HHsearch results for GI: 254780152 and protein with PDBid: 2ekl_A

>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}
Probab=99.73  E-value=5.5e-18  Score=119.28  Aligned_cols=79  Identities=33%  Similarity=0.516  Sum_probs=72.7

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611214001
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE   80 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~E   80 (82)
                      +|+++|+||+|+++++|+||+|+++++++||.|+|+|++++.+|||++++++|++.|++..+++.+++|.|.+.  .|.|
T Consensus        62 ~l~~~~~Lk~I~~~~~G~d~id~~~~~~~~i~v~~~~g~~~~~vaE~~~~~~l~l~r~~~~~~~~~~~g~~~~~--~~~~  139 (313)
T 2ekl_A           62 VIEKGKKLKIIARAGIGLDNIDTEEAEKRNIKVVYAPGASTDSAVELTIGLMIAAARKMYTSMALAKSGIFKKI--EGLE  139 (313)
T ss_dssp             HHHHCTTCCEEEECSSCCTTBCHHHHHHTTCEEECCTTTTHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCC--CCCC
T ss_pred             HHHHCCCCEEEEECCCCCCCCCCHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC--CCCC
T ss_conf             99519897799889816451651015543701563798771999999999999875143778887534885556--7766


Q ss_pred             C
Q ss_conf             7
Q gi|254780152|r   81 A   81 (82)
Q Consensus        81 l   81 (82)
                      |
T Consensus       140 L  140 (313)
T 2ekl_A          140 L  140 (313)
T ss_dssp             C
T ss_pred             C
T ss_conf             7