HHsearch alignment for GI: 254780152 and conserved domain: PRK08410

>PRK08410 2-hydroxyacid dehydrogenase; Provisional.
Probab=99.88  E-value=2.6e-23  Score=149.94  Aligned_cols=75  Identities=27%  Similarity=0.399  Sum_probs=72.0

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
Q ss_conf             802388985999816560883336741244136431432435528999999999972779999999859986112
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFN   75 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~   75 (82)
T Consensus        57 ~l~~a~~LK~I~~~g~G~D~ID~~aa~~~gI~V~n~p~~~~~aVAE~~l~~iL~l~r~i~~~~~~~~~g~w~~~~  131 (311)
T PRK08410         57 VLSALPNLKLICITATGTNNVDLEYAKKRGIAVKNVAGYSTESVAQHTFAMLLSLLGRINYYDNYVKSGEYSKSP  131 (311)
T ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             993699984999888156142199999799689927997848899999999999985579999999716533465