HHsearch results for GI: 254780152 and protein with PDBid: 2gcg_A

>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A
Probab=99.74  E-value=2.4e-18  Score=121.33  Aligned_cols=80  Identities=34%  Similarity=0.486  Sum_probs=72.0

Q ss_pred             HHHC-CCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC---CE
Q ss_conf             0238-8985999816560883336741244136431432435528999999999972779999999859986112---14
Q gi|254780152|r    2 LSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFN---FM   77 (82)
Q Consensus         2 l~~~-~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~---~~   77 (82)
                      |+++ |+||+|+++|+|+||||+++|+++||.|+|+|++++.+|||+++++||+++|++...++.+++|.|....   ..
T Consensus        70 l~~~~~~LK~I~~~~aG~d~id~~~~~~~gi~v~~~~~~~~~~vae~~l~~~l~~~r~~~~~~~~~~~~~~~~~~~~~~~  149 (330)
T 2gcg_A           70 LDAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLC  149 (330)
T ss_dssp             HHHHCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCCSTTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCSCCTTSSC
T ss_pred             HHHCCCCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             97008995499899854360179999867988997898423889999999998876323899999972996423432446


Q ss_pred             EEEC
Q ss_conf             0017
Q gi|254780152|r   78 GVEA   81 (82)
Q Consensus        78 G~El   81 (82)
                      |++|
T Consensus       150 ~~~l  153 (330)
T 2gcg_A          150 GYGL  153 (330)
T ss_dssp             BCCC
T ss_pred             CCEE
T ss_conf             7421