU25908.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus CGS00]
 gi|315198681|gb|EFU29009.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140492|gb|EFW32346.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320144031|gb|EFW35800.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323439031|gb|EGA96763.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus O11]
 gi|329314296|gb|AEB88709.1| tRNA-specific 2-thiouridylase mnmA [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727166|gb|EGG63622.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus 21172]
 gi|329728421|gb|EGG64858.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus 21189]
          Length = 372

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 201/380 (52%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|228902924|ref|ZP_04067065.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis IBL 4222]
 gi|228967471|ref|ZP_04128500.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228792248|gb|EEM39821.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228856708|gb|EEN01227.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis IBL 4222]
          Length = 376

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 202/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ + + E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVSNKVKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|205829103|sp|Q1J988|MNMA_STRPB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205829104|sp|Q1JJD5|MNMA_STRPC RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 373

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 IHFTREMPEE----FTFECTAKFRYRQPDSHVTVHVRGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + ++  
Sbjct: 349 YDG----KECLGGGMIDMAYKNGQ 368


>gi|123442025|ref|YP_001006008.1| tRNA-specific 2-thiouridylase MnmA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|205828986|sp|A1JLK6|MNMA_YERE8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|122088986|emb|CAL11797.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 373

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 125/382 (32%), Positives = 196/382 (51%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDGEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVNGKSRLLRGLDGNKDQSYFLYTLSHEQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGQHVGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGGDDPWYVVDKDVANNILLVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+      + V   F+C VK R  Q  +P  V   DD  V V F+     V  GQ+ V
Sbjct: 293 LHWVD----REPVTAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDDPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|319746158|gb|EFV98430.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae ATCC 13813]
          Length = 397

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  ++RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 26  TDNSNIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 82

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 83  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 142

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 143 LGADYVATGHYAQV----TRDKNGIVHMLRGVDNNKDQTYFLSQLSQEQLQKTLFPLGHL 198

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  + D + +     A  G ++ ++G+ +G 
Sbjct: 199 QKPEVRRIAEEAGLATAKKKDSTGICFIGEKNFKDFLGQYLP--AQPGRMMTVDGRDMGE 256

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +   E
Sbjct: 257 HAGLMYYTIGQRGGLGIGGQHGGDNKPWFVVGKDLSKNILYVGQGFYHDSLMSTSLTASE 316

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V    +   V F+  +  +  GQA VF
Sbjct: 317 IHFTRDMPNE----FKLECTAKFRYRQPDSKVTVYVKGNQARVVFDDLQRAITPGQAVVF 372

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y    NE   LGGG+I  + R D +
Sbjct: 373 Y----NEQECLGGGMIDQAYRDDKI 393


>gi|89094503|ref|ZP_01167442.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanospirillum sp. MED92]
 gi|89081239|gb|EAR60472.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanospirillum sp. MED92]
          Length = 371

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 118/384 (30%), Positives = 194/384 (50%), Gaps = 27/384 (7%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
           + +    +V+V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C A +D+ 
Sbjct: 6   NTDNSSAKVIVGMSGGVDSSVSALLLMQQGYQVEGLFMKNWDEDDGTE---YCTAKEDLA 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ VCD + +  +  ++   + + V   F   Y AG TP P + CNR +KF   L    
Sbjct: 63  DAQAVCDKLGIHLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLEYAV 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           +LGAD +ATGHY+R       D   +  + + +D  +DQSYFL    Q ++    FP+G+
Sbjct: 123 ELGADFIATGHYVRR-----GDRDGKTRLLKGLDNNKDQSYFLHQVGQLEIEKTLFPVGE 177

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K +VR LA E  L   +K DS  ICF+ + ++ D +K+     A  G I   NG ++G
Sbjct: 178 LEKPAVRKLAEEHDLVTHNKKDSTGICFIGERRFSDFLKQYLP--AQPGKIETPNGDVIG 235

Query: 255 RHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
            H G++ YTIGQR+GL +        EP FV   D + + +I    +         +   
Sbjct: 236 EHAGLMYYTIGQRQGLQIGGLKDYPEEPWFVGAKDLDRNVLIAVQGKQNDLLFTDWLTAD 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQAC 365
           E+ W+      +     ++C  K+R  Q      ++R+ + G  + F + +  +  GQ+ 
Sbjct: 296 ELFWING----EEPQLPYQCTAKVRYRQSDQGCIIERHGESGYRIVFNEPQRAITPGQSV 351

Query: 366 VFYTSDSNEARVLGGGIISGSKRS 389
           V Y  D      LGGG+I  + ++
Sbjct: 352 VIYQDDI----CLGGGVIEHTGKN 371


>gi|119503231|ref|ZP_01625315.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2080]
 gi|119460877|gb|EAW41968.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [marine gamma proteobacterium HTCC2080]
          Length = 363

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 125/378 (33%), Positives = 192/378 (50%), Gaps = 26/378 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           NP    V+V MSGGVDSSV A LL+  GY V G+ ++ ++    +     C A +D+ DA
Sbjct: 3   NPSPSTVIVGMSGGVDSSVAALLLRDQGYRVEGLFMKNWDEDDGTD---YCTAKEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V  ++ +  +  ++   + + V   F + Y +G TP P + CNR +KF   L    +L
Sbjct: 60  EAVAASLGIKLHSANFAAEYWDGVFEHFLAEYQSGRTPNPDILCNREIKFRAFLDYATEL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY+R      DD   R  + + +D ++DQSYFL     ++L    FP+GD+ 
Sbjct: 120 GADFIATGHYVRR-----DDSGERTALLKGLDPDKDQSYFLHQVGHRELSRSLFPVGDLA 174

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A + GL  A K DS  ICF+ + ++ D +++     A  G I   NGQ LG H
Sbjct: 175 KPEVRKIAEQAGLTTARKKDSTGICFIGERRFKDFLQQYLP--AQPGVIEDTNGQALGEH 232

Query: 257 NGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
            G++ +TIGQR+GLG+         P +VV      + +IV           H ++   +
Sbjct: 233 QGLMYHTIGQRQGLGIGGLADRNAAPWYVVEKHVERNVLIVAQGNDHPRLYKHSLHASTL 292

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
            W+     E A     +C  K+R  Q      V +   G  V+F+  +  +  GQ+ VFY
Sbjct: 293 FWIS----EQAPTFPLQCTAKVRYRQPDQSCVVTKTASGFLVEFDVPQRAITPGQSVVFY 348

Query: 369 TSDSNEARVLGGGIISGS 386
            +D+     +GGGII G+
Sbjct: 349 HNDT----CMGGGIIEGA 362


>gi|323442826|gb|EGB00451.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus O46]
          Length = 372

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 202/380 (53%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +   +      M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRHEDGN----VEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|125719134|ref|YP_001036267.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus sanguinis SK36]
 gi|166235087|sp|A3CRB2|MNMA_STRSV RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|125499051|gb|ABN45717.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase,
           putative [Streptococcus sanguinis SK36]
          Length = 373

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +   +RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQDGLVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+F+K +  +  GQ  VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVTVKGDKAVVNFDKPQRAITPGQGVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|296388914|ref|ZP_06878389.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas aeruginosa PAb1]
 gi|313107663|ref|ZP_07793846.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas aeruginosa 39016]
 gi|310880348|gb|EFQ38942.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudomonas aeruginosa 39016]
          Length = 363

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 123/375 (32%), Positives = 195/375 (52%), Gaps = 26/375 (6%)

Query: 24  VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI 83
           +V MSGGVDSSV A LL + GY V G+ ++ ++    ++    C A +D+ DA+ VCD I
Sbjct: 2   IVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWDEDDGTE---YCTAREDLADAQAVCDRI 58

Query: 84  NVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLAT 143
            +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LGAD++AT
Sbjct: 59  GIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLGADLIAT 118

Query: 144 GHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDL 203
           GHY+R R     D   R  + + +D  +DQSYFL A   +Q+    FP+G+++K  VR +
Sbjct: 119 GHYVRRR-----DRDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEKPEVRAI 173

Query: 204 AREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYT 263
           A + GL  A K DS  ICF+ + ++ D +K+     A  GDI    G+++GRH+G++ +T
Sbjct: 174 AEKHGLATAKKKDSTGICFIGERRFTDFLKQYLP--AQPGDIETTEGKVIGRHSGLMYHT 231

Query: 264 IGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWLGDGL 315
           IGQR+GLG+        +P +V+  D   + ++VG            +    I W+    
Sbjct: 232 IGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIYWVNPVE 291

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            E       +   K+R  Q      +++  +G    F++ +  V  GQ+ VFY  D    
Sbjct: 292 LE----RPRRLRAKVRYRQSDQDCVLEKTAEGYRAVFDEPQRAVTPGQSVVFYDGDV--- 344

Query: 376 RVLGGGIISGSKRSD 390
             LGGG+I  ++  D
Sbjct: 345 -CLGGGVIETAEAWD 358


>gi|194429520|ref|ZP_03062041.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Escherichia coli B171]
 gi|194412394|gb|EDX28695.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Escherichia coli B171]
 gi|323163677|gb|EFZ49499.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Escherichia coli E128010]
          Length = 368

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 122/379 (32%), Positives = 197/379 (51%), Gaps = 28/379 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ D
Sbjct: 1   MSETAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEE---YCTATADLAD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L     
Sbjct: 58  AQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAE 117

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY+R       D   +  + R +D  +DQSYFL+  + +Q+    FP+G+
Sbjct: 118 DLGADYIATGHYVRR-----ADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGE 172

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A ++GL  A K DS  ICF+ + K+ + + R     A  G I+ ++G  +G
Sbjct: 173 LEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIITVDGDEIG 230

Query: 255 RHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
            H G++ +T+GQR+GLG+        EP +VV  D  ++ ++V             +  +
Sbjct: 231 EHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQ 290

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQAC 365
           +++W+    F        +C VK R  Q  +P  V+  +DD + V F++    V  GQ+ 
Sbjct: 291 QLHWVDREPF----TGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSA 346

Query: 366 VFYTSDSNEARVLGGGIIS 384
           VFY  +      LGGGII 
Sbjct: 347 VFYNGEV----CLGGGIIE 361


>gi|330828858|ref|YP_004391810.1| putative tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Aeromonas veronii B565]
 gi|328803994|gb|AEB49193.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Aeromonas veronii B565]
          Length = 368

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 122/378 (32%), Positives = 199/378 (52%), Gaps = 27/378 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   ++V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A QD+ D
Sbjct: 2   TDNSQIKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDTDE---YCSAAQDLAD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L     
Sbjct: 59  AKAVCDKLGMKLHTINFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAE 118

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           +LGA  +ATGHY+R      DD   R  + R +D  +DQSYFL+  +++Q+    FP+GD
Sbjct: 119 ELGATYIATGHYVRR-----DDSTGRPRLLRGLDTNKDQSYFLYTLSEKQVGQSLFPVGD 173

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A ++ L  A K DS  ICF+ + K+ D + +     A  G I  ++G+++G
Sbjct: 174 LEKPEVRRIAEQLDLITAKKKDSTGICFIGERKFKDFLAKFLP--AQPGKIETVDGKVIG 231

Query: 255 RHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL--EVHRIYLRE 307
            H G++ +T+GQR+GLG+        E  +VV  +   + ++V   E        +   +
Sbjct: 232 EHQGLMYHTLGQRKGLGIGGRKDATEEAWYVVDKEVERNVLVVAQGEHPRLYSDGLIASQ 291

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        + +  +C VK R  Q  +P  +Q  DD  + V F++ +  V  GQ+ V
Sbjct: 292 LHWVD----RTPIREPRRCTVKTRYRQQDIPCLIQPIDDETIRVIFDEKQAAVTPGQSAV 347

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 348 FYDGEV----CLGGGIIE 361


>gi|271500468|ref|YP_003333493.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dickeya dadantii Ech586]
 gi|270344023|gb|ACZ76788.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dickeya dadantii Ech586]
          Length = 370

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 122/382 (31%), Positives = 196/382 (51%), Gaps = 27/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +     ++    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDDTE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + ++ +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGITLHTVNFAAEYWDNVFEHFLAEYRAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + QQL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DIDGKSRLLRGLDGNKDQSYFLYTLSHQQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R           V  +G+++G 
Sbjct: 175 EKPEVRKIAEQLDLATARKKDSTGICFIGERKFRDFLARYLPAQPGPILSVD-DGKVMGE 233

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  S+ + V             +  ++
Sbjct: 234 HQGLMYHTLGQRKGLGIGGVKEGGDDPWYVVDKDVASNVLYVAQGHEHPRLMSVGLIAQQ 293

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACV 366
           ++W+      + +    +C VK R  Q  +P  +   D D + V FE+    V  GQ+ V
Sbjct: 294 LHWVD----REPLSAPLRCTVKTRYRQADIPCLLTPLDADRIDVRFEEPVAAVTPGQSAV 349

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII    R
Sbjct: 350 FYQGEV----CLGGGIIEERLR 367


>gi|229198523|ref|ZP_04325227.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus m1293]
 gi|228585026|gb|EEK43140.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus m1293]
          Length = 376

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLVTAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVSNKAKE----KEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSGK 370


>gi|84686908|ref|ZP_01014792.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84665105|gb|EAQ11585.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2654]
          Length = 381

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 200/386 (51%), Positives = 255/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +    R+NSL   K   + RVVVAMSGGVDSSVVAA LKR+GYDVIGVTLQLY+   A
Sbjct: 1   MSLDTEIRVNSLGFAKPESETRVVVAMSGGVDSSVVAAKLKREGYDVIGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  FR AVI  FA SY  G TP+PC+ C
Sbjct: 61  LAKKGACCAGVDIHDARRVAEEMGFPHYVLDYENIFREAVIEEFADSYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL+  + L AD +ATGHYI+       DG     + R  D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLATAKDLDADCMATGHYIQR-----FDGDAGPELHRAADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGD-MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG    K+  R LARE GL++ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLSFLRFPLGHLKTKDETRALAREFGLEVADKPDSQDICFVPDGNYAGVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LGRH+G+I+YTIGQRRGLG+  + +PL+VV LD  + +V+VGP+E L
Sbjct: 236 AEPGEIVHADGRVLGRHDGVIHYTIGQRRGLGIGGLSDPLYVVRLDTETRQVVVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F       +   VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 ATRTIPVREINWLGDAPFTSQ--GEWHLSVKVRSTRPPREAVIRPISETEAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  DS  +R+ GGG I
Sbjct: 354 GVSPGQACVFYAPDS--SRIFGGGWI 377


>gi|228910232|ref|ZP_04074050.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis IBL 200]
 gi|228849396|gb|EEM94232.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus thuringiensis IBL 200]
          Length = 376

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 6   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 63  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 178 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 235

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 236 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 295

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+ +   E      FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 296 WVSNKAKETE----FKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 352 DGD----ECLGGATIDEVYRSAK 370


>gi|227535218|ref|ZP_03965267.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|227187102|gb|EEI67169.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus paracasei subsp. paracasei ATCC 25302]
          Length = 471

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 131/379 (34%), Positives = 187/379 (49%), Gaps = 25/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +  ++RVVV MSGGVDSSV A LLK+ GYDV+GV ++ ++    +   G C A  D  D 
Sbjct: 101 DNSNIRVVVGMSGGVDSSVTALLLKQQGYDVVGVFMKNWDD---TDENGVCTATTDYEDV 157

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V   I + +Y  ++E+ + + V   F   Y AG TP P V CN+ +KF   L    QL
Sbjct: 158 AKVASEIGIPYYSINFEKEYWDRVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDYADQL 217

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            AD +A GHY + +     D      M R  D  +DQ+YFL   +Q QL    FP+G ++
Sbjct: 218 NADYIAMGHYAQVKT----DENGIVHMLRGADGNKDQTYFLSQLSQDQLKKSLFPIGHLQ 273

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  +   +       A  G ++ ++G  +G H
Sbjct: 274 KPEVRKIAEAAGLATAKKKDSTGICFIGERNFKQFLSTYLP--AQPGKMMTVDGVEMGTH 331

Query: 257 NGIINYTIGQRRGLGVAMG----EPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FVV  D + + + V       +L    +    +N
Sbjct: 332 DGLMYYTIGQRQGLGIGGNSDNSEPWFVVGKDLDKNILYVGQGFDNPALMATSLSASNLN 391

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W        A  +G     K R  Q    V +  +DDG   VDF+     +  GQA VFY
Sbjct: 392 WTTG----QAPAEGTHMTAKFRYRQRDTGVTLHYHDDGTATVDFDVPVRAITPGQAVVFY 447

Query: 369 TSDSNEARVLGGGIISGSK 387
             D      LGGG I  + 
Sbjct: 448 DGD----ECLGGGTIDAAY 462


>gi|238749636|ref|ZP_04611141.1| tRNA-specific 2-thiouridylase mnmA [Yersinia rohdei ATCC 43380]
 gi|238712291|gb|EEQ04504.1| tRNA-specific 2-thiouridylase mnmA [Yersinia rohdei ATCC 43380]
          Length = 373

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 196/382 (51%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDGEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVDGKSRLLRGLDGNKDQSYFLYTLSHEQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++G+ +G 
Sbjct: 175 EKPEVRRIAEQLELVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGKHVGE 232

Query: 256 HNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKEGGDDPWYVVDKDVANNILLVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        V   F+C VK R  Q  +P  V   DD  V V F++    V  GQ+ V
Sbjct: 293 LHWVD----RQPVTAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDEPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|167042070|gb|ABZ06805.1| putative tRNA methyl transferase [uncultured marine microorganism
           HF4000_141I21]
          Length = 382

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 183/382 (47%), Positives = 255/382 (66%), Gaps = 10/382 (2%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           + NSL   K PKD +VVVAMSGGVDSS VA L+K+DGYDVIG+TL+LY+  K+SK    C
Sbjct: 7   KFNSLGFLKRPKDTKVVVAMSGGVDSSTVAGLMKKDGYDVIGITLKLYDDAKSSKESRQC 66

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           CAGQD+ DA+RV   +N+ H +  Y+++F+  VI  F  SY AGETP+PCV CN+TVKF 
Sbjct: 67  CAGQDILDAKRVSQQLNIDHKILYYQKKFKKDVIDSFIDSYVAGETPIPCVQCNQTVKFR 126

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DL S   ++ AD L TGHY+      G+       M R +DL RDQSYFLF+TTQ+QL  
Sbjct: 127 DLYSYALEMKADALITGHYVNRIKKNGN-----AEMYRAIDLTRDQSYFLFSTTQEQLNF 181

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLG M+K+  R +A ++ L++ADK DSQDICFV  G Y  ++K+       +G+I+ 
Sbjct: 182 LRFPLGQMQKKETRKIASKLKLNVADKPDSQDICFVPNGNYASIIKKYRPESFQKGNILD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           + G I+G+H+GIIN+TIGQR+G+G+A  EPL+V+ ++  ++ VIVG R +L + +IYL+ 
Sbjct: 242 IVGNIVGKHDGIINFTIGQRKGIGIAYKEPLYVININAKTNEVIVGNRVALAIKKIYLKN 301

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +N L D    +        F+K+RS+   V   V  ND G  V+ E+ E G++ GQACVF
Sbjct: 302 LNLLSDAEEYNN-----NLFIKVRSTGRLVKAKVNLNDTGAEVNLEELETGISPGQACVF 356

Query: 368 YTSDSNEARVLGGGIISGSKRS 389
           Y+ +    +VLGGG I  ++ +
Sbjct: 357 YSKNQFGDKVLGGGWIVKTENN 378


>gi|222151508|ref|YP_002560664.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Macrococcus caseolyticus JCSC5402]
 gi|222120633|dbj|BAH17968.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Macrococcus caseolyticus JCSC5402]
          Length = 371

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 125/379 (32%), Positives = 196/379 (51%), Gaps = 23/379 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +VVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MDNSKTKVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYED 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             RVC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIRVCNQIGIPYYAVNFEQEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHAVK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R            M R +D  +DQ+YFL   TQ+QL  + FPLG +
Sbjct: 118 LGADYVATGHYAQIRRSED-----GVEMLRGVDNNKDQTYFLNQLTQEQLSRVMFPLGHL 172

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A +  L  A K DS  ICF+ +  + + +       A  G++  L+G+ +G 
Sbjct: 173 QKPEVREIALKHDLATAKKKDSTGICFIGERNFKEFLSGYLP--AQNGEMQTLDGKPMGT 230

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V      ++L    +   +++++
Sbjct: 231 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFDHDALYSDYLIASDVSFV 290

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTS 370
                   +    +C  K R  Q    V V++ +D+ + V + +    +  GQA VFY  
Sbjct: 291 NPV----DLTTPLECTAKFRYRQRDTKVTVEKIDDNTIKVTYAEPVRAITPGQAVVFYNG 346

Query: 371 DSNEARVLGGGIISGSKRS 389
           +      LGG  I    ++
Sbjct: 347 EV----CLGGATIDDVYKT 361


>gi|19747021|ref|NP_608157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus pyogenes MGAS8232]
 gi|19749279|gb|AAL98656.1| tRNA-methyltransferase [Streptococcus pyogenes MGAS8232]
          Length = 379

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 132/386 (34%), Positives = 194/386 (50%), Gaps = 25/386 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
              +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D 
Sbjct: 6   FMTDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDY 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L   
Sbjct: 63  KDVAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLGYA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 123 MTLGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLG 178

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            ++K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +
Sbjct: 179 HLQKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDM 236

Query: 254 GRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYL 305
           G H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +  
Sbjct: 237 GEHAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDA 296

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
             I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA 
Sbjct: 297 SVIHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVRGDKAEVVFAEPQRAITPGQAV 352

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDA 391
           VFY         LGGG+I  + ++  
Sbjct: 353 VFYDG----KECLGGGMIDMAYKNGQ 374


>gi|196044752|ref|ZP_03111986.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 03BB108]
 gi|196024240|gb|EDX62913.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus cereus 03BB108]
          Length = 372

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 137/383 (35%), Positives = 201/383 (52%), Gaps = 23/383 (6%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++K P + RVV+ MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D 
Sbjct: 2   MNKLPHETRVVIGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDY 58

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            D   VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L   
Sbjct: 59  NDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHA 118

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
             LGAD +ATGHY R     G+       M R +D  +DQ+YFL   +Q+QL    FPLG
Sbjct: 119 IALGADYVATGHYARVAYMDGE-----YKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLG 173

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           ++KK  +R++A+E GL  A K DS  ICF+ +  + D +       A  G +  L+G++ 
Sbjct: 174 ELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLP--AQPGVMQTLSGEVK 231

Query: 254 GRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           G+H+G++ YTIGQR GLG+   G+P F V  +   + + V      E L    +    + 
Sbjct: 232 GKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVG 291

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           W+      +A    FKC  K R  Q+   V VQ  +++ V +  ++    +  GQA VFY
Sbjct: 292 WVS----NEAKEKEFKCTAKFRYRQEDNKVSVQIVDENTVRILCDEPIRAITPGQAVVFY 347

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
             D      LGG  I    RS  
Sbjct: 348 DGD----ECLGGATIDEVYRSGK 366


>gi|289578840|ref|YP_003477467.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter italicus Ab9]
 gi|289528553|gb|ADD02905.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter italicus Ab9]
          Length = 364

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 140/371 (37%), Positives = 211/371 (56%), Gaps = 14/371 (3%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYD 75
            K+ RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +       +G CC+   V D
Sbjct: 2   KKNNRVVVGMSGGVDSSVSAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEGGCCSLSAVND 61

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           ARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     
Sbjct: 62  ARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWM 121

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  
Sbjct: 122 IEAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKY 178

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           KK+ VR LA+++GL +A K DSQ+ICFV    Y   ++         G+     G+ LG 
Sbjct: 179 KKDEVRKLAKDLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGY 238

Query: 256 HNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL 315
           H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +     N++    
Sbjct: 239 HKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDELISYNNNFISI-- 296

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNE 374
             D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+ VFY  D   
Sbjct: 297 --DKLEGEMRVKAKIRYTAKEQDAVIRPLEDGKVFVKFDSPQRAITPGQSVVFYDGDI-- 352

Query: 375 ARVLGGGIISG 385
             V+GGGII  
Sbjct: 353 --VVGGGIIER 361


>gi|238796003|ref|ZP_04639515.1| tRNA-specific 2-thiouridylase mnmA [Yersinia mollaretii ATCC 43969]
 gi|238720208|gb|EEQ12012.1| tRNA-specific 2-thiouridylase mnmA [Yersinia mollaretii ATCC 43969]
          Length = 373

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 124/382 (32%), Positives = 194/382 (50%), Gaps = 28/382 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A  D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVAGLFMKNWEEDDGEE---YCSAATDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L      
Sbjct: 60  QAVCDKLGMELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAED 119

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+  + +QL    FP+G++
Sbjct: 120 LGADYIATGHYVRRQ-----DVNGKSRLLRGLDGNKDQSYFLYTLSHEQLAQSLFPVGEL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A ++ L  A K DS  ICF+ + K+ D + R     A  G I+ ++GQ +G 
Sbjct: 175 EKPEVRRIAEQLDLVTAKKKDSTGICFIGERKFRDFLGRYLP--AQPGPIMTVDGQHMGE 232

Query: 256 HNGIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG         +P +VV  D  ++ ++V             +  ++
Sbjct: 233 HQGLMYHTLGQRKGLGIGGTKDGGDDPWYVVDKDVANNILLVAQGHEHPRLMSVGLIAQQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        +   F+C VK R  Q  +P  V   DD  V V F+     V  GQ+ V
Sbjct: 293 LHWVD----RQPITAAFRCVVKTRYRQQDIPCTVTPLDDERVEVRFDDPVAAVTPGQSAV 348

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
           FY  +      LGGGII     
Sbjct: 349 FYQGEV----CLGGGIIEERYP 366


>gi|331085021|ref|ZP_08334108.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330408721|gb|EGG88186.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 357

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 137/367 (37%), Positives = 207/367 (56%), Gaps = 15/367 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDAR 77
             +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++        +  G CC    V DAR
Sbjct: 2   KKKVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDRAVEEENGGCCGLSAVDDAR 61

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV   + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +G
Sbjct: 62  RVAAALEIPYYVMNFKKEFKEKVIDYFVQEYLHGRTPNPCIACNRYVKWESLLKRSMDIG 121

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD +ATGHY R           R  +     L +DQ+Y L+  TQ+QL     P+G+  K
Sbjct: 122 ADYIATGHYARVVQL----ENGRYTLKCSATLAKDQTYALYNLTQEQLKRTLMPVGEYTK 177

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           + VR++A ++ L IA+K DSQDICFV  G Y   ++   A    EG+ V L+G++LGRH 
Sbjct: 178 DQVREIAEKINLRIANKPDSQDICFVPDGDYASFIEEEAAVKIPEGNFVDLDGRVLGRHK 237

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI +YT+GQR+GLG+++G P FV+ +   ++ +++G  E    + +   ++N++      
Sbjct: 238 GITHYTVGQRKGLGLSLGHPAFVLEIRPETNEIVIGSNEDSMSYTLRANQLNFMSI---- 293

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           + +    + + KIR +       ++++  D V   FE+ +  +  GQA VFY  +     
Sbjct: 294 EDLTGEMRVWTKIRYNHKGAWCTIRKSGKDEVTCTFEEPQRAITPGQAVVFYDGE----Y 349

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 350 VVGGGTI 356


>gi|312881247|ref|ZP_07741045.1| tRNA-specific 2-thiouridylase MnmA [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309371139|gb|EFP98593.1| tRNA-specific 2-thiouridylase MnmA [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 369

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 123/380 (32%), Positives = 187/380 (49%), Gaps = 28/380 (7%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
               +V+V MSGGVDSSV A LLK+ GY V G+ ++ +           C A +D+ DA+
Sbjct: 4   NSKKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDNED---YCTAAEDLADAQ 60

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQL 136
            VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      L
Sbjct: 61  AVCDKLGIHLHTINFAAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLDFADDVL 120

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            AD +A GHY+R      D    +  M R +D  +DQSYFL+  + +Q+    FP+G+++
Sbjct: 121 EADYIAMGHYVRRSCIESDQ---KPQMLRGLDGNKDQSYFLYTLSHEQIGRSLFPVGELE 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A E GL  A K DS  ICF+ + K+ D + +     A  G I    G+ +G H
Sbjct: 178 KPEVRRIAEEQGLITAKKKDSTGICFIGERKFTDFLSKYLP--AQPGKIETPEGKEIGEH 235

Query: 257 NGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRIYLR 306
            G++ +T+GQR+GL            EP +V   D   + +I              +   
Sbjct: 236 QGLMYHTLGQRKGLHIGGQKGGGGNEEPWYVADKDLKRNVLIAVQGADHPLLKSEGLIAS 295

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
           +++W+        +V   KC VK R  Q+ +P  +   D+G + V F+  +V V  GQ+ 
Sbjct: 296 QLHWVD----RSPLVSEIKCSVKTRYRQNDIPCTIVPIDNGSIKVIFDNPQVAVTPGQSA 351

Query: 366 VFYTSDSNEARVLGGGIISG 385
           VFY  D      LGGGII  
Sbjct: 352 VFYQGDV----CLGGGIIEE 367


>gi|327480910|gb|AEA84220.1| tRNA-specific 2-thiouridylase MnmA [Pseudomonas stutzeri DSM 4166]
          Length = 362

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 126/374 (33%), Positives = 194/374 (51%), Gaps = 26/374 (6%)

Query: 24  VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI 83
           +V MSGGVDSSV A LL   GY V G+ ++ +     ++    C A +D+ DA+ VCD I
Sbjct: 2   IVGMSGGVDSSVSALLLLEQGYQVEGLFMKNWEEDDGTE---YCTAKEDLADAQAVCDRI 58

Query: 84  NVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLAT 143
            +  +  ++   + + V   F + Y AG TP P + CNR +KF   L     LGAD++AT
Sbjct: 59  GIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYALMLGADLIAT 118

Query: 144 GHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDL 203
           GHY+R R     D   R  + + +D  +DQSYFL A   +QL    FP+G+++K  VR +
Sbjct: 119 GHYVRRR-----DRDGRSELLKGLDPNKDQSYFLHAVGGEQLAKTLFPVGELEKPEVRAI 173

Query: 204 AREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYT 263
           A + GL  A K DS  ICF+ + ++ D +K+     A  G+I  ++G+++GRH+G++ +T
Sbjct: 174 AEKHGLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGNIETVDGEVIGRHHGLMYHT 231

Query: 264 IGQRRGLGVA-----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWLGDGL 315
           IGQR+GLG+        EP +V+  D   + +IV        L    +   EI W+    
Sbjct: 232 IGQRQGLGIGGLKDASDEPWYVLSKDLQRNVLIVGQGNDHPWLFSRALLASEIYWVNPV- 290

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
               +    K   K+R  Q      +++  DG    FE  +  V  GQ+ VFY  +    
Sbjct: 291 ---DLSAPLKLTAKVRYRQSDQACTLEQTSDGYRAVFEVPQRAVTPGQSVVFYDGEV--- 344

Query: 376 RVLGGGIISGSKRS 389
             LGGG+I  ++  
Sbjct: 345 -CLGGGVIEQAEPW 357


>gi|319892675|ref|YP_004149550.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Staphylococcus pseudintermedius HKU10-03]
 gi|317162371|gb|ADV05914.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Staphylococcus pseudintermedius HKU10-03]
 gi|323464287|gb|ADX76440.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus pseudintermedius ED99]
          Length = 370

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 133/380 (35%), Positives = 195/380 (51%), Gaps = 22/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
              ++ RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MTNQNTRVVVGMSGGVDSSVTAHLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R R +          M R +D  +DQ+YFL   T+ QL  + FP+GD+
Sbjct: 118 LGADYVATGHYARVRHH----EDGSVEMLRGVDNNKDQTYFLNQLTEAQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K+ VR++A E  L  A K DS  ICF+ +  +   + +     A  G++  LNG++ G+
Sbjct: 174 DKQKVREIALEQDLATAKKKDSTGICFIGERNFKTFLSQYLP--AQPGEMRTLNGELKGQ 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H G++ YTIGQR GLG+   G+P FVV  +   + + V             +   +++++
Sbjct: 232 HGGLMYYTIGQRHGLGIGGDGDPWFVVGKNLEDNILYVEQGFHHDALYSDYLIASDVSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTS 370
                   + +  KC  K R  Q  V V V  + DD V V F++    +  GQA VFY  
Sbjct: 292 N----ATDLTEPLKCTAKFRYRQKDVGVTVTAHGDDAVKVTFDEPVRAITPGQAVVFYDG 347

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    + D
Sbjct: 348 DV----CLGGATIDDVYKKD 363


>gi|255975449|ref|ZP_05426035.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T2]
 gi|256961498|ref|ZP_05565669.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis Merz96]
 gi|293385188|ref|ZP_06631008.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis R712]
 gi|293388180|ref|ZP_06632702.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis S613]
 gi|307277736|ref|ZP_07558822.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0860]
 gi|312908274|ref|ZP_07767238.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis DAPTO 512]
 gi|312910654|ref|ZP_07769495.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis DAPTO 516]
 gi|255968321|gb|EET98943.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T2]
 gi|256951994|gb|EEU68626.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis Merz96]
 gi|291077561|gb|EFE14925.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis R712]
 gi|291082420|gb|EFE19383.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis S613]
 gi|306505615|gb|EFM74799.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0860]
 gi|310625688|gb|EFQ08971.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis DAPTO 512]
 gi|311289030|gb|EFQ67586.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis DAPTO 516]
          Length = 374

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 196/380 (51%), Gaps = 26/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V D I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L    QL
Sbjct: 60  AKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R +D  +DQ+YFL   +Q QL    FPLG M+
Sbjct: 120 GADYVATGHYAQVET----DENGVVHMLRGIDNNKDQTYFLSQLSQTQLAKTMFPLGGME 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  +CF+ +  + + +       A +G++V  +G+I G+H
Sbjct: 176 KSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLP--AKKGNMVTEDGEIKGQH 233

Query: 257 NGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FV+  D  ++ + V      E L    +   E++
Sbjct: 234 DGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           +  D      +   F C  K R  Q  +PV V  ++DG    V F++    V  GQA VF
Sbjct: 294 FTVD----TPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y         LGGG+I  + 
Sbjct: 350 YDG----MECLGGGLIDRAY 365


>gi|22538278|ref|NP_689129.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae 2603V/R]
 gi|25012138|ref|NP_736533.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus agalactiae
           NEM316]
 gi|76798859|ref|ZP_00781068.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae 18RS21]
 gi|77406508|ref|ZP_00783561.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae H36B]
 gi|77408912|ref|ZP_00785637.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae COH1]
 gi|54039756|sp|P66979|MNMA_STRA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|54042260|sp|P66978|MNMA_STRA3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|22535193|gb|AAN01002.1|AE014289_2 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae 2603V/R]
 gi|24413682|emb|CAD47762.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76585782|gb|EAO62331.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae 18RS21]
 gi|77172503|gb|EAO75647.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae COH1]
 gi|77174880|gb|EAO77696.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae H36B]
          Length = 373

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 196/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  ++RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSNIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQV----TRDENGIVHMLRGADNNKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  + D + +     A  G ++ ++G+ +G 
Sbjct: 175 QKPEVRRIAEEAGLATAKKKDSTGICFIGEKNFKDFLGQYLP--AQPGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +   E
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNKPWFVVGKDLSKNILYVGQGFYHDSLMSTSLTASE 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V    +   V F+  +  +  GQA VF
Sbjct: 293 IHFTRDMPNE----FKLECTAKFRYRQPDSKVTVYVKGNQARVVFDDLQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y    NE   LGGG+I  + R D +
Sbjct: 349 Y----NEQECLGGGMIDQAYRDDKI 369


>gi|117617943|ref|YP_855954.1| tRNA-specific 2-thiouridylase MnmA [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166234841|sp|A0KI53|MNMA_AERHH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|117559350|gb|ABK36298.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 368

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 122/378 (32%), Positives = 198/378 (52%), Gaps = 27/378 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   ++V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A QD+ D
Sbjct: 2   TDNSQIKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDTDE---YCSAAQDLAD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L     
Sbjct: 59  AKAVCDKLGMKLHTINFAAEYWDNVFEHFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAE 118

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           +LGA  +ATGHY+R      DD   R  + R +D  +DQSYFL+  ++ Q+    FP+GD
Sbjct: 119 ELGATYIATGHYVRR-----DDSTGRPRLLRGLDTNKDQSYFLYTLSEAQVGQSLFPVGD 173

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A ++ L  A K DS  ICF+ + K+ D + +     A  G I  ++G+++G
Sbjct: 174 LEKPEVRRIAEQLDLITAKKKDSTGICFIGERKFKDFLAKFLP--AQPGPIETVDGKVIG 231

Query: 255 RHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGPRESL--EVHRIYLRE 307
            H G++ +T+GQR+GLG+        E  +VV  +   + ++V   E        +   +
Sbjct: 232 EHQGLMYHTLGQRKGLGIGGRKDATEEAWYVVDKEVERNTLVVAQGEHPRLYSDGLIASQ 291

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+        +    +C VK R  Q+ +P  +Q  DD  + V F++ +  V  GQ+ V
Sbjct: 292 LHWVD----RTPIRAPRRCTVKTRYRQEDIPCLIQPIDDETIRVIFDEKQAAVTPGQSAV 347

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 348 FYDGEV----CLGGGIIE 361


>gi|209695634|ref|YP_002263563.1| tRNA-specific 2-thiouridylase MnmA [Aliivibrio salmonicida LFI1238]
 gi|208009586|emb|CAQ79882.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Aliivibrio salmonicida LFI1238]
          Length = 374

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 118/383 (30%), Positives = 191/383 (49%), Gaps = 27/383 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 3   DNSQKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEEDDNEE---YCTAAEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ- 135
           + VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L    + 
Sbjct: 60  QAVCDKLGIHLHTINFAAEYWDNVFEYFLEEYKAGRTPNPDILCNKEIKFKAFLEFADEV 119

Query: 136 LGADVLATGHYIRSRLYVGDD--GKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           L AD +A GHY+R      +D     +  M R +D  +DQSYFL+  + +Q+    FP+G
Sbjct: 120 LDADFIAMGHYVRRTFPTAEDIANGAKPQMLRGLDSNKDQSYFLYTLSSEQVARSLFPVG 179

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           D++K  VR +A+E  L  A K DS  ICF+ + K+ + + +     A  G+I    G+++
Sbjct: 180 DLEKPEVRRIAQEQDLITAKKKDSTGICFIGERKFTEFLGKYLP--AQPGNIETPEGKVI 237

Query: 254 GRHNGIINYTIGQRRGLG-------VAMGEPLFVVYLDKNSSRVIVGPRESLE---VHRI 303
           G+H G++ +T+GQR+GL            +P FV   D   + +I              +
Sbjct: 238 GQHQGLMYHTLGQRKGLHIGGSKGGGGNEDPWFVGEKDLKRNVLIAVQGHDHPLLKSQGL 297

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASG 362
              +++W+       A+     C VK R  Q  +P  +   DD  + V F + ++ V  G
Sbjct: 298 LASQLDWVD----RTAIKAPLSCTVKTRYRQTDIPCTIIPIDDENIKVIFNEPQIAVTPG 353

Query: 363 QACVFYTSDSNEARVLGGGIISG 385
           Q+ VFY+ +      LGGGII  
Sbjct: 354 QSAVFYSGEI----CLGGGIIEE 372


>gi|315221594|ref|ZP_07863514.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus anginosus F0211]
 gi|315189428|gb|EFU23123.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus anginosus F0211]
          Length = 373

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 130/384 (33%), Positives = 196/384 (51%), Gaps = 25/384 (6%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
              RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D   
Sbjct: 5   SKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDVAA 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     LGA
Sbjct: 62  VADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLGA 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R++     D      M R +D  +DQ+YFL   +Q+QL    FPLG ++K 
Sbjct: 122 DYVATGHYARAKR----DEDGIVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKS 177

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A + GL  A K DS  ICF+ +  + + +       A  G ++ ++G+ +G H G
Sbjct: 178 EVRAIAEKAGLATAKKKDSTGICFIGEKNFKEFLGNYLP--AQPGRMMTVDGRDMGEHAG 235

Query: 259 IINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++++
Sbjct: 236 LMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQVHF 295

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
             +   E       +C  K R  Q    V V    D   V+F + +  +  GQA VFY  
Sbjct: 296 TREIPAE----FTMECTAKFRYRQPDSKVTVTVKGDKAIVNFAEPQRAITPGQAVVFYDE 351

Query: 371 DSNEARVLGGGIISGSKRSDAVEE 394
           +      LGGG+I  + +   +++
Sbjct: 352 E----ECLGGGLIDNAYKDGKLQQ 371


>gi|119386805|ref|YP_917860.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paracoccus denitrificans PD1222]
 gi|205816904|sp|A1B9H0|MNMA_PARDP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|119377400|gb|ABL72164.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paracoccus denitrificans PD1222]
          Length = 389

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 190/382 (49%), Positives = 247/382 (64%), Gaps = 14/382 (3%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           + +NSL   K P   RVVVAMSGGVDSSVVAA+L   GYDVIGVTLQLY+   A  +KG+
Sbjct: 15  STVNSLGFPKPPAQTRVVVAMSGGVDSSVVAAMLAAQGYDVIGVTLQLYDHGAALAKKGA 74

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD++DARRV + I   HYV DYE +FR +VI  FA +Y AG TP+PC+ CN  VKF
Sbjct: 75  CCAGQDIHDARRVAERIGFPHYVLDYENKFRESVIEEFADAYLAGATPVPCIRCNERVKF 134

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL   R+L AD +ATGHYIR  +     G +   +    D  RDQSYFLF+TTQ+QL 
Sbjct: 135 RDLLQTARELDADCMATGHYIRRLM-----GPKGAELHMAADPARDQSYFLFSTTQEQLD 189

Query: 187 DLRFPLGD-MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
            LRFPLG    K   R LA + GL +ADK DSQDICFV  G Y  V++++  G A  G+I
Sbjct: 190 FLRFPLGGLASKAETRALAAQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGAADPGEI 249

Query: 246 VHLNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           V ++G +LG H G+I+YTIGQ R      +G+PL+VV L+ ++ RV+VGP+++L    + 
Sbjct: 250 VDMDGNVLGSHRGVIHYTIGQRRGLGIGGLGDPLYVVRLEPDTRRVVVGPKQALATKIVP 309

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQ 363
           + E+NWLGD  FED +        +IRS++ P P  ++        ++    E GV+ GQ
Sbjct: 310 VTEVNWLGDEPFEDEIA----VTARIRSTRPPRPAILRVTGKHRAEIELLDPEEGVSPGQ 365

Query: 364 ACVFYTSDSNEARVLGGGIISG 385
           ACVFY   +  +RVLGGG IS 
Sbjct: 366 ACVFYA--TEGSRVLGGGWISH 385


>gi|119775197|ref|YP_927937.1| tRNA-specific 2-thiouridylase MnmA [Shewanella amazonensis SB2B]
 gi|205816912|sp|A1S7B1|MNMA_SHEAM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|119767697|gb|ABM00268.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Shewanella amazonensis SB2B]
          Length = 377

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 124/378 (32%), Positives = 191/378 (50%), Gaps = 28/378 (7%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
                +V+V MSGGVDSSV A LLK+ GY V G+ ++ +      +    C A +D+ DA
Sbjct: 13  ANSSKKVIVGMSGGVDSSVSAYLLKQQGYQVEGLFMKNWEEDDTDE---YCAAAEDLKDA 69

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQ 135
           + VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L      
Sbjct: 70  QAVCDKLGIKLHTVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLEFADDI 129

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           L AD +A GHY+R R     D   +  M R +D  +DQSYFL+  + +Q+    FP+G++
Sbjct: 130 LDADYIAMGHYVRRR-----DTDGKTEMLRGIDGNKDQSYFLYTLSHEQVARSLFPVGEL 184

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL   DK DS  ICF+ + K+ D +       A  G+I    G I+GR
Sbjct: 185 EKPEVRRIAEEQGLITHDKKDSTGICFIGERKFKDFLATYLP--AQPGNIETPEGDIIGR 242

Query: 256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           H G++ +T+GQR+GLG+        +P +VV  D   + ++V             + + +
Sbjct: 243 HEGLMYHTLGQRKGLGIGGMKNSNDDPWYVVDKDMARNVLVVAQGHEHPRLMSKGMRVNQ 302

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACV 366
           ++W+          DG    VK R  Q  +P  V+  D+  + V F++    V  GQ+ V
Sbjct: 303 LHWVD----RTGPADGATISVKTRYRQQDIPCTVKIIDEQTIEVLFDEPVAAVTPGQSAV 358

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  +      LGGGII 
Sbjct: 359 FYDGEV----CLGGGIID 372


>gi|297584733|ref|YP_003700513.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus selenitireducens MLS10]
 gi|297143190|gb|ADH99947.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bacillus selenitireducens MLS10]
          Length = 371

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 137/384 (35%), Positives = 208/384 (54%), Gaps = 23/384 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           ++ +K P+D R+VV MSGGVDSSV A LLK  GY+VIG+ ++ ++    +   G C A +
Sbjct: 1   MNNEKRPEDTRIVVGMSGGVDSSVTAHLLKEQGYEVIGIFMKNWDD---TDEFGVCTATE 57

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D  D  RVC+ +++ +Y  ++E+++ + V   F   Y +G TP P V CN+ +KF   L 
Sbjct: 58  DYEDVIRVCNQLDIPYYAVNFEKQYWDKVFTYFLDEYKSGRTPNPDVMCNKEIKFKAFLD 117

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
               LGAD +ATGHY +              + R  D  +DQ+YFL A +Q QL  + FP
Sbjct: 118 HAMTLGADYVATGHYAKVSHTPD-----GVKLLRGKDRNKDQTYFLNALSQDQLRHVLFP 172

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LGD++K  VR++A E GL  A K DS  ICF+ +  + + +       A  G++  L+G+
Sbjct: 173 LGDIEKPRVREIAEEAGLATAGKKDSTGICFIGERNFKEFLSEYLP--AQPGNMETLDGE 230

Query: 252 ILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
           + G H+G++ YT+GQR+GLG+   GEP FV+  D + + ++VG            +    
Sbjct: 231 VKGTHDGLMYYTLGQRQGLGIGGSGEPWFVIDKDLSRNVLLVGQGFHHPALYSEGLKADG 290

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACV 366
           +NW+       A  + F C VK R  Q      V    DG V + F+++E  V  GQA V
Sbjct: 291 VNWVAGS----APAERFHCTVKTRYRQQDRGATVTVEPDGSVTLMFDEAERAVTPGQAVV 346

Query: 367 FYTSDSNEARVLGGGIISGSKRSD 390
           FY  +      LGGG I+   +S+
Sbjct: 347 FYDDEI----CLGGGTINERIKSE 366


>gi|24638305|sp|Q8NZ00|MNMA_STRP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 373

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 194/384 (50%), Gaps = 25/384 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   +RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLGYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + +     D      M R  D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQVKR----DENGTVHMLRGADNGKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A   GL  A K DS  ICF+ +  +   + +     A +G ++ ++G+ +G 
Sbjct: 175 QKSEVREIAERAGLATAKKKDSTGICFIGEKNFKQFLSQYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      E+L  + +    
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNQPWFVVGKDLSQNILYVGQGFYHEALMSNSLDASV 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  +   E      F+C  K R  Q    V V    D   V F + +  +  GQA VF
Sbjct: 293 IHFTREMPEE----FTFECTAKFRYRQPDSQVTVHVRGDKAEVVFAEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDA 391
           Y         LGGG+I  + ++  
Sbjct: 349 YDG----KECLGGGMIDMAYKNGQ 368


>gi|191638296|ref|YP_001987462.1| tRNA-specific 2-thiouridylase MnmA [Lactobacillus casei BL23]
 gi|190712598|emb|CAQ66604.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactobacillus casei BL23]
 gi|327382323|gb|AEA53799.1| tRNA-specific 2-thiouridylase mnmA [Lactobacillus casei LC2W]
 gi|327385523|gb|AEA56997.1| tRNA-specific 2-thiouridylase mnmA [Lactobacillus casei BD-II]
          Length = 443

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 131/379 (34%), Positives = 187/379 (49%), Gaps = 25/379 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +  ++RVVV MSGGVDSSV A LLK+ GYDV+GV ++ ++    +   G C A  D  D 
Sbjct: 73  DNSNIRVVVGMSGGVDSSVTALLLKQQGYDVVGVFMKNWDD---TDENGVCTATTDYEDV 129

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V   I + +Y  ++E+ + + V   F   Y AG TP P V CN+ +KF   L    QL
Sbjct: 130 AKVASEIGIPYYSINFEKEYWDRVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLDYADQL 189

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            AD +A GHY + +     D      M R  D  +DQ+YFL   +Q QL    FP+G ++
Sbjct: 190 NADYIAMGHYAQVKT----DENGIVHMLRGADGNKDQTYFLSQLSQDQLKKSLFPIGHLQ 245

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  +   +       A  G ++ ++G  +G H
Sbjct: 246 KPEVRKIAEAAGLATAKKKDSTGICFIGERNFKQFLSTYLP--AQPGKMMTVDGVEMGTH 303

Query: 257 NGIINYTIGQRRGLGVAMG----EPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FVV  D + + + V       +L    +    +N
Sbjct: 304 DGLMYYTIGQRQGLGIGGNSDNSEPWFVVGKDLDKNILYVGQGFDNPALMATSLSASNLN 363

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W        A  +G     K R  Q    V +  +DDG   VDF+     +  GQA VFY
Sbjct: 364 WTTG----QAPAEGTHMTAKFRYRQRDTGVTLHYHDDGTATVDFDVPVRAITPGQAVVFY 419

Query: 369 TSDSNEARVLGGGIISGSK 387
             D      LGGG I  + 
Sbjct: 420 DGD----ECLGGGTIDAAY 434


>gi|116511650|ref|YP_808866.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. cremoris SK11]
 gi|116107304|gb|ABJ72444.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lactococcus lactis subsp. cremoris SK11]
          Length = 384

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 137/386 (35%), Positives = 192/386 (49%), Gaps = 26/386 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           K+P   RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 12  KSPAQTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDENGVCTATEDYKD 68

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I V +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L    +
Sbjct: 69  VAAVADQIGVPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAME 128

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY + R     D      M R  D  +DQ+YFL   TQ+QL    FPLG +
Sbjct: 129 LGADYVATGHYAQVRT----DEDGTVHMLRGADNNKDQTYFLSQLTQEQLKKTMFPLGHL 184

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A + GL  A K DS  ICF+ +  +   +       A  G ++ L+G  +G 
Sbjct: 185 EKPEVRRIAEKAGLATAKKKDSTGICFIGEKNFKKFLGEYLP--AQPGKMMTLDGVEMGN 242

Query: 256 HNGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLR 306
           H G++ YTIGQR GLG+         +P FVV  D  ++ + V      E L    +   
Sbjct: 243 HAGLMYYTIGQRGGLGIGGQHGQLTSDPWFVVGKDLTTNTLYVGQGFHHEHLYSTSLDAS 302

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++++      E        C  K R  Q+   V +    D V VDF++    +  GQA V
Sbjct: 303 DLSFTR----EMPETFDLHCTAKFRYRQEDTGVTIHVKADKVTVDFDEPVRAITPGQAVV 358

Query: 367 FYTSDSNEARVLGGGIISGSKRSDAV 392
           FY  +      LGG +I  + +   V
Sbjct: 359 FYDGE----ECLGGAMIDVAYKEQKV 380


>gi|326390968|ref|ZP_08212518.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993010|gb|EGD51452.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 144/390 (36%), Positives = 217/390 (55%), Gaps = 17/390 (4%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           +     RL +  + KN    RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +   
Sbjct: 1   MRESTRRLKNFFMKKNN---RVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEE 57

Query: 62  KR--KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD 119
               +G CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ 
Sbjct: 58  AVRVEGGCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIA 117

Query: 120 CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA 179
           CN+ +KF +LL     + A  +ATGHY        D+ +RR ++ + +D  +DQ+Y L+ 
Sbjct: 118 CNKYIKFEELLKRAWMIDAYYVATGHYAIKEY---DEERRRYLLKKSVDTSKDQTYVLYN 174

Query: 180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            TQ QL  + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++      
Sbjct: 175 LTQTQLEHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEE 234

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLE 299
              G+     G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + + 
Sbjct: 235 IKPGEFRDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVF 294

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVG 358
              +     N++      D +    +   KIR +       ++  +DG V+V F+  +  
Sbjct: 295 GDELISYNNNFISI----DKLEGEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRA 350

Query: 359 VASGQACVFYTSDSNEARVLGGGIISGSKR 388
           +  GQ+ VFY  D     V+GGG I    R
Sbjct: 351 ITPGQSVVFYDGDI----VVGGGTIERKVR 376


>gi|167626941|ref|YP_001677441.1| tRNA-specific 2-thiouridylase MnmA [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189040504|sp|B0TW32|MNMA_FRAP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|167596942|gb|ABZ86940.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 359

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 129/374 (34%), Positives = 200/374 (53%), Gaps = 26/374 (6%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           ++ +++V +SGGVDSSV A LLK+ GYDV GV ++ +      +    C A Q + DA+ 
Sbjct: 2   QNNKIIVGISGGVDSSVSALLLKQQGYDVTGVFMKNWEEDDTDE---FCSAEQHIADAQA 58

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           VCD+I +     ++   + + V   F + Y AG TP P + CN+ +KF   LS    LG 
Sbjct: 59  VCDSIGIPFKKINFAAEYWDNVFEHFLTEYKAGRTPNPDILCNKEIKFKAFLSYVHLLGG 118

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++           + + +D  +DQ+YFL+   Q+QL    FP+GD++K 
Sbjct: 119 DYIATGHYARTKVIDD----GSVQLVKGLDDSKDQTYFLYTLGQEQLKQTMFPIGDIEKS 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++A+E  L   DK DS  ICF+ + K+ D + +     A +G+I   NG  +G H+G
Sbjct: 175 RVREIAKENNLVTFDKKDSTGICFIGERKFKDFLSKFLP--AQKGEIHDENGIKIGMHDG 232

Query: 259 IINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YTIGQR+GLG+         P F    D  ++ +I         L    +   +++W
Sbjct: 233 LMYYTIGQRQGLGIGGVKNRPEIPWFAAQKDLENNVLIAVQGHDHPMLFKDTLQAIDLSW 292

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYT 369
           +       A  D F+C  K+R  Q   P  V+ N+DG V V F++ +  +  GQ+ VFY 
Sbjct: 293 VAGS----APADSFRCSAKVRYRQKDQPCSVEVNNDGSVNVVFDEPQRAITPGQSVVFYD 348

Query: 370 SDSNEARVLGGGII 383
           +D      LGGGII
Sbjct: 349 NDV----CLGGGII 358


>gi|88798697|ref|ZP_01114280.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Reinekea sp. MED297]
 gi|88778460|gb|EAR09652.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Reinekea sp. MED297]
          Length = 364

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 125/380 (32%), Positives = 187/380 (49%), Gaps = 26/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +  + +V+V MSGGVDSSV AALL   GY V G+ ++ ++    ++    C A +D+ DA
Sbjct: 3   SNSETKVIVGMSGGVDSSVTAALLLEQGYQVEGLFMKNWDEDDGTE---YCTAKEDLADA 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           + V D + +  +  ++   + + V   F   Y AG TP P + CNR +KF   L     L
Sbjct: 60  QAVADRLGIHLHKANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLEYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R+     D    +  + R  D  +DQ+YFL A   +Q     FP+G+++
Sbjct: 120 GADKIATGHYART-----DTMNGKGRLLRGNDHNKDQTYFLHAVGHEQFEKTLFPVGELE 174

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A +  L  A K DS  ICF+ + ++ D +K+     A  G IV L G++LG H
Sbjct: 175 KPQVRAIAEKYKLATAKKKDSTGICFIGERRFSDFLKQYLP--AQPGKIVTLEGEVLGDH 232

Query: 257 NGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREIN 309
            G++ YTIGQR+GLG+        P FV   +  ++ ++V             + L  I 
Sbjct: 233 QGLMYYTIGQRQGLGIGGTRHGEAPWFVAQKNLATNELVVVQGTDHPALFTTYMSLNNIY 292

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+ D   E  V        K R  Q      + RN  G   V F + +  +  GQ+ VFY
Sbjct: 293 WVDDTGPELPVT----LACKHRYRQPDQSCELSRNAQGEYQVTFHEPQRAITPGQSAVFY 348

Query: 369 TSDSNEARVLGGGIISGSKR 388
             D      LGGG+I  +  
Sbjct: 349 LGDV----CLGGGVIETTWN 364


>gi|154503928|ref|ZP_02040988.1| hypothetical protein RUMGNA_01754 [Ruminococcus gnavus ATCC 29149]
 gi|153795527|gb|EDN77947.1| hypothetical protein RUMGNA_01754 [Ruminococcus gnavus ATCC 29149]
          Length = 356

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 141/365 (38%), Positives = 206/365 (56%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   +  A +  G CC    V DARRV
Sbjct: 3   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEEQAAQEENGGCCGLSAVDDARRV 62

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GA+
Sbjct: 63  AAALEIPYYVMNFKKEFKENVIDYFVEEYQNGRTPNPCIACNRYVKWESLLQRSLSIGAE 122

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R           R  + R   L +DQ+Y L+  TQ+QL     P+G   K+ 
Sbjct: 123 YIATGHYARVVQL----ENGRYTLRRSATLAKDQTYALYNLTQEQLKRTLMPVGKYTKDE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A ++ L IA+K DSQDICFV  G Y   ++        EG+ V  +G +LGRH GI
Sbjct: 179 VRAIAEKINLRIANKPDSQDICFVPDGDYAAYIEEEAGVKVPEGNFVLTDGTVLGRHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YT+GQR+GLG+A+G P FV+ +   ++ V++G +E     ++  R +N++      + 
Sbjct: 239 THYTVGQRKGLGLALGYPAFVLEIRPETNEVVIGTKEESMTTQLRARNLNFMA----VED 294

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + +    F KIR +       +++  +D V   F++ +  V  GQA VFY  +     VL
Sbjct: 295 LTEPLHVFTKIRYNHKGAWCTIEKTGEDEVLCTFDEPQRAVTPGQAVVFYDGE----YVL 350

Query: 379 GGGII 383
           GGG I
Sbjct: 351 GGGTI 355


>gi|29376579|ref|NP_815733.1| tRNA-specific 2-thiouridylase MnmA [Enterococcus faecalis V583]
 gi|227520188|ref|ZP_03950237.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0104]
 gi|227555378|ref|ZP_03985425.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis HH22]
 gi|256762940|ref|ZP_05503520.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T3]
 gi|256853584|ref|ZP_05558949.1| tRNA-specific 2-thiouridylase mnmA [Enterococcus faecalis T8]
 gi|257079445|ref|ZP_05573806.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis JH1]
 gi|257087270|ref|ZP_05581631.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis D6]
 gi|257090346|ref|ZP_05584707.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis CH188]
 gi|257419691|ref|ZP_05596685.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T11]
 gi|257422150|ref|ZP_05599140.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis X98]
 gi|294780347|ref|ZP_06745716.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis PC1.1]
 gi|307270242|ref|ZP_07551555.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX4248]
 gi|307295656|ref|ZP_07575491.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0411]
 gi|312900841|ref|ZP_07760135.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0470]
 gi|312902847|ref|ZP_07762051.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0635]
 gi|73920123|sp|Q820U1|MNMA_ENTFA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|29344043|gb|AAO81803.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis V583]
 gi|227072360|gb|EEI10323.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0104]
 gi|227175492|gb|EEI56464.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis HH22]
 gi|256684191|gb|EEU23886.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T3]
 gi|256710527|gb|EEU25570.1| tRNA-specific 2-thiouridylase mnmA [Enterococcus faecalis T8]
 gi|256987475|gb|EEU74777.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis JH1]
 gi|256995300|gb|EEU82602.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis D6]
 gi|256999158|gb|EEU85678.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis CH188]
 gi|257161519|gb|EEU91479.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis T11]
 gi|257163974|gb|EEU93934.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis X98]
 gi|294452611|gb|EFG21044.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis PC1.1]
 gi|306496368|gb|EFM65945.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0411]
 gi|306513458|gb|EFM82077.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX4248]
 gi|310633901|gb|EFQ17184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0635]
 gi|311291940|gb|EFQ70496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0470]
 gi|315025815|gb|EFT37747.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX2137]
 gi|315028590|gb|EFT40522.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX4000]
 gi|315031109|gb|EFT43041.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0017]
 gi|315149261|gb|EFT93277.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0012]
 gi|315157187|gb|EFU01204.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0043]
 gi|315171619|gb|EFU15636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX1342]
 gi|315173202|gb|EFU17219.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX1346]
 gi|315575062|gb|EFU87253.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0309B]
 gi|315576621|gb|EFU88812.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0630]
 gi|315582488|gb|EFU94679.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis TX0309A]
 gi|327535526|gb|AEA94360.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis OG1RF]
          Length = 374

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 196/380 (51%), Gaps = 26/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V D I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L    QL
Sbjct: 60  AKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R +D  +DQ+YFL   +Q QL    FPLG M+
Sbjct: 120 GADYVATGHYAQVET----DENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGME 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  +CF+ +  + + +       A +G++V  +G+I G+H
Sbjct: 176 KSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLP--AKKGNMVTEDGEIKGQH 233

Query: 257 NGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FV+  D  ++ + V      E L    +   E++
Sbjct: 234 DGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           +  D      +   F C  K R  Q  +PV V  ++DG    V F++    V  GQA VF
Sbjct: 294 FTVD----TPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y         LGGG+I  + 
Sbjct: 350 YDG----MECLGGGLIDRAY 365


>gi|188534099|ref|YP_001907896.1| tRNA-specific 2-thiouridylase MnmA [Erwinia tasmaniensis Et1/99]
 gi|188029141|emb|CAO97013.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erwinia tasmaniensis Et1/99]
          Length = 369

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 119/379 (31%), Positives = 195/379 (51%), Gaps = 28/379 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ D
Sbjct: 1   MSNSQKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEE---YCTAAEDLAD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F   Y AG TP P + CN+ +KF   L     
Sbjct: 58  AQAVCDKLGIYLHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAE 117

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY+R +     D   +  + R +D  +DQSYFL+    +Q+    FP+G+
Sbjct: 118 DLGADYIATGHYVRRQ-----DVDGKSRLLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGE 172

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           + K  VR +A ++ L  A K DS  ICF+ + K+ + + R     A  G I+ ++G  +G
Sbjct: 173 LAKPEVRRIAEQLELVTAKKKDSTGICFIGERKFTEFLSRYLP--AQPGPILSVDGDNVG 230

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           +H G++ +T+GQR+GLG+        +P +VV  D  ++ ++V             +  +
Sbjct: 231 QHQGLMYHTLGQRKGLGIGGRKEANDDPWYVVDKDVANNVLVVAQGHEHPRLMSTGLIAQ 290

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQAC 365
           +++W+      D++    +C VK R  Q  +P  V   D + + V F+     V  GQ+ 
Sbjct: 291 QLHWVD----RDSLTTPLRCTVKTRYRQQDIPCTVTPVDAERIEVRFDFPVAAVTPGQSA 346

Query: 366 VFYTSDSNEARVLGGGIIS 384
           VFY  +      LGGGII 
Sbjct: 347 VFYLDEV----CLGGGIIE 361


>gi|257870651|ref|ZP_05650304.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus gallinarum EG2]
 gi|257804815|gb|EEV33637.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus gallinarum EG2]
          Length = 372

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 196/380 (51%), Gaps = 25/380 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + ++ RVVV MSGGVDSSV A LLK  GYDV+G+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNENTRVVVGMSGGVDSSVTALLLKEQGYDVVGIFMKNWDD---TDENGVCTATEDYKD 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +V   I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 58  VAKVAAQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMD 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q QL    FPLG M
Sbjct: 118 LGADYVATGHYAQVET----DENGVTHMLRGVDSNKDQTYFLSQLSQAQLSKTMFPLGGM 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A   GL  A K DS  +CF+ +  +   +       A +G++V L+G++ G+
Sbjct: 174 EKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKQFLSNYLP--AKKGNMVTLDGEVKGQ 231

Query: 256 HNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREI 308
           H+G++ YTIGQR+GLG+       EP FVV  D  ++ + VG           R+   +I
Sbjct: 232 HDGLMYYTIGQRQGLGIGGGGTSQEPWFVVGKDLATNTLYVGQGFHHPALYADRLEASQI 291

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVF 367
           ++  D          FKC  K R  Q  V V V+  ++D   V F++    +  GQA VF
Sbjct: 292 HFTTD----TDRPSEFKCTAKFRYRQQDVGVSVRLLDNDRAEVIFDEPVRAITPGQAVVF 347

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y         LGGG+I  + 
Sbjct: 348 YDG----MECLGGGLIDAAY 363


>gi|289550612|ref|YP_003471516.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315658107|ref|ZP_07910979.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus lugdunensis M23590]
 gi|289180144|gb|ADC87389.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315496436|gb|EFU84759.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus lugdunensis M23590]
          Length = 370

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 137/379 (36%), Positives = 198/379 (52%), Gaps = 22/379 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAYLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++EE + N V   F   Y  G TP P V CN+ +KF   L    +
Sbjct: 58  VIAVCNQIGIPYYAVNFEEEYWNKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLEHALK 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R + Y          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARLKRYDD----GHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A E GL  A K DS  ICF+ +  +   + +     A  GD+  L+G+ +G 
Sbjct: 174 EKKEVRRIAEEQGLATAKKKDSTGICFIGERNFKSFLSQYLP--AQAGDMRTLDGKKMGV 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLVDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                E     GF C  K R  Q    V V+R DD  + V F++    +  GQ+ VFY  
Sbjct: 292 NPVDLE----RGFNCTAKFRYRQQDTEVSVERVDDHSIKVTFKEPVRAITPGQSVVFYDG 347

Query: 371 DSNEARVLGGGIISGSKRS 389
           +      LGG  I    ++
Sbjct: 348 EI----CLGGATIDDVYKT 362


>gi|169829330|ref|YP_001699488.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lysinibacillus sphaericus C3-41]
 gi|205816875|sp|B1HUL3|MNMA_LYSSC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|168993818|gb|ACA41358.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lysinibacillus sphaericus C3-41]
          Length = 374

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 133/379 (35%), Positives = 203/379 (53%), Gaps = 22/379 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
           ++P  +RVVV MSGGVDSSV A LLK+ GY+VIG+ ++ ++    +   G C A +D  D
Sbjct: 5   RDPSQIRVVVGMSGGVDSSVAAYLLKQQGYEVIGIFMKNWDD---TDENGVCTATEDYDD 61

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
             +VC+ I + +Y  ++E+++ + V   F   Y AG TP P V CN+ +KF   L     
Sbjct: 62  VIKVCNQIGIPYYAVNFEKQYWDKVFTYFLEEYKAGRTPNPDVMCNKEIKFKAFLEHAMS 121

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD LATGHY R        G     M R +D  +DQ+YFL   +Q+QL  + FP+GD+
Sbjct: 122 LGADYLATGHYARI----DRSGDGEVKMLRGVDNNKDQTYFLNQLSQEQLAHVMFPIGDI 177

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K+ VR +A E GL  A K DS  ICF+ +  + + + +     A  G++  ++G ++G+
Sbjct: 178 EKKEVRKIAEEAGLATAKKKDSTGICFIGERNFKEFLSQFLP--AQPGNMETMDGVVMGK 235

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINWL 311
           H+G++ YT+GQR GLG+   GEP FV+  D   + ++V      E L    +   ++N+ 
Sbjct: 236 HDGLMYYTLGQRHGLGIGGDGEPWFVLGKDLERNVLLVGQGFDNEHLYSTSLSAVKMNYT 295

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
                   +   F C  K R  Q   PV V+   DG  ++ F +    +  GQA V Y  
Sbjct: 296 STK----KLPGKFSCTAKFRYRQTDTPVEVELLADGRTHITFAEPVRAITPGQAVVLYDG 351

Query: 371 DSNEARVLGGGIISGSKRS 389
           +      +GGG I    +S
Sbjct: 352 E----ECIGGGTIDEVFKS 366


>gi|184158965|ref|YP_001847304.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii ACICU]
 gi|294840582|ref|ZP_06785265.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter sp. 6014059]
 gi|205811014|sp|B2HVN5|MNMA_ACIBC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|183210559|gb|ACC57957.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Acinetobacter baumannii ACICU]
 gi|322508947|gb|ADX04401.1| trmU [Acinetobacter baumannii 1656-2]
 gi|323518933|gb|ADX93314.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 377

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 198/379 (52%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTAMEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRS-RLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R         G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRAETAYNSKGEAYAPLLRGLDKNKDQTYFLHAVHGREINKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A E+ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 EVRRIAEELDLATAKKKDSTGICFIGERRFNDFLKQYLP--AQPGKIVLDNGKEVGEHHG 236

Query: 259 IINYTI-----GQRRGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+         G+  A     FV++ D  ++R++V        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGLGGMKGASEGAWFVLHKDVANNRLVVGQGHDHPLMQSTQLWSEAIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD---GVYVDFEKSEVGVASGQACVF 367
           +     ++   +G +C  K R  Q      V  +++   GV V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QNIPAEGLRCTAKTRYRQPDQACTVFIDENSEHGVRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSDEV----CLGGGVIHHT 369


>gi|169795184|ref|YP_001712977.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii AYE]
 gi|213158152|ref|YP_002320203.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AB0057]
 gi|215482732|ref|YP_002324930.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AB307-0294]
 gi|239501147|ref|ZP_04660457.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AB900]
 gi|260556664|ref|ZP_05828882.1| tRNA methyl transferase [Acinetobacter baumannii ATCC 19606]
 gi|294837181|ref|ZP_06781864.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter sp. 6013113]
 gi|294860682|ref|ZP_06798451.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter sp. 6013150]
 gi|301346855|ref|ZP_07227596.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii AB056]
 gi|301511134|ref|ZP_07236371.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii AB058]
 gi|301596413|ref|ZP_07241421.1| tRNA-specific 2-thiouridylase MnmA [Acinetobacter baumannii AB059]
 gi|205811029|sp|B0VBY5|MNMA_ACIBY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205815008|sp|A3M7G3|MNMA_ACIBT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|226704765|sp|B7GZ21|MNMA_ACIB3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|226704766|sp|B7I4K8|MNMA_ACIB5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|169148111|emb|CAM85974.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AYE]
 gi|213057312|gb|ACJ42214.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AB0057]
 gi|213987036|gb|ACJ57335.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acinetobacter baumannii AB307-0294]
 gi|260409923|gb|EEX03223.1| tRNA methyl transferase [Acinetobacter baumannii ATCC 19606]
          Length = 377

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 120/379 (31%), Positives = 198/379 (52%), Gaps = 23/379 (6%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             RV+V MSGGVDSSV AALL + GY V G+ ++ +     ++    C A +D+ DA+ V
Sbjct: 2   QQRVIVGMSGGVDSSVSAALLLQQGYQVEGLFMKNWEEDDGTE---YCTAMEDLADAQAV 58

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D I +  +  ++   + + V   F + YAAG TP P + CN+ +KF   L     LGAD
Sbjct: 59  ADKIGIKLHTANFAMEYWDRVFEHFLAEYAAGRTPNPDILCNKEIKFRAFLDHAMTLGAD 118

Query: 140 VLATGHYIRS-RLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R         G+    + R +D  +DQ+YFL A   +++    FP+G+++K 
Sbjct: 119 FIATGHYARRAETAYNSKGEAYAPLLRGLDNNKDQTYFLHAVHGREINKTLFPVGEIEKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A E+ L  A K DS  ICF+ + ++ D +K+     A  G IV  NG+ +G H+G
Sbjct: 179 EVRRIAEELDLATAKKKDSTGICFIGERRFNDFLKQYLP--AQPGKIVLDNGKEVGEHHG 236

Query: 259 IINYTI-----GQRRGLGVAMGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREINW 310
           ++ YT+         G+  A     FV++ D  ++R++V        ++  +++   I+W
Sbjct: 237 LMYYTLGQRGGIGLGGMKGASEGAWFVLHKDVANNRLVVGQGHDHPLMQSTQLWSEAIDW 296

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD---GVYVDFEKSEVGVASGQACVF 367
           +     ++   +G +C  K R  Q      V  +++   GV V+F++ +  V  GQ+ VF
Sbjct: 297 VAGE--QNIPAEGLRCTAKTRYRQPDQACTVFIDENSEHGVRVEFDEPQRAVTPGQSVVF 354

Query: 368 YTSDSNEARVLGGGIISGS 386
           Y+ +      LGGG+I  +
Sbjct: 355 YSDEV----CLGGGVIHHT 369


>gi|325695737|gb|EGD37636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus sanguinis SK150]
          Length = 373

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 132/384 (34%), Positives = 195/384 (50%), Gaps = 25/384 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDEFGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
             V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     L
Sbjct: 60  AAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYALTL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY + +     D +    M R  D  +DQ+YFL   +Q+QL    FPLG ++
Sbjct: 120 GADYVATGHYAQVKR----DQEGVVHMLRGKDNNKDQTYFLSQLSQEQLQKTMFPLGHLE 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  ICF+ +  + + + +     A  G ++ L G+ +G+H
Sbjct: 176 KPEVRAIAERAGLATAKKKDSTGICFIGEKNFKEFLSQYLP--AQPGRMMTLEGRDMGQH 233

Query: 257 NGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREI 308
            G++ YTIGQR GLG+        EP FVV  D + + + V      ++L    +   ++
Sbjct: 234 AGLMYYTIGQRGGLGIGGQHGGDNEPWFVVGKDLSQNILYVGQGFYHDNLMSTSLDASQV 293

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           ++  +   E       +C  K R  Q    V V    D   V+ ++ +  V  GQA VFY
Sbjct: 294 HFTKEMPEE----FTMECTAKFRYRQPDSKVTVAVKGDKAVVNVDQPQRAVTPGQAVVFY 349

Query: 369 TSDSNEARVLGGGIISGSKRSDAV 392
             D      LGGG+I  + ++  V
Sbjct: 350 DGD----ECLGGGLIDRAYKNGQV 369


>gi|24380473|ref|NP_722428.1| tRNA-specific 2-thiouridylase MnmA [Streptococcus mutans UA159]
 gi|30173426|sp|Q8DRS4|MNMA_STRMU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|24378503|gb|AAN59734.1|AE015035_3 putative tRNA [Streptococcus mutans UA159]
          Length = 373

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 130/385 (33%), Positives = 195/385 (50%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +    RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R  D  +DQ+YFL   +Q+QL  + FPLG +
Sbjct: 119 LGADYVATGHYAQVSR----DADGTVHMLRGADNNKDQTYFLSQLSQEQLQKVMFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR++A + GL  A K DS  ICF+ +  + + +       A +G ++ ++G+ +G 
Sbjct: 175 QKPRVREIAEKAGLVTAKKKDSTGICFIGEKNFKEFLSSYLP--AQKGRMMTIDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           HNG++ YTIGQR G+G+         P FVV  D + + + V      ++L    +   +
Sbjct: 233 HNGLMYYTIGQRGGMGIGGQKGGDNAPWFVVGKDLSQNILYVGQGFYHDALMSTSLTASQ 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +++               C  K R  Q    V V+ N D   V F++ +  +  GQA VF
Sbjct: 293 VHFT----QNMPDKFTLNCTAKFRYRQPDSKVDVKVNGDKAEVIFDEPQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  D      LGGG+I  + + + +
Sbjct: 349 YDGD----ECLGGGLIDNAYQEEKI 369


>gi|77412483|ref|ZP_00788784.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae CJB111]
 gi|77161459|gb|EAO72469.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae CJB111]
          Length = 373

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 197/385 (51%), Gaps = 25/385 (6%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +  ++RVVV MSGGVDSSV A LLK  GYDVIGV ++ ++    +   G C A +D  D
Sbjct: 2   TDNSNIRVVVGMSGGVDSSVTALLLKEQGYDVIGVFMKNWDD---TDEFGVCTATEDYKD 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              V D I + +Y  ++E+ + + V   F + Y AG TP P V CN+ +KF   L     
Sbjct: 59  VAAVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMT 118

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY +       D      M R +D  +DQ+YFL   +Q+QL    FPLG +
Sbjct: 119 LGADYVATGHYAQV----TRDKNGIVHMLRGVDNNKDQTYFLSQLSQEQLQKTLFPLGHL 174

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  + D + +     A  G ++ ++G+ +G 
Sbjct: 175 QKPEVRRIAEEAGLATAKKKDSTGICFIGEKNFKDFLGQYLP--AQPGRMMTVDGRDMGE 232

Query: 256 HNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLRE 307
           H G++ YTIGQR GLG+        +P FVV  D + + + V      +SL    +   E
Sbjct: 233 HAGLMYYTIGQRGGLGIGGQHGGDNKPWFVVGKDLSKNILYVGQGFYHDSLMSTSLTASE 292

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           I++  D   E       +C  K R  Q    V V    +   V F+  +  +  GQA VF
Sbjct: 293 IHFTRDMPNE----FKLECTAKFRYRQPDSKVTVYVKGNQARVVFDDLQRAITPGQAVVF 348

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y    NE   LGGG+I  + R D +
Sbjct: 349 Y----NEQECLGGGMIDQAYRDDKI 369


>gi|21283300|ref|NP_646388.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486454|ref|YP_043675.1| tRNA-specific 2-thiouridylase MnmA [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207658|ref|ZP_06924093.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300911740|ref|ZP_07129183.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus TCH70]
 gi|24638304|sp|Q8NW84|MNMA_STAAW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56749706|sp|Q6G8U8|MNMA_STAAS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|21204740|dbj|BAB95436.1| (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Staphylococcus aureus subsp. aureus MW2]
 gi|49244897|emb|CAG43358.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|296887675|gb|EFH26573.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|300885986|gb|EFK81188.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus TCH70]
          Length = 372

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 134/380 (35%), Positives = 201/380 (52%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVVV MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVVGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKIEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|329733069|gb|EGG69406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Staphylococcus aureus subsp. aureus 21193]
          Length = 372

 Score =  355 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 133/380 (35%), Positives = 201/380 (52%), Gaps = 20/380 (5%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            + KD+RVV+ MSGGVDSSV A +LK  GYDVIG+ ++ ++    +   G C A +D  D
Sbjct: 1   MSNKDIRVVIGMSGGVDSSVTAHVLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYND 57

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
              VC+ I + +Y  ++E+ + + V   F   Y  G TP P V CN+ +KF   L     
Sbjct: 58  VIEVCNQIGIPYYAVNFEKEYWDKVFTYFLDEYKKGRTPNPDVMCNKEIKFKAFLDHAMN 117

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD +ATGHY R   +          M R +D  +DQ+YFL   +QQQL  + FP+GD+
Sbjct: 118 LGADYVATGHYARIHRH----EDGHVEMLRGVDNNKDQTYFLNQLSQQQLSKVMFPIGDI 173

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
           +K  VR +A E GL  A K DS  ICF+ +  +   + +     A  GD++ L+G+ +G+
Sbjct: 174 EKSEVRRIAEEQGLVTAKKKDSTGICFIGEKNFKTFLSQYLP--AQPGDMITLDGKKMGK 231

Query: 256 HNGIINYTIGQRRGLGVAM-GEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLREINWL 311
           H+G++ YTIGQR GLG+   G+P FVV  +   + + V             +   + +++
Sbjct: 232 HSGLMYYTIGQRHGLGIGGDGDPWFVVGKNLKDNVLYVEQGFHHDALYSDYLIASDYSFV 291

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTS 370
                ++ +  GF+C  K R  Q    VFV+R +D  + V F +    +  GQA VFY  
Sbjct: 292 N--PEDNDLDQGFECTAKFRYRQKDTKVFVKRENDHALRVTFAEPVRAITPGQAVVFYQG 349

Query: 371 DSNEARVLGGGIISGSKRSD 390
           D      LGG  I    +++
Sbjct: 350 DV----CLGGATIDDVFKNE 365


>gi|119944723|ref|YP_942403.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Psychromonas ingrahamii 37]
 gi|166235075|sp|A1STI9|MNMA_PSYIN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|119863327|gb|ABM02804.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Psychromonas ingrahamii 37]
          Length = 367

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 124/380 (32%), Positives = 200/380 (52%), Gaps = 28/380 (7%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            +   ++V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A QD+ D
Sbjct: 2   TDNSQVKVIVGMSGGVDSSVSAYLLQQQGYLVEGLFMKNWEEDDTDQ---YCAAAQDLED 58

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TR 134
           A+ VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L     
Sbjct: 59  AQSVCDKLGIPLHTINFAAEYWDNVFEHFLAEYKAGRTPNPDIMCNKEIKFKAFLEFAAE 118

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGAD +ATGHY+R R   G        + R +D  +DQSYFL+A  ++Q+    FP+G+
Sbjct: 119 DLGADYIATGHYVRRREVDG-----HVQLLRGLDNNKDQSYFLYAIGEKQIAKSLFPVGE 173

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           ++K  VR +A +  L   +K DS  ICF+ + K+ D ++      A  GDIV   G+++G
Sbjct: 174 LEKPEVRRIAEQQDLITHNKKDSTGICFIGERKFTDFLQEYLP--AQPGDIVTPTGEVIG 231

Query: 255 RHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLR 306
           +H G++ +T+GQR+GLG+         P +VV  D +++R++V           + +  +
Sbjct: 232 QHQGLMYHTLGQRKGLGIGGLQNSNENPWYVVGKDMDNNRLLVAQGADHPALFSYGLIAK 291

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           + +W+            F+C VK R  Q  +P  V   +DD + V F+ ++  V  GQ+ 
Sbjct: 292 QCDWVD----RTPKKSTFRCTVKTRYRQQDIPCTVTPLDDDTLKVIFDTAQAAVTPGQSA 347

Query: 366 VFYTSDSNEARVLGGGIISG 385
           VFY  +      LGG II  
Sbjct: 348 VFYNDEV----CLGGAIIEE 363


>gi|257416449|ref|ZP_05593443.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis AR01/DG]
 gi|257158277|gb|EEU88237.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis ARO1/DG]
          Length = 374

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 195/380 (51%), Gaps = 26/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V D I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L    QL
Sbjct: 60  AKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R +D  +DQ+YFL   +Q QL    FPLG M 
Sbjct: 120 GADYVATGHYAQVET----DENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGMG 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  +CF+ +  + + +       A +G++V  +G+I G+H
Sbjct: 176 KSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLP--AKKGNMVTEDGEIKGQH 233

Query: 257 NGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FV+  D  ++ + V      E L    +   E++
Sbjct: 234 DGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           +  D      +   F C  K R  Q  +PV V  ++DG    V F++    V  GQA VF
Sbjct: 294 FTVD----TPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y         LGGG+I  + 
Sbjct: 350 YDG----MECLGGGLIDRAY 365


>gi|149908394|ref|ZP_01897057.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Moritella sp. PE36]
 gi|149808557|gb|EDM68492.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Moritella sp. PE36]
          Length = 379

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 120/378 (31%), Positives = 191/378 (50%), Gaps = 28/378 (7%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
               +V+V MSGGVDSSV A LL++ GY V G+ ++ +      +    C A +D+ DA+
Sbjct: 14  NSTKKVIVGMSGGVDSSVSAYLLQQQGYQVEGLFMKNWEDDDNDE---YCAAAEDLADAQ 70

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQL 136
            VCD + +  +  ++   + + V   F + Y AG TP P + CN+ +KF   L   +  L
Sbjct: 71  AVCDKLGIELHAINFSAEYWDNVFEYFLAEYKAGRTPNPDILCNKEIKFKAFLQFASEVL 130

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            AD +A GHY+  R         +  M R +D  +DQSYFL+     Q+    FP+G+++
Sbjct: 131 AADYIAMGHYVSRRQTAD----GKFEMLRGLDSNKDQSYFLYTLDHVQVSRSLFPVGELE 186

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A E GL  A+K DS  ICF+ + K+ + + +     A  G I  ++G+ +G H
Sbjct: 187 KPEVRRIAEEQGLITANKKDSTGICFIGERKFTEFLSKYLP--AQPGKIESVDGEEIGEH 244

Query: 257 NGIINYTIGQRRGLGVA------MGEPLFVVYLDKNSSRVIVGPRESL---EVHRIYLRE 307
            G++ +T+GQR+GL +         EP +VV  D   + ++V    +        +   +
Sbjct: 245 QGLMYHTLGQRKGLHIGGMKNNNNQEPWYVVDKDMERNVLLVAQGHNHPRLFSTGLMASQ 304

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACV 366
           ++W+      + +    +C VK R  Q  VP  V    +D + V F+K E+ V  GQ+ V
Sbjct: 305 LHWIS----REPLTQPLRCTVKTRYRQTDVPCLVTPIGEDQIEVTFDKPELAVTPGQSAV 360

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  D      LGG II 
Sbjct: 361 FYLDDV----CLGGAIID 374


>gi|326791915|ref|YP_004309736.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium lentocellum DSM 5427]
 gi|326542679|gb|ADZ84538.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium lentocellum DSM 5427]
          Length = 360

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 139/365 (38%), Positives = 211/365 (57%), Gaps = 12/365 (3%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
             +VVV MSGGVDSSV A LLK  GY+VIG+T+Q++         G CC    V DARRV
Sbjct: 6   KKKVVVGMSGGVDSSVTAYLLKEQGYEVIGMTMQIWQEGAPEDSDGGCCGLSAVDDARRV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           C  +++ HYV ++   F+  VI  F   Y    TP PC+ CNR VK+  +L    Q+GAD
Sbjct: 66  CQKLDIPHYVVNFRSDFKKHVIDYFLDEYQNARTPNPCIACNRYVKWESMLQKALQIGAD 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    + D+   R  + +   L +DQ+Y L+  TQ QL     PLGD  K+ 
Sbjct: 126 YIATGHYARV---IRDEVTGRYSLKQSKTLAKDQTYALYNLTQHQLAHTLMPLGDYTKDE 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A+E+GL +A K DSQ+ICFV    Y   ++       + G+ V+ +G++LG+H GI
Sbjct: 183 VRAIAKEIGLAVATKPDSQEICFVPDNNYAKYIEEETGKKPVVGNFVNKDGKVLGKHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+++G+P FV  +++ ++ V++G  E L    +   ++N++      + 
Sbjct: 243 IHYTIGQRKGLGLSLGKPGFVQRINQKTNEVVIGDNEDLFDTTVTANQVNFM----PFEH 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +     C  KIR +Q P P  ++  ++D +   F++ +  +  GQA V Y  D    +++
Sbjct: 299 LEGEMHCLGKIRYNQAPQPCTIKMIDEDTIQCIFDEKQRAITPGQALVLYDGD----KLI 354

Query: 379 GGGII 383
           GGG I
Sbjct: 355 GGGTI 359


>gi|257082170|ref|ZP_05576531.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis E1Sol]
 gi|256990200|gb|EEU77502.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Enterococcus faecalis E1Sol]
          Length = 374

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 136/380 (35%), Positives = 196/380 (51%), Gaps = 26/380 (6%)

Query: 17  NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDA 76
           +    RVVV MSGGVDSSV A LLK  GYDVIG+ ++ ++    +   G C A +D  D 
Sbjct: 3   DNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDD---TDENGVCTATEDYKDV 59

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
            +V D I + +Y  ++E+ + + V   F + Y  G TP P V CN+ +KF   L    QL
Sbjct: 60  AKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAIQL 119

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY +       D      M R +D  +DQ+YFL   +Q QL    FPLG M+
Sbjct: 120 GADYVATGHYAQVET----DENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGME 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A   GL  A K DS  +CF+ +  + + +       A +G++V  +G+I G+H
Sbjct: 176 KSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLP--AKKGNMVTEDGEIKGQH 233

Query: 257 NGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIV---GPRESLEVHRIYLREIN 309
           +G++ YTIGQR+GLG+       EP FV+  D  ++ + V      E L    +   E++
Sbjct: 234 DGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVH 293

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVF 367
           +  D      +   F C  K R  Q  +PV V  ++DG    V F++    V  GQA VF
Sbjct: 294 FTVD----TPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVF 349

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y         LGGG+I  + 
Sbjct: 350 YDG----MECLGGGLIDRAY 365


>gi|20808819|ref|NP_623990.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|24638308|sp|Q8R7F0|MNMA2_THETN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|20517470|gb|AAM25594.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Thermoanaerobacter tengcongensis MB4]
          Length = 364

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 141/373 (37%), Positives = 212/373 (56%), Gaps = 14/373 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +       +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEGGCCSLAAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 DAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDKVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +     N++     
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDELISYNNNFISI--- 296

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+ VFY  D    
Sbjct: 297 -DKLEKEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRAITPGQSVVFYDGDI--- 352

Query: 376 RVLGGGIISGSKR 388
            V+GGGII    R
Sbjct: 353 -VVGGGIIERKVR 364


>gi|76788488|ref|YP_330692.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae A909]
 gi|123601021|sp|Q3JYG1|MNMA_STRA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|76563545|gb|ABA46129.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Streptococcus agalactiae A909]
          Le