HHsearch alignment for GI: 254780152 and conserved domain: PRK06436

>PRK06436 glycerate dehydrogenase; Provisional.
Probab=99.83  E-value=8e-21  Score=136.15  Aligned_cols=73  Identities=27%  Similarity=0.382  Sum_probs=66.5

Q ss_pred             HHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
Q ss_conf             02388985999816560883336741244136431432435528999999999972779999999859986112
Q gi|254780152|r    2 LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFN   75 (82)
Q Consensus         2 l~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~   75 (82)
T Consensus        44 ~~~aknLK~I~~~g~G~D~IDlea~~~-~iiv~~n~g~~s~aVAE~al~liLal~R~i~~~~~~~r~g~W~~~~  116 (303)
T PRK06436         44 YVPGKKTKMIQSLSAGVDHIDVSGIPE-NVVLCSNAGAYSISVAEHAFALLLAWAKNICENNYNMKNGNFKQSP  116 (303)
T ss_pred             CCCCCCCEEEEECCEECCHHHHHHHHC-CCEEEECCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
T ss_conf             776888559998976875235999976-9989989998862799999999999981868999999807555789