RPSBLAST alignment for GI: 254780151 and conserved domain: pfam03054

>gnl|CDD|145938 pfam03054, tRNA_Me_trans, tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. Length = 354
 Score =  380 bits (978), Expect = e-106
 Identities = 160/370 (43%), Positives = 214/370 (57%), Gaps = 23/370 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           M+VVVAMSGGVDSSV A LLK  GY+VIGV ++ ++        G CC+ +D+ DA+RVC
Sbjct: 1   MKVVVAMSGGVDSSVAAYLLKEQGYEVIGVFMKNWDEED-EFGHG-CCSEEDLADAQRVC 58

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS-VTRQLGAD 139
           + + +  YV ++E+ +   V  PF   Y  G TP P + CNR +KF  LL    + LGAD
Sbjct: 59  EQLGIPLYVVNFEKEYWEKVFEPFLDEYKNGRTPNPDILCNREIKFGALLDYAKQVLGAD 118

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            LATGHY R      ++ +    + R  D  +DQSYFL   +Q+QL  L FPLGD+ KE 
Sbjct: 119 YLATGHYARV---SLNENESE--LLRGKDKNKDQSYFLSGLSQEQLEKLLFPLGDLTKEE 173

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN-GQILGRHNG 258
           VR +A+E GL  A K DSQ ICF+ +  + D +K+        GDI+ ++ G++LG H G
Sbjct: 174 VRKIAKEAGLPTAKKKDSQGICFIGKRNFKDFLKKY--LPVKPGDIIDIDTGEVLGEHEG 231

Query: 259 IINYTIGQRRGLGVA-MGEPLFVVYLDKNSSRVIVGPR---ESLEVHRIYLREINWLGDG 314
           I  YTIGQR+GLG+   GEP +VV  D   + V VG     E L    +  +++NWLG  
Sbjct: 232 IWFYTIGQRKGLGIGGYGEPWYVVEKDPEKNTVYVGRGEDHEDLYSDGLRAKDLNWLGPE 291

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSN 373
           L    V    +C VK+R  Q PVP  V+  DD  + V F++    V  GQA VFY  D  
Sbjct: 292 LPTGEV---LRCTVKVRHRQPPVPCKVKLLDDNTIEVHFDEPVRAVTPGQAAVFYDGD-- 346

Query: 374 EARVLGGGII 383
             R LGGGII
Sbjct: 347 --RCLGGGII 354