HHsearch alignment of GI: 254780152 and MMDB domain: 1wwk_A_1-97_284-307

>1wwk_A (A:1-97,A:284-307) Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3}
Probab=99.12  E-value=3.4e-11  Score=82.66  Aligned_cols=43  Identities=40%  Similarity=0.718  Sum_probs=40.0

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCC
Q ss_conf             8023889859998165608833367412441364314324355
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSIT   43 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~s   43 (82)
                      +|+++|+||+|+++|+||||||+++|+++||.|+|+|+.++..
T Consensus        60 iL~~~p~LK~I~~~~vG~d~IDl~aa~~rGI~VtN~pg~~~~~  102 (121)
T 1wwk_A           60 VIESAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASTVE  102 (121)
T ss_dssp             HHTTCTTCCEEEESSSCCTTBCHHHHHHHTCEEECCGGTCBHH
T ss_pred             HHHHCCCCCEEEECCCCCCCCCCCCHHHHCCCCCCCCCCCHHH
T ss_conf             9950887748965034453222111011023323466528299