HHsearch alignment of GI: 254780152 and MMDB domain: 1sc6_A_101-288

>1sc6_A (A:101-288) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}
Probab=98.30  E-value=4.7e-07  Score=59.74  Aligned_cols=43  Identities=33%  Similarity=0.414  Sum_probs=39.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEEC
Q ss_conf             2435528999999999972779999999859986112140017
Q gi|254780152|r   39 GNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEA   81 (82)
Q Consensus        39 ~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~El   81 (82)
                      +|+.+|||+++++||++.|++..+++.+++|.|.+..+.|.||
T Consensus         1 ana~~vAE~~l~~iL~~~R~~~~~~~~~~~g~w~~~~~~~~~l   43 (188)
T 1sc6_A            1 SNTRSVAELVIGELLLLLRGVPEANAKAHRGVGNKLAAGSFEA   43 (188)
T ss_dssp             TTHHHHHHHHHHHHHHHHHTHHHHHHHHHHTCCC-----CCCS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             5444116788775421100135555565427632235655444