HHsearch results for GI: 254780152 and protein with PDBid: 2g76_A

>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}
Probab=99.88  E-value=6.1e-23  Score=146.65  Aligned_cols=81  Identities=53%  Similarity=0.877  Sum_probs=78.2

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611214001
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE   80 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~E   80 (82)
                      +|+++|+||+|+++|+|+||||+++|+++||.|+|+|++++.+|||+++++||+++|+++.+++.+++|.|++..+.|.|
T Consensus        83 vl~~~~~LK~I~~~g~G~D~iD~~~a~~~gI~v~n~p~~~~~~VAE~~i~~iL~l~R~i~~~~~~~~~g~w~~~~~~g~e  162 (335)
T 2g76_A           83 VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTE  162 (335)
T ss_dssp             HHHHCSSCCEEEESSSSCTTBCHHHHHHHTCEEECCSSTTHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCTGGGCBCC
T ss_pred             HHHCCCCCEEEEECCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99319997699966854562669999867905742798763147999999999996167999999980987656767623


Q ss_pred             C
Q ss_conf             7
Q gi|254780152|r   81 A   81 (82)
Q Consensus        81 l   81 (82)
                      |
T Consensus       163 L  163 (335)
T 2g76_A          163 L  163 (335)
T ss_dssp             C
T ss_pred             C
T ss_conf             5