HHsearch alignment for GI: 254780152 and conserved domain: PRK00257

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated.
Probab=99.60  E-value=5.9e-16  Score=109.26  Aligned_cols=57  Identities=32%  Similarity=0.472  Sum_probs=52.5

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             8023889859998165608833367412441364314324355289999999999727
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ   58 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~   58 (82)
T Consensus        53 LL~-~s~lKfIgtat~G~DhID~~~l~~~gI~v~naPG~Na~sVaEyvl~~ll~la~~  109 (379)
T PRK00257         53 LLE-GSKVRFVGTCTIGTDHLDLDYFAEAGITWSNAPGCNARGVVDYVLGSLLTLAER  109 (379)
T ss_pred             HHC-CCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             975-699269997456353146999986997899699877799999999999999985