HHsearch alignment for GI: 254780152 and conserved domain: PRK12480

>PRK12480 D-lactate dehydrogenase; Provisional.
Probab=99.88  E-value=5.4e-23  Score=148.14  Aligned_cols=81  Identities=22%  Similarity=0.311  Sum_probs=74.0

Q ss_pred             CHHHCCC--CCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCC-CCCE
Q ss_conf             8023889--859998165608833367412441364314324355289999999999727799999998599861-1214
Q gi|254780152|r    1 MLSHAKK--MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEK-FNFM   77 (82)
Q Consensus         1 il~~~~~--Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~-~~~~   77 (82)
T Consensus        61 vl~~l~~~~LK~I~~~gvG~D~IDl~aa~~~GI~V~n~P~~~~~aVAE~ai~liL~l~R~~~~~~~~~~~~~~~~~~~~~  140 (330)
T PRK12480         61 VYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVPSYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIM  140 (330)
T ss_pred             HHHHHHHCCCEEEEECCEECCHHCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCC
T ss_conf             99965567975999877217521699999789999959986828999999999999984549999999827876456557


Q ss_pred             EEEC
Q ss_conf             0017
Q gi|254780152|r   78 GVEA   81 (82)
Q Consensus        78 G~El   81 (82)
T Consensus       141 g~~l  144 (330)
T PRK12480        141 SKPV  144 (330)
T ss_pred             CCCC
T ss_conf             7523