RPSBLAST alignment for GI: 254780151 and conserved domain: COG0482

>gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]. Length = 356
 Score =  391 bits (1007), Expect = e-109
 Identities = 155/375 (41%), Positives = 220/375 (58%), Gaps = 24/375 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
            K  +V+V MSGGVDSSV A LLK  GY+VIG+ ++ ++        G CC+ +D+ DA 
Sbjct: 1   MKKKKVLVGMSGGVDSSVAAYLLKEQGYEVIGLFMKNWDEDG----GGGCCSEEDLRDAE 56

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV D + +  YV D+E+ F N V   F + Y AG+TP PC+ CN+ +KF  LL   ++LG
Sbjct: 57  RVADQLGIPLYVVDFEKEFWNKVFEYFLAEYKAGKTPNPCILCNKEIKFKALLDYAKELG 116

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD +ATGHY R R     + +   ++ R +DL +DQSYFL+A +Q+QL  L FPLGD++K
Sbjct: 117 ADYIATGHYARQR-----EDEGIELLLRGVDLNKDQSYFLYALSQEQLERLLFPLGDLEK 171

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A E GL  A K DSQ ICF+ + K+ D + R     A  G+I+  +G++LG H+
Sbjct: 172 LEVRPIAAEKGLPTAKKKDSQGICFIGERKFKDFLGRYLP--AKPGEIIDKDGKVLGEHD 229

Query: 258 GIINYTIGQRRGLGVA--MGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL 315
           G++ YTIGQR+GLG+    GEP +VV  D   +R+ VG  E+L    +   ++NWL D  
Sbjct: 230 GLMYYTIGQRKGLGIGGLKGEPWYVVGKDLKKNRLYVGQGEALLSVGLIAEDLNWLDDAP 289

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQR---NDDGVYVDFEKSEVGVASGQACVFYTSDS 372
            E    +  +C  K+R  Q   P  V+     D  + V F++ +  V  GQA V Y  D 
Sbjct: 290 PE----EPLECTAKVRYRQGDEPCKVKVLSDEDVELAVKFDEPQRAVTPGQAAVLYDGD- 344

Query: 373 NEARVLGGGIISGSK 387
                LGGGII  S+
Sbjct: 345 ---ICLGGGIIDTSE 356