RPSBLAST alignment of GI: 254780151 and protein with PDBid: 1wxi

>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Length = 275
 Score = 39.5 bits (91), Expect = 0.001
 Identities = 18/149 (12%), Positives = 35/149 (23%), Gaps = 25/149 (16%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKR-----------DGYDVIGVTLQLYNSRKASK 62
           L   P    +V+ +SGG DS++   L +            +    I V L          
Sbjct: 34  LQTYPFIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQADEQD 93

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
            + +    Q             ++      E                   +     +   
Sbjct: 94  CQDAIAFIQPDRVLTVNIKGAVLASEQALREAGIEL--------------SDFVRGNEKA 139

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRL 151
             +     S+       V+ T H   +  
Sbjct: 140 RERMKAQYSIAGMTSGVVVGTDHAAEAIT 168