HHsearch alignment of GI: 254780152 and MMDB domain: 2w2k_A_1-111_307-348

>2w2k_A (A:1-111,A:307-348) D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B
Probab=99.17  E-value=1.2e-11  Score=85.17  Aligned_cols=63  Identities=29%  Similarity=0.341  Sum_probs=46.7

Q ss_pred             CHHHCC-CCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCC-HHHHHHHHHHHHHHCHHHHHHHHHCCC
Q ss_conf             802388-9859998165608833367412441364314324355-289999999999727799999998599
Q gi|254780152|r    1 MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSIT-TAEHAISLMLAIARQIPVANESTHKGK   70 (82)
Q Consensus         1 il~~~~-~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~s-VAE~~i~l~L~l~R~~~~~~~~~~~g~   70 (82)
                      +|+++| +||+|+++|+||||||+++|+++||.|+|+|+.-+.. --|+--.-|       ...++.+.+|+
T Consensus        73 iL~~lP~~LK~Ia~~gvGyDnIDv~aa~erGI~V~NtPG~~~~~~~~~~~~~~~-------~~~~~~~~~~~  137 (153)
T 2w2k_A           73 LISHLPSSLKVFAAAGAGFDWLDLDALNERGVAFANSRGGVAIETFHEFERLTM-------TNIDRFLLQGK  137 (153)
T ss_dssp             HHTTSCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTTCSHHHHHHHHHHHH-------HHHHHHHHTCC
T ss_pred             HHHHCCCCCEEEEECCCCCCCCCHHHHHHCEEEEEECCECCHHHHHHHHHHHHH-------HHHHHHHHCCC
T ss_conf             997241272799999845675068888328588860101184999999999999-------99999997798