HHsearch alignment for GI: 254780152 and conserved domain: KOG0067

>KOG0067 consensus.
Probab=98.61  E-value=2.2e-08  Score=67.44  Aligned_cols=78  Identities=27%  Similarity=0.307  Sum_probs=70.6

Q ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             023889859998165608833367412441364314324355289999999999727799999998599861121400
Q gi|254780152|r    2 LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGV   79 (82)
Q Consensus         2 l~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~   79 (82)
T Consensus        90 lEkfkalRv~~rig~g~dn~dikaAseL~iavC~ip~~~Ve~~a~stl~hIl~l~rrntw~cq~l~eg~~~q~~~q~~  167 (435)
T KOG0067          90 LEKFKALRVIVRIGSGYDNIDIKAASELGIAVCNIPSDAVEETADSTLCHILNLYRRNTWLCQALREGTCTQGLEQVR  167 (435)
T ss_pred             HHHHHHHCEEEEECCCCCHHHHHHHHHHCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCCEEECHHHHH
T ss_conf             877522200565115665455444422003443265126888877789998755404415442211664552144543