HHsearch alignment of GI: 254780152 and MMDB domain: 1mx3_A_1-116_312-347

>1mx3_A (A:1-116,A:312-347) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens}
Probab=99.18  E-value=9.7e-12  Score=85.64  Aligned_cols=41  Identities=37%  Similarity=0.494  Sum_probs=38.2

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCC
Q ss_conf             80238898599981656088333674124413643143243
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNS   41 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~   41 (82)
                      +|+++|+||+|+++|+||||||+++|+++||.|+|+|+-.+
T Consensus        79 vL~~~p~LK~I~~~gvG~DnVDl~aa~krGI~V~NtpG~~~  119 (152)
T 1mx3_A           79 DLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAWYS  119 (152)
T ss_dssp             HHTTCSSCCEEEESSSCCTTBCHHHHHHTTCEEECCCSTCC
T ss_pred             HHHCCCCCCEEEECCEECCCCCHHHHHHCCCEEEECCCCCH
T ss_conf             99539985179999873251359989868999996998173