HHsearch alignment for GI: 254780152 and conserved domain: PRK06932

>PRK06932 glycerate dehydrogenase; Provisional.
Probab=99.89  E-value=1.4e-23  Score=151.42  Aligned_cols=74  Identities=31%  Similarity=0.439  Sum_probs=71.5

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKF   74 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~   74 (82)
T Consensus        59 vl~~ap~LK~I~~~g~G~D~ID~~aa~~~gI~V~n~pg~~~~~VAE~~i~liL~l~r~i~~~~~~~~~~~W~~~  132 (314)
T PRK06932         59 TLQQLPKLKLIAITATGTNNVDLVAAKELGITVKNVTGYSSTTVPEHVLGLIFALKHSLMGWYRDQLSAKWAEC  132 (314)
T ss_pred             HHHCCCCCEEEEECCCCCCCCCHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99539998099889834564789999749979993898672789999999999999779999999983864324