HHsearch alignment of GI: 254780152 and MMDB domain: 3gg9_A_108-302

>3gg9_A (A:108-302) D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum}
Probab=97.93  E-value=9.5e-06  Score=52.55  Aligned_cols=34  Identities=29%  Similarity=0.518  Sum_probs=31.5

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
Q ss_conf             5528999999999972779999999859986112
Q gi|254780152|r   42 ITTAEHAISLMLAIARQIPVANESTHKGKWEKFN   75 (82)
Q Consensus        42 ~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~   75 (82)
                      +||||++++++|++.|++..+++.+++|.|++..
T Consensus         2 ~sVAE~~l~~~L~~~R~~~~~~~~~~~g~w~~~~   35 (195)
T 3gg9_A            2 VAPAELTWALVMAAQRRIPQYVASLKHGAWQQSG   35 (195)
T ss_dssp             HHHHHHHHHHHHHHHTTHHHHHHHHHTTCTTCCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             0467899999999865345443332047632245