HHsearch results for GI: 254780152 and protein with PDBid: 3hg7_A

>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp}
Probab=99.73  E-value=3.4e-18  Score=120.45  Aligned_cols=75  Identities=20%  Similarity=0.258  Sum_probs=69.9

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCC
Q ss_conf             8023889859998165608833367412441364314324355289999999999727799999998599861121
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNF   76 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~   76 (82)
                      +|+++|+||+|++.|+|+|+ |++++.++||.|+|+|++++.+|||++++++|++.|+++.+++.+++|.|.+...
T Consensus        61 ~l~~~~~Lk~I~~~~aG~D~-~~~~~~~~gI~v~n~~g~~a~~VAE~~l~~iL~l~R~~~~~~~~~~~~~W~~~~~  135 (324)
T 3hg7_A           61 LLAKANKLSWFQSTYAGVDV-LLDARCRRDYQLTNVRGIFGPLMSEYVFGHLLSLMRQLPLYREQQKQRLWQSHPY  135 (324)
T ss_dssp             GGGGCTTCCEEEESSSCCGG-GSCTTSCCSSEEECCCSCCHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCCC
T ss_pred             HHHCCCCCEEEEECCEECCC-CHHHHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCC
T ss_conf             99349996599988855072-0165887898899689856399999999999998521559999987512455787