HHsearch alignment of GI: 254780152 and MMDB domain: 3gvx_A_1-78_260-290

>3gvx_A (A:1-78,A:260-290) Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum}
Probab=97.89  E-value=1.3e-05  Score=51.81  Aligned_cols=57  Identities=19%  Similarity=0.249  Sum_probs=46.9

Q ss_pred             HHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHH
Q ss_conf             238898599981656088333674124413643143243552899999999997277999
Q gi|254780152|r    3 SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA   62 (82)
Q Consensus         3 ~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~   62 (82)
                      +.+||||+|++.++|+|++|++..+++.|.++|+....   +.+.++.+...-.|++...
T Consensus        45 ~kaknLKwIQtiSAGVD~LPfe~Ip~~vIv~SNA~~~~---~~~~~~~~~~~~~~~~~~~  101 (109)
T 3gvx_A           45 VLGKRTKXIQAISAGVDHIDVNGIPENVVLCSNAXSGE---IXDIAIQLAFENVRNFFEG  101 (109)
T ss_dssp             CCCSSCCEEEECSSCCTTSCGGGSCTTSEEECCHBTTB---CCHHHHHHHHHHHHHHTC-
T ss_pred             HCCCCCEEEEECCEECCCCCHHHHHHCCEEEECCCHHH---HHHHHHHHHHHHHHHHHCC
T ss_conf             50898609999988335017988972987995477999---9999999999999999879