RPSBLAST alignment of GI: 254780151 and protein with PDBid: 1ni5

>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Length = 433
 Score = 50.3 bits (119), Expect = 8e-07
 Identities = 33/220 (15%), Positives = 66/220 (30%), Gaps = 38/220 (17%)

Query: 11  SLDLDKN-PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL----YNSRKASKRKG 65
           +L L++      +++VA SGG+DS+V+   L +   +  GV L+     +     +    
Sbjct: 3   TLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANAD--- 59

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
                  V     VC    V   V   +       I                    +  +
Sbjct: 60  -----AWVTHCENVCQQWQVPLVVERVQLAQEGLGI------------------EAQARQ 96

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
                     L  +VL T  ++  +        +R      +         +   ++   
Sbjct: 97  ARYQAFARTLLPGEVLVTAQHLDDQCETFLLALKRGSGPAGL-------SAMAEVSEFAG 149

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQ 225
             L  PL    +  +   AR+  L   +   +QD  + + 
Sbjct: 150 TRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSYDRN 189