HHsearch results for GI: 254780152 and protein with PDBid: 3k5p_A

>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}
Probab=99.86  E-value=3.1e-22  Score=142.79  Aligned_cols=82  Identities=33%  Similarity=0.527  Sum_probs=78.2

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             80238898599981656088333674124413643143243552899999999997277999999985998611214001
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE   80 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~E   80 (82)
                      +|+++|+||+|+++|+|+||||+++|+++||.|+|+|++++.+|||++++++|+++|++...+..+++|.|++..+.|.|
T Consensus        74 ~l~~~~~Lk~I~~~gaG~d~Id~~~~~~~gI~V~n~pg~na~aVAE~~i~~iL~l~R~i~~~~~~~~~~~w~~~~~~~~~  153 (416)
T 3k5p_A           74 IFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSRE  153 (416)
T ss_dssp             HHHHCTTCCEEEECSSCCTTBCHHHHHHTTCCEECCSSTTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCCTTCCC
T ss_pred             HHHCCCCCCEEEECCEECCCCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEE
T ss_conf             99339997299989862130069989978979997698662289999999988653102566545431771103667624


Q ss_pred             CC
Q ss_conf             78
Q gi|254780152|r   81 AG   82 (82)
Q Consensus        81 lG   82 (82)
                      +.
T Consensus       154 l~  155 (416)
T 3k5p_A          154 VR  155 (416)
T ss_dssp             ST
T ss_pred             EC
T ss_conf             04