Query         gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 82
No_of_seqs    110 out of 4711
Neff          6.8 
Searched_HMMs 13730
Date          Sun May 22 20:16:16 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780152.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1ygya2 c.23.12.1 (A:3-98,A:28  99.9 1.5E-23 1.1E-27  148.7   3.1   72    1-72     58-129 (130)
  2 d2naca2 c.23.12.1 (A:1-147,A:3  99.8 3.1E-21 2.3E-25  135.9   0.7   71    1-71    107-185 (186)
  3 d1mx3a2 c.23.12.1 (A:27-125,A:  99.8 6.1E-20 4.5E-24  128.8   5.1   68    1-73     59-126 (133)
  4 d1dxya2 c.23.12.1 (A:1-100,A:3  99.8 2.8E-20 2.1E-24  130.6   1.1   68    1-68     60-129 (131)
  5 d1sc6a2 c.23.12.1 (A:7-107,A:2  99.7 9.9E-19 7.2E-23  122.1   3.2   68    1-70     63-130 (132)
  6 d1j4aa2 c.23.12.1 (A:2-103,A:3  99.7 1.6E-17 1.1E-21  115.5   3.8   65    2-72     62-128 (134)
  7 d1gdha2 c.23.12.1 (A:2-100,A:2  99.7 3.2E-17 2.4E-21  113.7   4.9   57    1-57     60-117 (129)
  8 d1qp8a2 c.23.12.1 (A:1-82,A:26  99.5 4.3E-15 3.1E-19  102.0   3.7   59    1-60     44-102 (121)
  9 d1ygya1 c.2.1.4 (A:99-282) Pho  98.6 1.8E-08 1.3E-12   65.5   4.3   42   40-81      1-42  (184)
 10 d1sc6a1 c.2.1.4 (A:108-295) Ph  98.4 7.7E-08 5.6E-12   61.9   3.6   42   40-81      1-42  (188)
 11 d1gdha1 c.2.1.4 (A:101-291) D-  98.2 4.6E-07 3.3E-11   57.7   4.0   41   41-81      2-45  (191)
 12 d1dxya1 c.2.1.4 (A:101-299) D-  98.2 2.7E-07   2E-11   58.9   2.6   41   41-81      2-43  (199)
 13 d1j4aa1 c.2.1.4 (A:104-300) D-  98.2 4.9E-07 3.6E-11   57.5   3.8   40   42-81      2-41  (197)
 14 d1mx3a1 c.2.1.4 (A:126-318) Tr  98.2 6.6E-07 4.8E-11   56.8   3.7   33   42-74      1-33  (193)
 15 d1qp8a1 c.2.1.4 (A:83-263) Put  98.0 1.2E-06 8.5E-11   55.4   3.2   35   41-75      1-35  (181)
 16 d2naca1 c.2.1.4 (A:148-335) Fo  98.0 1.7E-06 1.3E-10   54.5   3.2   34   42-75      1-34  (188)
 17 d1j6ua1 c.5.1.1 (A:0-88) UDP-N  49.2     3.8 0.00028   19.4   1.8   26   10-35     64-89  (89)
 18 d1p3da1 c.5.1.1 (A:11-106) UDP  40.4     5.8 0.00043   18.4   1.7   25   10-34     71-95  (96)
 19 d2jfga1 c.5.1.1 (A:1-93) UDP-N  25.3      15  0.0011   16.2   1.7   25   10-34     68-92  (93)
 20 d1knxa1 c.98.2.1 (A:1-132) HPr  22.2      26  0.0019   14.8   2.9   41   10-50     87-127 (132)

No 1  
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=99.87  E-value=1.5e-23  Score=148.73  Aligned_cols=72  Identities=32%  Similarity=0.442  Sum_probs=69.3

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCC
Q ss_conf             802388985999816560883336741244136431432435528999999999972779999999859986
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWE   72 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~   72 (82)
                      +|+++|+||+|+++|+||||||+++|+++||.|+|+|++++.+|||++++|||+++|++..+++.+|+|.|.
T Consensus        58 ~l~~~p~Lk~I~~~g~G~d~IDl~~~~~~gI~V~n~p~~~~~~VAE~~~~l~L~l~R~i~~a~~~vr~g~~~  129 (130)
T d1ygya2          58 VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAGEFVPDAVNV  129 (130)
T ss_dssp             HHHTCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCSC
T ss_pred             HHHHCCCCEEEEEECCCCCCHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             986302353886623446403499998779169946998708999999999999981278875544167418


No 2  
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]}
Probab=99.79  E-value=3.1e-21  Score=135.88  Aligned_cols=71  Identities=30%  Similarity=0.330  Sum_probs=68.0

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHH--------HHHHHHHHHCHHHHHHHHHCCCC
Q ss_conf             802388985999816560883336741244136431432435528999--------99999997277999999985998
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHA--------ISLMLAIARQIPVANESTHKGKW   71 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~--------i~l~L~l~R~~~~~~~~~~~g~W   71 (82)
                      +|+++||||+|+++|+|+||||+++|+++||.|+|+|++|+.|||||+        +++++...|++...+..+++|+|
T Consensus       107 ~i~~ap~LKlI~~~g~G~D~VDl~aa~e~gI~V~n~pg~n~~SVAEha~~~~~~~~i~~il~~~r~~~~~~~~v~~G~~  185 (186)
T d2naca2         107 RIAKAKNLKLALTAGIGSDHVDLQSAIDRNVTVAEVTYCNSTTLTAQARYAAGTREILECFFEGRPIRDEYLIVQGGAL  185 (186)
T ss_dssp             HHHHCTTCCEEEESSSCCTTBCHHHHHHTTCEEEECTTTTHCSHHHHHHHHHHHHHHHHHHHHTCCCCGGGEEEETTEE
T ss_pred             HHHCCCCCEEEEEECCCCCCCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             9834822109999256886165889975997899789837588999999998789999999856651166665536605


No 3  
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}
Probab=99.78  E-value=6.1e-20  Score=128.76  Aligned_cols=68  Identities=29%  Similarity=0.416  Sum_probs=61.8

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCC
Q ss_conf             8023889859998165608833367412441364314324355289999999999727799999998599861
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEK   73 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~   73 (82)
                      +|+++|+||+|+++|+|+||||+++|+++||.|+|+|++++ +||||+++|||+++|+++++.    +|+|++
T Consensus        59 ~l~~~~~Lk~I~~~g~G~d~iD~~~~~~~gI~v~n~p~~~~-~vAE~a~~lil~~~R~i~~a~----~g~~~~  126 (133)
T d1mx3a2          59 DLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASV-YSEQASIEMREEAAREIRRAI----TGRIPD  126 (133)
T ss_dssp             HHTTCSSCCEEEESSSCCTTBCHHHHHHTTCEEECCCSTTH-CCHHHHHHHHHHHHHHHHHHH----HSCTTT
T ss_pred             HHHHCCCCEEEEECCCCCCCEEEEEHEECCEEEECCCCCCC-HHHHHHHHHHHHHHHHHHHHH----HCCCCC
T ss_conf             99629997599983877662862103319997874799973-559999999999986479997----125231


No 4  
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
Probab=99.76  E-value=2.8e-20  Score=130.62  Aligned_cols=68  Identities=18%  Similarity=0.255  Sum_probs=61.5

Q ss_pred             CHHHCC--CCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHC
Q ss_conf             802388--98599981656088333674124413643143243552899999999997277999999985
Q gi|254780152|r    1 MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHK   68 (82)
Q Consensus         1 il~~~~--~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~   68 (82)
                      +|+++|  +||+|+++|+||||||+++|+++||.|+|+|++++.||||+++++||++.|++..+++.++.
T Consensus        60 vl~~l~~~~Lk~I~~~~vG~d~ID~~~a~~~gI~V~n~P~~~~~aVAE~~~~~~l~l~R~l~~~~~~~e~  129 (131)
T d1dxya2          60 VFEKMHAYGIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYTETAVHNMVYFSLQHLVDFLTKGETSTEV  129 (131)
T ss_dssp             HHHHHHHTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSHHHHHHHHHHHHHHHHHHHHHSCCTTEE
T ss_pred             HHHHCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCHHHHHHHCCC
T ss_conf             9852334774799871554466444311343489995799785459999999999998162888724107


No 5  
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
Probab=99.71  E-value=9.9e-19  Score=122.10  Aligned_cols=68  Identities=26%  Similarity=0.429  Sum_probs=56.9

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCC
Q ss_conf             8023889859998165608833367412441364314324355289999999999727799999998599
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGK   70 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~   70 (82)
                      +|+++|+||+|+++|+||||||+++|+++||+|+|+|++++.+|||++++||+  .|.+..++...+-+.
T Consensus        63 ~i~~~p~Lk~I~~~gvG~D~IDl~aa~~~gI~V~ntp~~~~~svAe~~~lml~--~~~~~~~d~~~~~~~  130 (132)
T d1sc6a2          63 VINAAEKLVAIGAFAIGTNQVDLDAAAKRGIPVFNAPFSSTQEAQENIGLEVA--GKLIKYSDNGSTLSA  130 (132)
T ss_dssp             HHHHCSSCCEEEECSSCCTTBCHHHHHHTTCCEECCTTTCSHHHHHHHHHHHH--HHHHHHHHHCCCTTB
T ss_pred             HHHCCCCCEEEEEECCCCCCCCHHHHHHCCCEEEECCCCCHHHHHHHHHHHHH--HHHHHHHHCCCCCCC
T ss_conf             52034442267774155455689999859988998999860699999999999--971677757272126


No 6  
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
Probab=99.66  E-value=1.6e-17  Score=115.45  Aligned_cols=65  Identities=23%  Similarity=0.294  Sum_probs=55.0

Q ss_pred             HHHC--CCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCC
Q ss_conf             0238--8985999816560883336741244136431432435528999999999972779999999859986
Q gi|254780152|r    2 LSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWE   72 (82)
Q Consensus         2 l~~~--~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~   72 (82)
                      |+++  ++||+|+++|+||||||+++|+++||.|+|+|++   |||||++++||+++|++.   ..+.+|+|.
T Consensus        62 l~~l~~~~LK~I~~~~vG~d~ID~~aa~~~gI~V~N~P~~---svae~a~~~ml~l~r~~~---~~~~~~k~~  128 (134)
T d1j4aa2          62 LQALADNGITKMSLRNVGVDNIDMAKAKELGFQITNVPVY---SYTTHAVRNMVVKAFDNN---LELVEGKEA  128 (134)
T ss_dssp             HHHHHHTTCCEEEESSSCCTTBCHHHHHHTTCEEECCCCS---CCBHHHHHHHHHHHHHHH---HHHHTTCCC
T ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHCCEEEEECCCC---CHHHHHHHHHHHHHHHHH---HHHHHHHCC
T ss_conf             9540025716999836776766889998598699989998---689999999999999876---887631015


No 7  
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]}
Probab=99.65  E-value=3.2e-17  Score=113.72  Aligned_cols=57  Identities=25%  Similarity=0.341  Sum_probs=49.8

Q ss_pred             CHHHCC-CCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             802388-985999816560883336741244136431432435528999999999972
Q gi|254780152|r    1 MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR   57 (82)
Q Consensus         1 il~~~~-~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R   57 (82)
                      +|+++| +||+|+++|+|+||||+++|+++||+|+|+|++++.||||+++++|+.+++
T Consensus        60 ~l~~~~~~LK~I~~~gvG~d~ID~~~a~~~gI~V~ntpg~~~~aVAE~A~~~~~l~~~  117 (129)
T d1gdha2          60 VIDRIPENIKCISTYSIGFDHIDLDACKARGIKVGNAPHGATQAREDMAHQANDLIDA  117 (129)
T ss_dssp             HHHHSCTTCCEEEEESSCCTTBCHHHHHHTTCEEECCCCSBHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCEEEEECCCCCCCCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             7756500100555515698643699998699989979997756799999999999999


No 8  
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
Probab=99.50  E-value=4.3e-15  Score=102.02  Aligned_cols=59  Identities=12%  Similarity=0.152  Sum_probs=55.3

Q ss_pred             CHHHCCCCCEEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCHH
Q ss_conf             802388985999816560883336741244136431432435528999999999972779
Q gi|254780152|r    1 MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP   60 (82)
Q Consensus         1 il~~~~~Lk~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~l~L~l~R~~~   60 (82)
                      +|+++|+||+|++.|+|+||||+++++ +||.|+|+|++++.+||||++++||+++|++.
T Consensus        44 ~l~~~~~Lk~i~~~~aG~D~i~~~~~~-~~i~v~n~~g~~~~~vae~~~~~il~~~r~l~  102 (121)
T d1qp8a2          44 ELAKMPRLKFIQVVTAGLDHLPWESIP-PHVTVAGNAGSNGYGNERVWRQMVMEAVRNLI  102 (121)
T ss_dssp             HHHHCTTCCCEEBSSSCCTTSCCTTSC-TTSCEECCCSSSSSSCHHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCEEEEECCCCCCCCCHHHHC-CCEEEEECCCCCHHHHHHHHHHHHHHHCCCEE
T ss_conf             996198855998526676877888946-57289978998818999999999998559789


No 9  
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=98.59  E-value=1.8e-08  Score=65.48  Aligned_cols=42  Identities=43%  Similarity=0.714  Sum_probs=38.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEEC
Q ss_conf             435528999999999972779999999859986112140017
Q gi|254780152|r   40 NSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEA   81 (82)
Q Consensus        40 ~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~El   81 (82)
                      |+.|||||++++||++.|++..+++.+++|.|++..+.|.|+
T Consensus         1 N~~sVAE~~~~liL~~~R~i~~~~~~~~~~~W~~~~~~~~~l   42 (184)
T d1ygya1           1 NIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEI   42 (184)
T ss_dssp             SHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCGGGCCBCCC
T ss_pred             CCHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             956999999999999980979999999928998665655212


No 10 
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
Probab=98.41  E-value=7.7e-08  Score=61.94  Aligned_cols=42  Identities=33%  Similarity=0.421  Sum_probs=38.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEEC
Q ss_conf             435528999999999972779999999859986112140017
Q gi|254780152|r   40 NSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEA   81 (82)
Q Consensus        40 ~~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~El   81 (82)
                      |++||||++++++|++.|+++.++..+++|.|++....++||
T Consensus         1 Na~aVAE~~l~~il~l~R~~~~~~~~~~~~~w~~~~~~~~~l   42 (188)
T d1sc6a1           1 NTRSVAELVIGELLLLLRGVPEANAKAHRGVGNKLAAGSFEA   42 (188)
T ss_dssp             THHHHHHHHHHHHHHHHHTHHHHHHHHHHTCCC-----CCCS
T ss_pred             CCHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             978999999999999982969999999828886456654100


No 11 
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]}
Probab=98.22  E-value=4.6e-07  Score=57.66  Aligned_cols=41  Identities=24%  Similarity=0.439  Sum_probs=35.1

Q ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC---CCEEEEC
Q ss_conf             3552899999999997277999999985998611---2140017
Q gi|254780152|r   41 SITTAEHAISLMLAIARQIPVANESTHKGKWEKF---NFMGVEA   81 (82)
Q Consensus        41 ~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~---~~~G~El   81 (82)
                      +.+|||++++|||+++|++..+++.+|+|.|+++   .+.|.||
T Consensus         2 t~AvAE~ai~liL~~~R~i~~~~~~~r~g~w~~~~~~~~~~~~l   45 (191)
T d1gdha1           2 TVATAEIAMLLLLGSARRAGEGEKMIRTRSWPGWEPLELVGEKL   45 (191)
T ss_dssp             HHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCCTTTTCBCCC
T ss_pred             CHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCEE
T ss_conf             78999999999999972788999999839987677656566232


No 12 
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
Probab=98.20  E-value=2.7e-07  Score=58.92  Aligned_cols=41  Identities=27%  Similarity=0.400  Sum_probs=35.9

Q ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC-CCEEEEC
Q ss_conf             3552899999999997277999999985998611-2140017
Q gi|254780152|r   41 SITTAEHAISLMLAIARQIPVANESTHKGKWEKF-NFMGVEA   81 (82)
Q Consensus        41 ~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~-~~~G~El   81 (82)
                      ..||||+++++||++.|++..+++.+++|+|++. .+.|.||
T Consensus         2 p~aVAE~~l~~iL~l~R~~~~~~~~~~~g~w~~~~~~~~~~l   43 (199)
T d1dxya1           2 PAAIAEFALTDTLYLLRNMGKVQAQLQAGDYEKAGTFIGKEL   43 (199)
T ss_dssp             HHHHHHHHHHHHHHHHTTHHHHHHHHHTTCHHHHTCCCCCCG
T ss_pred             CHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             749999999999999809789999998299886667664214


No 13 
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
Probab=98.20  E-value=4.9e-07  Score=57.48  Aligned_cols=40  Identities=25%  Similarity=0.157  Sum_probs=36.4

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCEEEEC
Q ss_conf             5528999999999972779999999859986112140017
Q gi|254780152|r   42 ITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEA   81 (82)
Q Consensus        42 ~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~~~G~El   81 (82)
                      +|||||++++||++.|++..+++.+++|+|.+..+.|+||
T Consensus         2 ~aVAE~~l~~~l~l~r~~~~~~~~~~~~~~~w~~~~g~el   41 (197)
T d1j4aa1           2 NAIAEHAAIQAARILRQDKAMDEKVARHDLRWAPTIGREV   41 (197)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHHHHTTBCCCTTCCBCCG
T ss_pred             CHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             7799999999999992859999999948887588867205


No 14 
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}
Probab=98.15  E-value=6.6e-07  Score=56.78  Aligned_cols=33  Identities=15%  Similarity=0.215  Sum_probs=31.0

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC
Q ss_conf             552899999999997277999999985998611
Q gi|254780152|r   42 ITTAEHAISLMLAIARQIPVANESTHKGKWEKF   74 (82)
Q Consensus        42 ~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~   74 (82)
                      ++|||+++++||+++|++..+++.+|+|.|.+.
T Consensus         1 e~VAE~ai~liL~l~R~i~~~~~~~~~g~w~~~   33 (193)
T d1mx3a1           1 EETADSTLCHILNLYRRATWLHQALREGTRVQS   33 (193)
T ss_dssp             HHHHHHHHHHHHHHHHCHHHHHHHHHTTCCCCS
T ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCC
T ss_conf             948999999999998289999999984996556


No 15 
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
Probab=98.04  E-value=1.2e-06  Score=55.41  Aligned_cols=35  Identities=26%  Similarity=0.321  Sum_probs=32.0

Q ss_pred             CCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
Q ss_conf             35528999999999972779999999859986112
Q gi|254780152|r   41 SITTAEHAISLMLAIARQIPVANESTHKGKWEKFN   75 (82)
Q Consensus        41 ~~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~   75 (82)
                      ++||||+++++||++.|++..+++.+++|+|.+..
T Consensus         1 A~aVAE~~~~liL~~~R~i~~~~~~~~~~~w~~~~   35 (181)
T d1qp8a1           1 ADAVAEFALALLLAPYKRIIQYGEKMKRGDYGRDV   35 (181)
T ss_dssp             HHHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCCCS
T ss_pred             CCHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
T ss_conf             92599999999999981979999999819988777


No 16 
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]}
Probab=97.98  E-value=1.7e-06  Score=54.45  Aligned_cols=34  Identities=29%  Similarity=0.575  Sum_probs=31.1

Q ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCC
Q ss_conf             5528999999999972779999999859986112
Q gi|254780152|r   42 ITTAEHAISLMLAIARQIPVANESTHKGKWEKFN   75 (82)
Q Consensus        42 ~sVAE~~i~l~L~l~R~~~~~~~~~~~g~W~~~~   75 (82)
                      .|||||+++++|++.|++..+++.+++|.|++..
T Consensus         1 isVAE~~l~~iL~~~R~~~~~~~~~~~g~w~~~~   34 (188)
T d2naca1           1 ISVAEHVVMMILSLVRNYLPSHEWARKGGWNIAD   34 (188)
T ss_dssp             HHHHHHHHHHHHHHHTTHHHHHHHHHTTCCCHHH
T ss_pred             CCHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCC
T ss_conf             9589999999999983879999999938998765


No 17 
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}
Probab=49.17  E-value=3.8  Score=19.44  Aligned_cols=26  Identities=23%  Similarity=0.353  Sum_probs=19.6

Q ss_pred             EEEECCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             99981656088333674124413643
Q gi|254780152|r   10 VVGRAGIGTDNVDLVVASRAGIVVMN   35 (82)
Q Consensus        10 ~I~~~g~G~d~ID~~~~~~~gI~v~n   35 (82)
                      +|.+..+--||..+.+|+++||+|.+
T Consensus        64 vV~SsAI~~~npel~~A~~~gIpv~~   89 (89)
T d1j6ua1          64 VIKTPAVRDDNPEIVRARMERVPIEN   89 (89)
T ss_dssp             EEECTTCCTTCHHHHHHHHTTCCEEE
T ss_pred             EEEECCCCCCCHHHHHHHHCCCCCCC
T ss_conf             99825759989999999985998039


No 18 
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
Probab=40.40  E-value=5.8  Score=18.41  Aligned_cols=25  Identities=36%  Similarity=0.454  Sum_probs=16.2

Q ss_pred             EEEECCCCCCCCCHHHHHCCCCEEE
Q ss_conf             9998165608833367412441364
Q gi|254780152|r   10 VVGRAGIGTDNVDLVVASRAGIVVM   34 (82)
Q Consensus        10 ~I~~~g~G~d~ID~~~~~~~gI~v~   34 (82)
                      +|.+.++--||..+.+|+++||+|.
T Consensus        71 vV~S~AI~~~npel~~A~~~gipii   95 (96)
T d1p3da1          71 VVVSSAIKDDNPELVTSKQKRIPVI   95 (96)
T ss_dssp             EEECTTSCTTCHHHHHHHHTTCCEE
T ss_pred             EEECCCCCCCCHHHHHHHHCCCCEE
T ss_conf             9988872998999999998599888


No 19 
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
Probab=25.30  E-value=15  Score=16.16  Aligned_cols=25  Identities=32%  Similarity=0.515  Sum_probs=17.6

Q ss_pred             EEEECCCCCCCCCHHHHHCCCCEEE
Q ss_conf             9998165608833367412441364
Q gi|254780152|r   10 VVGRAGIGTDNVDLVVASRAGIVVM   34 (82)
Q Consensus        10 ~I~~~g~G~d~ID~~~~~~~gI~v~   34 (82)
                      +|.++|+-.||--+..++++||+|.
T Consensus        68 vi~SPGi~~~~~~~~~a~~~gi~ii   92 (93)
T d2jfga1          68 IVASPGIALAHPSLSAAADAGIEIV   92 (93)
T ss_dssp             EEECTTSCTTSHHHHHHHHTTCEEE
T ss_pred             EEECCCCCCCCHHHHHHHHCCCCEE
T ss_conf             9988987999999999998699748


No 20 
>d1knxa1 c.98.2.1 (A:1-132) HPr kinase/phoshatase HprK N-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}
Probab=22.24  E-value=26  Score=14.84  Aligned_cols=41  Identities=12%  Similarity=0.065  Sum_probs=28.1

Q ss_pred             EEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCCHHHHHHH
Q ss_conf             99981656088333674124413643143243552899999
Q gi|254780152|r   10 VVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAIS   50 (82)
Q Consensus        10 ~I~~~g~G~d~ID~~~~~~~gI~v~n~~~~~~~sVAE~~i~   50 (82)
                      +|.+-|.-....=+++|+++||++..++...+.=++.....
T Consensus        87 iIvt~~~~~p~~l~~~a~~~~vPll~T~~~ts~li~~l~~y  127 (132)
T d1knxa1          87 IILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETY  127 (132)
T ss_dssp             EEEETTTCCCHHHHHHGGGTCCCEEEESSCGGGGTTTHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHH
T ss_conf             99979799999999999982996898186199999999999


Done!