HHsearch results for GI: 254780152 and protein with PDBid: 1sc6_A

>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A*
Probab=99.86  E-value=2.6e-22  Score=143.16  Aligned_cols=82  Identities=37%  Similarity=0.553  Sum_probs=78.4

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611214001
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE   80 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~E   80 (82)
                      +|+++|+||+|+++|+|+||||+++|+++||.|+|+|++++.+|||++++++|++.|++..++..++++.|.+..+.|.|
T Consensus        63 ~l~~~~~Lk~I~~~g~G~d~Id~~~a~~~GI~V~n~pg~n~~aVaE~~l~l~l~~~R~~~~~~~~~~~~~w~~~~~~~~e  142 (404)
T 1sc6_A           63 VINAAEKLVAIGAFAIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVGNKLAAGSFE  142 (404)
T ss_dssp             HHHHCSSCCEEEECSSCCTTBCHHHHHHTTCCEECCTTTTHHHHHHHHHHHHHHHHHTHHHHHHHHHHTCCC-----CCC
T ss_pred             HHHCCCCCEEEEECCCCCCCHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99508987499994753364100301033201463157544411678877542110013555556542763223565544


Q ss_pred             CC
Q ss_conf             78
Q gi|254780152|r   81 AG   82 (82)
Q Consensus        81 lG   82 (82)
                      |.
T Consensus       143 l~  144 (404)
T 1sc6_A          143 AR  144 (404)
T ss_dssp             ST
T ss_pred             CC
T ss_conf             43