HHSEARCH alignment of GI: 254780152 and SCOP domain: d1dxya2

Alignment
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
Probab=99.76  E-value=2.8e-20  Score=130.62  Aligned_cols=68  Identities=18%  Similarity=0.255  Sum_probs=61.5

Q ss_pred             CHHHCC--CCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHC
Q ss_conf             802388--98599981656088333674124413643143243552899999999997277999999985
Q gi|254780152|r    1 MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHK   68 (82)
Q Consensus         1 il~~~~--~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~   68 (82)
                      +|+++|  +||+|+++|+||||||+++|+++||.|+|+|++++.||||+++++||++.|++..+++.++.
T Consensus        60 vl~~l~~~~Lk~I~~~~vG~d~ID~~~a~~~gI~V~n~P~~~~~aVAE~~~~~~l~l~R~l~~~~~~~e~  129 (131)
T d1dxya2          60 VFEKMHAYGIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYTETAVHNMVYFSLQHLVDFLTKGETSTEV  129 (131)
T ss_dssp             HHHHHHHTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSHHHHHHHHHHHHHHHHHHHHHSCCTTEE
T ss_pred             HHHHCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCHHHHHHHCCC
T ss_conf             9852334774799871554466444311343489995799785459999999999998162888724107


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: D-2-hydroxyisocaproate dehydrogenase
species: Lactobacillus casei [TaxId: 1582]