HHsearch alignment of GI: 254780152 and MMDB domain: 2cuk_A_97-279

>2cuk_A (A:97-279) Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}
Probab=98.05  E-value=4.3e-06  Score=54.48  Aligned_cols=43  Identities=23%  Similarity=0.485  Sum_probs=37.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC---CCEEEEC
Q ss_conf             243552899999999997277999999985998611---2140017
Q gi|254780152|r   39 GNSITTAEHAISLMLAIARQIPVANESTHKGKWEKF---NFMGVEA   81 (82)
Q Consensus        39 ~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~---~~~G~El   81 (82)
                      .|+++|||+++++||++.|++..+++.+++|.|.+.   .+.|+||
T Consensus         1 v~a~~VAE~~l~~~L~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~l   46 (183)
T 2cuk_A            1 VLTEATADLTLALLLAVARRVVEGAAYARDGLWKAWHPELLLGLDL   46 (183)
T ss_dssp             TTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCCTTTTCBCCC
T ss_pred             CCCCCCCCHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             0233320000024565540416899999809744357545355213