BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate
dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
         (82 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254039829|gb|ACT56625.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 82

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
          MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP
Sbjct: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60

Query: 61 VANESTHKGKWEKFNFMGVEAG 82
          VANESTHKGKWEKFNFMGVEAG
Sbjct: 61 VANESTHKGKWEKFNFMGVEAG 82


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AKK+KVVGRAGIG DNVDL  A+ AG++VMNTPFGNSITTAEHAI++M A+AR IP
Sbjct: 58  VLAAAKKLKVVGRAGIGVDNVDLPAATAAGVIVMNTPFGNSITTAEHAIAMMFALARDIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 QANASTHAGKWEKSKFMGVE 137


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA  +KVVGRAGIGTDNVD V AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLAHADNLKVVGRAGIGTDNVDKVAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAISLM+A+ARQIP
Sbjct: 61  IIAAATNLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISLMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKSRFMGVE 140


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAAENLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKSRFMGVE 140


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVDL  ASR GI+VMNTPFGNSITTAEHA+SLM+A+ARQIP
Sbjct: 64  LIEAATNLKVIGRAGIGVDNVDLKAASRRGIIVMNTPFGNSITTAEHAMSLMMAVARQIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST +GKWEK  FMGVE
Sbjct: 124 AADNSTQQGKWEKSKFMGVE 143


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|256255607|ref|ZP_05461143.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|261222811|ref|ZP_05937092.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|260921395|gb|EEX88048.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
          Length = 478

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 126 EADTSTRAGKWEKNRFMGVE 145


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 126 EADTSTRAGKWEKNRFMGVE 145


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EADTSTRAGKWEKNRFMGVE 140


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 126 EADTSTRAGKWEKNRFMGVE 145


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATKLKVVGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKNRFMGVE 140


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIGT+N+DL  A+  G+VVMNTPFGNS+TTAEHAI+LM ++ARQIP
Sbjct: 58  LLAAATRLKVIGRAGIGTENIDLAAATDQGVVVMNTPFGNSVTTAEHAIALMFSLARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 AANASTHLGKWEKSRFMGVE 137


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 61  LLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFACARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKSRFMGVE 140


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 64  LLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFACARQLP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 124 EANASTHAGKWEKSRFMGVE 143


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G+WEK  FMGVE
Sbjct: 126 EADTSTRAGRWEKNRFMGVE 145


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAIS+M+A+ARQIP
Sbjct: 61  LIEQATNLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSRFMGVE 140


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  LLEAATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANVSTHAGKWEKSRFMGVE 140


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score =  123 bits (309), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 69/80 (86%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+GRAGIG DNVD+  AS+ G++VMNTPFGNS+TTAEHAI+LM A+ARQ+P
Sbjct: 60  LLENAGKLKVIGRAGIGVDNVDIPAASKKGVIVMNTPFGNSVTTAEHAIALMFAVARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH+GKWEK  FMGVE
Sbjct: 120 EASVSTHEGKWEKNRFMGVE 139


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score =  123 bits (309), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAEATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADNSTQAGKWEKSKFMGVE 140


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|218516115|ref|ZP_03512955.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 283

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI+LM A+ARQIP
Sbjct: 61  ILEKADRLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIALMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKSKFMGVE 140


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score =  123 bits (308), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 65  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 125 AADTSTQAGKWEKSKFMGVE 144


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score =  123 bits (308), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEAAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 SADASTQAGKWEKSKFMGVE 140


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 44  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 103

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 104 AADTSTQAGKWEKSKFMGVE 123


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KVV RAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 61  LLENATRLKVVARAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFAAARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKSRFMGVE 140


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVD+  ASR GI+VMNTPFGNS+TTAEHAI+LM A+ARQ+P
Sbjct: 61  LLEKAGRLKVIGRAGIGVDNVDISAASRRGIIVMNTPFGNSVTTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH G+WEK  FMGVE
Sbjct: 121 EASASTHAGRWEKNRFMGVE 140


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATRLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKNRFMGVE 140


>gi|218507544|ref|ZP_03505422.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 239

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDNVD   AS+AGI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 46  LLESAPNLKVIGRAGIGTDNVDKEAASKAGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 105

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 106 EASASTHAGKWEKSKFMGVE 125


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AKK+KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANAKKLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKSKFMGVE 140


>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIEAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADSSTQAGKWEKSKFMGVE 140


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAVAMIFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKNRFMGVE 140


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIEAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADSSTQAGKWEKSKFMGVE 140


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKNRFMGVE 140


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADGSTQAGKWEKSKFMGVE 140


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 121 EANASTHAGKWEKNRFMGVE 140


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 61  IIAAATNLKVVGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASTSTHDGKWEKSKFMGVE 140


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKSKFMGVE 140


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+GRAGIG DN+DL  AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 60  LLSAATNLKVIGRAGIGVDNIDLKAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 120 EASASTHAGKWEKSKFMGVE 139


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADGSTQAGKWEKSKFMGVE 140


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADGSTQAGKWEKSKFMGVE 140


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADGSTQAGKWEKSKFMGVE 140


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 49  ILEHATNLKVVGRAGIGVDNVDIPAASAKGVVVMNTPFGNSITTAEHAIALMFALARQLP 108

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 109 EADASTQAGKWEKNRFMGVE 128


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIQGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 67  LLAQATRLKVVGRAGIGVDNVDVPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 127 AADASTQAGKWEKNRFMGVE 146


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 69/80 (86%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A+K+KVVGRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANARKLKVVGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADTSTQAGKWEKSKFMGVE 140


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KV+GRAGIG DNV++  A+ AGIVVMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 60  VIAAAKKLKVIGRAGIGVDNVNIPAATAAGIVVMNTPFGNSITTAEHAIAMMFALARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 120 AADASTQAGKWEKNRFMGVE 139


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+ARQIP
Sbjct: 62  ILANAKNLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLALARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG+E
Sbjct: 122 QADASTQAGKWEKNRFMGIE 141


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAISL++A+ARQIP
Sbjct: 60  VLASAERLKVVGRAGIGVDNVDVPAATARGVIVMNTPFGNSITTAEHAISLLMALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 120 EADRSTQAGKWEKSKFMGVE 139


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 69/80 (86%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK++KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 82  ILANAKRLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITLMLALAREIP 141

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 142 AADASTQAGKWEKNRFMGVE 161


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  LIQAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKNRFMGVE 140


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKADKLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMG+E
Sbjct: 121 EASTSTHAGKWEKSRFMGIE 140


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEHATNLKVVGRAGIGTDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG E
Sbjct: 121 AADASTQAGKWEKSKFMGTE 140


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+KV+GRAGIGTDN+D   AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  IIAAATKLKVIGRAGIGTDNIDKDAASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 58  ILAAATNLKVVGRAGIGVDNVDVPAATARGIVVMNTPFGNSITTAEHAIAMMFALAREIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 EANASTHAGKWEKNRFMGVE 137


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  + V+GRAGIGTDN+D   AS+AGI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLQNAPNLTVIGRAGIGTDNIDKDAASKAGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLEKADHLKVVGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSRFMGVE 140


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 58  ILAAATNLKVVGRAGIGVDNVDVPAATARGIVVMNTPFGNSITTAEHAIAMMFALAREIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 EANASTHAGKWEKNRFMGVE 137


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIGTDNVD   +S+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 448 LLEHATNLKVVGRAGIGTDNVDKEASSKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 507

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 508 EADASTQAGKWEKSKFMGVE 527


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILENATNLKVIGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASSAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN ST   KWEK  FMGVE
Sbjct: 118 EANASTQASKWEKNRFMGVE 137


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANAKNLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 QADASTQAGKWEKNRFMGVE 141


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LINAAGNLKVIGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++STH GKWEK  FMGVE
Sbjct: 121 EASQSTHAGKWEKSKFMGVE 140


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 62  LLAEANRLKVVGRAGIGVDNVDVPAATSRGVIVMNTPFGNSITTAEHAIAMMFALARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 QADASTQAGKWEKNRFMGVE 141


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KVVGRAGIG DNVD+  A+ AG+VVMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 58  VIAAAKNLKVVGRAGIGVDNVDIPSATAAGVVVMNTPFGNSITTAEHAIAMMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 118 AADVSTQAGKWEKNRFMGVE 137


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN ST   KWEK  FMGVE
Sbjct: 118 EANASTQASKWEKNRFMGVE 137


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  IIDAATNLKVVGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKSRFMGVE 140


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN ST   KWEK  FMGVE
Sbjct: 118 EANASTQASKWEKNRFMGVE 137


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 61  ILANATRLKVVGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIAMMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKNRFMGVE 140


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 61  ILENASRLKVIGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG+E
Sbjct: 121 AADASTQAGKWEKNRFMGLE 140


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENADNLKVIGRAGIGTDNIDREAASKRGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKATNLKVVGRAGIGTDNVDKDAASKHGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENATNLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQVP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENATNLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQVP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILAAAPNLKVIGRAGIGTDNIDKEAASKQGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVVGRAGIG DNVD+  A+  G+VVMNTPFGN+ITTAEHAI++M A+ARQIP
Sbjct: 58  VLAAAGKLKVVGRAGIGVDNVDIAAATAGGVVVMNTPFGNAITTAEHAIAMMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 118 QADASTQAGKWEKSKFMGVE 137


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+ RAGIGTDN+D V AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILNAATNLKVIARAGIGTDNIDKVAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 61  ILEKATNLKVVGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 SADASTQAGKWEKNKFMGVE 140


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLEKATNLKVVGRAGIGVDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LML++AR+IP
Sbjct: 63  ILEKATKLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLSLAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 123 AADASTQAGKWEKNRFMGVE 142


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A++ G+VVMNTPFGN++TTAEHAI+++L++ARQIP
Sbjct: 58  ILDAAPNLKVVGRAGIGVDNVDIPEATKRGVVVMNTPFGNAVTTAEHAITMILSLARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ANEST  GKWEK  FMG E
Sbjct: 118 AANESTQAGKWEKSRFMGTE 137


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKASRLKVIGRAGIGVDNVDIPAATARGVIVMNTPFGNSITTAEHAIAMMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 QADASTQAGKWEKNRFMGVE 140


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+     +KV+GRAGIG DNVD+  A+  GI VMNTPFGN+ TTAEHAI++ML++ARQIP
Sbjct: 60  MIEAGTDLKVIGRAGIGVDNVDIDAATATGIAVMNTPFGNATTTAEHAIAMMLSLARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ANESTH+GKWEK  FMG E
Sbjct: 120 QANESTHQGKWEKSRFMGRE 139


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ HA ++KVVGRAGIG DN+D+  A+  GI+VMNTPFGN+ITTAEHAI++M+A+ARQIP
Sbjct: 61  IIVHADQLKVVGRAGIGVDNIDIPKATARGIIVMNTPFGNAITTAEHAIAMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG E
Sbjct: 121 AADASTQAGKWEKSRFMGTE 140


>gi|255603392|ref|XP_002538041.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223514072|gb|EEF24343.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 223

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDAAANLKVVGRAGIGVDNVDIPAASARGVVVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 118 EADASTQAGKWEKNRFMGVE 137


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVDL  A+  G++VMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 61  ILQKAGRLKVIGRAGIGVDNVDLPAATAKGVIVMNTPFGNSITTAEHAIAMMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKNRFMGVE 140


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILEAATNLKVVGRAGIGTDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASVSTHAGKWEKSKFMGVE 140


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  IIERAKRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 QADASTQAGKWEKNRFMGVE 141


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KVV RAGIG DNVD+  AS+ G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 63  VLDAATELKVVARAGIGVDNVDIPAASQKGVIVMNTPFGNSITTAEHAIAMMFAVARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 123 EADASTQAGKWEKSKFMGVE 142


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  IIERAKRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 QADASTQAGKWEKNRFMGVE 141


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  ++VVGRAGIG DNVD+  A+  G+VVMNTPFGNSITTAEHAI++M+A+AR IP
Sbjct: 58  VLAVATNLRVVGRAGIGVDNVDVPAATARGVVVMNTPFGNSITTAEHAIAMMMALARDIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN STH GKWEK  FMGVE
Sbjct: 118 EANASTHAGKWEKNRFMGVE 137


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LML++AR+IP
Sbjct: 62  ILEKATRLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILDAATNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 60  ILEAATNLKVIGRAGIGVDNVDIPAASAQGVVVMNTPFGNSITTAEHAIALMFALARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 120 EADLSTQAGKWEKNRFMGVE 139


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score =  117 bits (293), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI++MLA+AR+IP
Sbjct: 62  ILEKATRLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITMMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVVGRAGIG DN+D+  AS+ G+VVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VLAAATKLKVVGRAGIGVDNIDIPEASKKGVVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T  GKW K +FMGVE
Sbjct: 120 EANALTQAGKWPKNDFMGVE 139


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDHATNLKVIGRAGIGVDNVDIPAASSKGVIVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T +G W K  FMGVE
Sbjct: 118 EANAQTQQGLWPKNGFMGVE 137


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+GRAGIG DNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILAAATNLKVIGRAGIGVDNVDREAASKNGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+AR +P
Sbjct: 58  VLAAATNLKVVGRAGIGVDNVDIPAASAKGVVVMNTPFGNSITTAEHAIALMFALARDLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++ST  GKWEK  FMGVE
Sbjct: 118 EADKSTQAGKWEKNRFMGVE 137


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+GRAG+  DN+DL  A+  G++VMNTPFGNSITTAEHAI+LM A+AR+IP
Sbjct: 61  VLERAERLKVIGRAGVSVDNIDLAAATAKGVIVMNTPFGNSITTAEHAIALMFALARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST +GKWEK  F+GVE
Sbjct: 121 AADASTRQGKWEKARFLGVE 140


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKAAKLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A K+KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILANAHKLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKNAFMGVE 140


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDHATNLKVIGRAGIGVDNVDIPAASAKGVIVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T +G W K  FMGVE
Sbjct: 118 EANAQTQQGLWPKNGFMGVE 137


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKANRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILEKATNLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 QADASTQAGKWEKNRFMGVE 141


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILDNATNLKVIARAGIGTDNIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKANRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 122 AADASTQAGKWEKNRFMGVE 141


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILDNATNLKVIARAGIGTDNIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSKFMGVE 140


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/73 (72%), Positives = 62/73 (84%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KV+GRAGIGTDN+D   AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP A+ STH
Sbjct: 68  LKVIGRAGIGTDNIDKDAASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIPEASASTH 127

Query: 68  KGKWEKFNFMGVE 80
            GKWEK  FMGVE
Sbjct: 128 AGKWEKSKFMGVE 140


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  ++V+GRAGIG DNVD+  AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  VIAAADNLRVIGRAGIGVDNVDIPHASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASASTHAGKWEKSRFMGVE 140


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A K+KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILANAHKLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMGVE
Sbjct: 121 EASVSTHAGKWEKNAFMGVE 140


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 127 AADASTQAGKWEKNRFMGVE 146


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 127 AADASTQAGKWEKNRFMGVE 146


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMG E
Sbjct: 121 EASTSTHAGKWEKSKFMGTE 140


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 127 AADASTQAGKWEKNRFMGVE 146


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 127 AADASTQAGKWEKNRFMGVE 146


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VIAAAHKLRVIARAGIGVDNVDIPAATAKGIVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 120 AADASTQAGKWEKNRFMGVE 139


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANADNLKVIARAGIGTDNIDKEAASKRGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ STH GKWEK  FMG E
Sbjct: 121 EASASTHAGKWEKSKFMGTE 140


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEAADNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 EASASTQAGKWEKSKFMGVE 140


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +KV+GRAGIG DNVD+  A+  GI+VMNTPFGN+ITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAAENLKVIGRAGIGVDNVDIPKATARGIIVMNTPFGNAITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG E
Sbjct: 121 AADTSTQSGKWEKSRFMGRE 140


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+++LA+ARQIP
Sbjct: 61  ILEAATNLKVIGRAGIGVDNVDIPAASERGVVVMNTPFGNSITTAEHAIAMLLALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T  G+W K +FMG+E
Sbjct: 121 QANARTQAGEWPKSDFMGIE 140


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  A+  GI+VMNTPFGN+ITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAADNLKVVGRAGIGVDNVDIPKATARGIIVMNTPFGNAITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG E
Sbjct: 121 AADASTQAGKWEKSRFMGRE 140


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VIAAANKLRVIARAGIGVDNVDIPAATAKGIVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 120 AADVSTQGGKWEKNRFMGVE 139


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 66/80 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VVGRAG+G DNVD+  A+  G+VVMNTP+GNS+TTAEH I+LM+A+ARQIP
Sbjct: 61  LLARAGRLRVVGRAGVGVDNVDVGAATAHGVVVMNTPYGNSVTTAEHTIALMMALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTRAGKWEKSRFMGVE 140


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNS+TTAEHAI+LM A+AR+IP
Sbjct: 61  IIARGGRLKVIGRAGIGVDNVDIPAATARGVIVMNTPFGNSVTTAEHAIALMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKNRFMGVE 140


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +K++KV+GRAGIG DN+DL  A+  G VVMNTPFGNSITTAEHAI+L+L+ ARQIP
Sbjct: 58  IIEKSKRLKVIGRAGIGVDNIDLEAATNNGKVVMNTPFGNSITTAEHAITLILSTARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++TH+GKWEK +  GVE
Sbjct: 118 FADKTTHEGKWEKSSIKGVE 137


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHA+++M A+ARQIP
Sbjct: 60  ILDAATNLKVIGRAGIGVDNVDIPYASSKGVVVMNTPFGNSITTAEHAVAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+  T  G+W K +FMGVE
Sbjct: 120 QADRRTQAGEWPKNDFMGVE 139


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNV++  A+  GI+VMNTPFGN+ITTAEHAI++M ++ARQIP
Sbjct: 61  IIEAATNLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNAITTAEHAIAMMFSVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 121 AADASTQAGKWEKSKFMGVE 140


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 72  ILDAATNLKVIGRAGIGVDNVDIPAASAQGVVVMNTPFGNSITTAEHAIAMMFALARQIP 131

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T  G W K  FMGVE
Sbjct: 132 EANAQTQAGLWPKNGFMGVE 151


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 49  ILDAATNLKVIGRAGIGVDNVDIPYASAKGVIVMNTPFGNSITTAEHAIALMFALARQLP 108

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T  G W K  FMGVE
Sbjct: 109 EANAQTQAGLWPKNGFMGVE 128


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 67/80 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A++++VVGRAGIG DNVD+  A+  G++VMNTP GN++TTAEHAI++MLA+AR+IP
Sbjct: 63  LLDKAERLRVVGRAGIGVDNVDVPAATARGVIVMNTPHGNAVTTAEHAIAMMLALAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST +G+WEK  F+G+E
Sbjct: 123 QADASTQQGRWEKNRFLGIE 142


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++++A+ARQIP
Sbjct: 70  ILDAATNLKVIGRAGIGVDNVDVPYASGKGVVVMNTPFGNSITTAEHAIAMIMALARQIP 129

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+  T  G+W K +FMGVE
Sbjct: 130 QADRRTQAGEWPKNDFMGVE 149


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  A+  GIVVMNTPFGN+ITTAEHAI++M A+ RQIP
Sbjct: 61  IIKAATNLKVIGRAGIGVDNVDIPAATAKGIVVMNTPFGNAITTAEHAIAMMFAVTRQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMG E
Sbjct: 121 AADVSTQAGKWEKSRFMGNE 140


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAGIG DNVD+  A+  G++VMNTP GN++TTAEHAI+LMLA+AR+IP
Sbjct: 63  LLERAGRLRVVGRAGIGVDNVDVPAATARGVIVMNTPHGNAVTTAEHAIALMLALAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G+WEK  F+G+E
Sbjct: 123 QADASTQAGRWEKNRFLGIE 142


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  A+  G+VVMNTP+GN+ITTAEHAI LM A+AR++P
Sbjct: 58  LLDAATNLKVIGRAGIGVDNVDVKSATARGVVVMNTPYGNAITTAEHAIGLMFALARELP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  GKWEK  FMGVE
Sbjct: 118 EASASTKAGKWEKNRFMGVE 137


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/80 (63%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+KV+GRAGIG DN+DL  A+  G VVMNTPFGNSITTAEHAI+L+L+ ARQIP
Sbjct: 58  VIESCKKLKVIGRAGIGVDNIDLEAATNNGKVVMNTPFGNSITTAEHAITLLLSTARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++TH GKWEK +  G+E
Sbjct: 118 FASQTTHAGKWEKSSIKGIE 137


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++++A+AR IP
Sbjct: 67  ILDAATNLKVIGRAGIGVDNVDIPYASGKGVVVMNTPFGNSITTAEHAIAMIMALARMIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+  T  G+W K +FMG+E
Sbjct: 127 AADARTQNGEWPKKDFMGIE 146


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DN+D+  A+  G+VVMNTPFGN+ITTAEHAI+++ A ARQIP
Sbjct: 58  VIAAATNLKVIGRAGIGVDNIDIKAATAKGVVVMNTPFGNAITTAEHAIAMLFAAARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN  T  GKW K  +MGVE
Sbjct: 118 AANADTQAGKWPKSGYMGVE 137


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  AS+ G++VMNTP+GN++TTAEHAI+LM+A AR IP
Sbjct: 58  VLAAASRLKVVGRAGIGVDNVDIHAASKRGVIVMNTPYGNTVTTAEHAIALMMAAARMIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G+WEK  F GVE
Sbjct: 118 QATMSLKAGQWEKSRFQGVE 137


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN+ITTAEH +S+M+++AR+IP
Sbjct: 63  VLEGATRLKVIGRAGAGLDNVDLPAATNRGIVVMNTPGGNTITTAEHTVSMMMSMARRIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWEK  FMG+E
Sbjct: 123 QANASNRSGKWEKSKFMGIE 142


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN++TTAEH +SL++++AR+IP
Sbjct: 61  ILKNADRLKVIGRAGAGLDNVDLEAATERGIVVMNTPGGNTVTTAEHTMSLLMSMARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWEK  FMGVE
Sbjct: 121 QANASNKAGKWEKSKFMGVE 140


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN++TTAEH +SL++++AR+IP
Sbjct: 61  ILKNADRLKVIGRAGAGLDNVDLEAATERGIVVMNTPGGNTVTTAEHTMSLLMSMARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWEK  FMGVE
Sbjct: 121 QANASNKAGKWEKSKFMGVE 140


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG G DNVD + A++ GIVVMNTP GN+ITTAEHAI+++ ++AR+IP
Sbjct: 57  IIDAADKLKVIGRAGTGVDNVDKIAATKKGIVVMNTPGGNTITTAEHAIAMLFSLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  FMGVE
Sbjct: 117 QATASMKSGKWEKKKFMGVE 136


>gi|11498419|ref|NP_069647.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus fulgidus DSM
           4304]
 gi|3122861|sp|O29445|SERA_ARCFU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2649798|gb|AAB90429.1| phosphoglycerate dehydrogenase (serA) [Archaeoglobus fulgidus DSM
           4304]
          Length = 527

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+TAEHAI+LMLA AR+IP
Sbjct: 57  VIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +GKWE+  FMG+E
Sbjct: 117 QADRSVKEGKWERKKFMGIE 136


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A K+KVVGRAGIG DN+D+  A+  G+ VMNTPFGN++TTAEHAI+++ A ARQIP
Sbjct: 59  VFAKADKLKVVGRAGIGVDNIDIPAATAKGVAVMNTPFGNAVTTAEHAIAMLFAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+  T  G+W K +++G E
Sbjct: 119 AASARTQNGEWPKKDYVGTE 138


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+GRAGIG DNVD   AS+ GI+VMNTPFGN+ITTAE  ++L +A AR IP 
Sbjct: 59  IAAASRLKVIGRAGIGVDNVDTPAASQKGIIVMNTPFGNAITTAELGVTLAMAAARHIPA 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A  ST  GKWEK  FMG E
Sbjct: 119 ATASTKAGKWEKSRFMGRE 137


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML HA +++V+GRAG+G DN++L  A+R GI VMNTP  N+I  AEH I LMLA+AR IP
Sbjct: 59  MLEHADQLRVIGRAGVGVDNIELEAATRKGIAVMNTPGANAIAVAEHTIGLMLALARFIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A E+ H GKWEK +  G E
Sbjct: 119 RATETMHAGKWEKKSLQGTE 138


>gi|114775665|ref|ZP_01451233.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
 gi|114553776|gb|EAU56157.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
          Length = 529

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KV+GRAGIG DNVD+   SR G VVMNTPFGN+ITTAE A++ ++A AR IP
Sbjct: 58  LLDAAKRVKVIGRAGIGVDNVDVETCSRRGTVVMNTPFGNTITTAELAVAHIVAAARMIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G WEK  FMG+E
Sbjct: 118 QASASTRAGLWEKNRFMGME 137


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+ V+GRAG G DN+D+  AS+ GIVVMNTP GN++TT EHAI++ML++AR+IP
Sbjct: 59  ILDSADKLTVIGRAGAGVDNIDVEAASKKGIVVMNTPGGNTVTTGEHAIAMMLSLARKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  FMG E
Sbjct: 119 QATASMKAGKWEKSRFMGNE 138


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++VVGRAG+G DN+D+  A+  GIVVMN P GN+ITTAEH I+L++A+AR+IP
Sbjct: 88  LLDGAPALRVVGRAGVGVDNIDVPAATERGIVVMNAPDGNTITTAEHTIALLIALARRIP 147

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+WE+  F+GVE
Sbjct: 148 QANSSLKSGRWERKTFIGVE 167


>gi|330509011|ref|YP_004385439.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
 gi|328929819|gb|AEB69621.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
          Length = 525

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK++KV+GRAG+G DNVD+  A++ GI+V+NTP GN+I+ AEH I++MLA+AR IP
Sbjct: 56  VINAAKRLKVIGRAGVGIDNVDVEAATKKGIIVLNTPGGNTISAAEHTIAMMLALARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN + H+G+W +  + GVE
Sbjct: 116 QANSALHQGEWNRKKYTGVE 135


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++V+GRAG+G DNVDL  A+ AG++VMNTP GN+I+ AEH ++LMLA+AR IP
Sbjct: 55  VLEKGPKLRVIGRAGVGVDNVDLEAATAAGVLVMNTPGGNAISVAEHTLALMLAMARHIP 114

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  ST  GKWEK  FMG E
Sbjct: 115 QATASTCGGKWEKKKFMGNE 134


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 61/74 (82%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+RAGIVV+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  QLKIIGRAGVGVDNVDVAAATRAGIVVVNSPEGNTIAAAEHALAMMLSLSRYIPEANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
             GKW++  F+GVE
Sbjct: 123 KSGKWDRKKFIGVE 136


>gi|284161805|ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
 gi|284011802|gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
          Length = 525

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+K++GRAG+G DN+D+  A+  GIVV+N P GNS++ AEH I L+L+IAR+IP
Sbjct: 57  VIDRAKKLKIIGRAGVGVDNIDVDYATEKGIVVVNAPGGNSVSAAEHTIGLILSIARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +GKWE+  F+G+E
Sbjct: 117 QADRSVKEGKWERKKFVGIE 136


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG G DNVD   A+R GIVVMNTP GN++TTAEH ++++ +++R+IP
Sbjct: 57  VIAAASQLKVVGRAGSGLDNVDTPAATRRGIVVMNTPGGNTVTTAEHTMAMIFSMSRRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  ST  GKWEK  FMGVE
Sbjct: 117 QATASTKGGKWEKEKFMGVE 136


>gi|260881561|ref|ZP_05404709.2| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
 gi|260848763|gb|EEX68770.1| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
          Length = 558

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 86  VIARAKKLKIIGRAGVGVDNIDIPAATAKGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 145

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +ANE+ HKG+W +  ++GVE
Sbjct: 146 IANETMHKGEWNRKKYVGVE 165


>gi|116751067|ref|YP_847754.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700131|gb|ABK19319.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 526

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVV RAGIG DNVD+  AS+ GIVVMNTP GN +TTAEHAI+++LA++R IP
Sbjct: 58  IIDAADNLKVVARAGIGLDNVDVEAASKRGIVVMNTPEGNIVTTAEHAIAMILALSRSIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  FMG E
Sbjct: 118 QATNSIKSGKWEKKRFMGRE 137


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++VVGRAG+G DN+D+  A+  GIVVMN P GN+ITTAEH ++L++A+AR++P
Sbjct: 60  LMDAATNLRVVGRAGVGVDNIDVPAATARGIVVMNAPDGNTITTAEHTVALLIALARRVP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKW++ +F+GVE
Sbjct: 120 QANSSLKSGKWDRKSFIGVE 139


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLAI+R IP
Sbjct: 57  IIEAANQLKIIGRAGVGVDNVDVPAATRKGIVVVNSPEGNTIAAAEHAIAMMLAISRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKWE+  FMGVE
Sbjct: 117 DADNSVKNGKWERNRFMGVE 136


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DNVD+  A++ GI+VMNTP GN+I+TAEHA SLM++ AR IP
Sbjct: 61  VIEAATNLKVIGRAGVGVDNVDVDAATKRGIIVMNTPGGNTISTAEHAFSLMVSTARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKW++  F+GVE
Sbjct: 121 QADASVKSGKWDRKTFVGVE 140


>gi|327401404|ref|YP_004342243.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
 gi|327316912|gb|AEA47528.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
          Length = 523

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 65/80 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK++++GRAG+G DN+D+  A++ GI+V+N P GNS++TAEH ++L+LA+AR+IP
Sbjct: 57  VIEAAKKLRIIGRAGVGVDNIDVQAATQHGIIVVNAPGGNSVSTAEHTLALILAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+WE+  F+G+E
Sbjct: 117 QADRSVKEGRWERKKFIGME 136


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KVVGRAG G DNV++  A++ GIVVMNTP GN++TT EHAIS+MLA+AR IP
Sbjct: 58  VLEVASRLKVVGRAGTGLDNVNIPEATKRGIVVMNTPGGNTVTTGEHAISMMLALARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+WEK  F G E
Sbjct: 118 QAAHSMREGRWEKKRFQGRE 137


>gi|119356910|ref|YP_911554.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354259|gb|ABL65130.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
          Length = 526

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+K++GRAG G DN+D+  A+R GI+VMNTP GN+I+ AEH   +MLA ARQIP
Sbjct: 57  IIELGKKLKLIGRAGAGVDNIDIEAATRNGIIVMNTPGGNTISAAEHTCGMMLAAARQIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      GKW+K  FMGVE
Sbjct: 117 QATAELKNGKWDKKKFMGVE 136


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +KK++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSKKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN ST  GKWE+  F+G E
Sbjct: 117 IANSSTFLGKWERKKFVGNE 136


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AK +KVVGRAGIG DNVD+  A++ G++VMNTP GN ITTAEHA+++M+++ R IP
Sbjct: 58  LLSTAKNLKVVGRAGIGLDNVDIPAATKHGVIVMNTPGGNVITTAEHAVAMMMSMTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKWEK N  G E
Sbjct: 118 WGTASLKAGKWEKKNLEGRE 137


>gi|220931993|ref|YP_002508901.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
 gi|219993303|gb|ACL69906.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
          Length = 527

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A+ +KV+GRAG G DN+D+  AS+ GI+V NTP GN+I+  EH I +MLA++R IP 
Sbjct: 58  LDKARNLKVIGRAGTGYDNIDIEEASKRGIIVFNTPTGNTISAVEHTIGMMLALSRNIPQ 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN++ H+G W++  +MGVE
Sbjct: 118 ANQALHEGIWDRKKYMGVE 136


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +KK++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSKKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN ST  GKWE+  F+G E
Sbjct: 117 IANSSTFLGKWERKKFVGNE 136


>gi|86157688|ref|YP_464473.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774199|gb|ABC81036.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 528

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+SIT AE A+S++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSITVAELALSMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  F G E
Sbjct: 119 AATASVKAGKWEKKRFQGHE 138


>gi|178056550|ref|NP_001116634.1| D-3-phosphoglycerate dehydrogenase [Sus scrofa]
 gi|166977567|sp|A5GFY8|SERA_PIG RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|147223383|emb|CAN13230.1| phosphoglycerate dehydrogenase [Sus scrofa]
          Length = 533

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VINAAKKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|207079971|ref|NP_001128745.1| DKFZP469K2432 protein [Pongo abelii]
 gi|55725727|emb|CAH89645.1| hypothetical protein [Pongo abelii]
          Length = 329

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE A  +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELACGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           VAN ST  GKWE+  F+G E
Sbjct: 117 VANSSTLSGKWERKKFVGNE 136


>gi|94265988|ref|ZP_01289711.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase,
           NAD-binding [delta proteobacterium MLMS-1]
 gi|93453454|gb|EAT03870.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase,
           NAD-binding [delta proteobacterium MLMS-1]
          Length = 304

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ +KVVGRAGIG DNVD+  AS+ G+VVMN P GN+ T AEHA+S+M+A+ R IP
Sbjct: 57  ILEAAENLKVVGRAGIGLDNVDVPAASKKGVVVMNAPDGNATTAAEHAVSMMMALTRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  F G E
Sbjct: 117 QATASMKAGKWEKKKFQGHE 136


>gi|224370615|ref|YP_002604779.1| D-3-phosphoglycerate dehydrogenase [Desulfobacterium autotrophicum
           HRM2]
 gi|223693332|gb|ACN16615.1| SerA1 [Desulfobacterium autotrophicum HRM2]
          Length = 526

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A+R G+ VMNTP GN++TTAEHAIS+M+A+ R IP
Sbjct: 58  ILDAATHLKVVGRAGIGLDNVDIPEATRHGVAVMNTPGGNTVTTAEHAISMMMALTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
               +  KG WEK N  G E
Sbjct: 118 RGTATLKKGLWEKKNLQGRE 137


>gi|167041185|gb|ABZ05943.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_001L24]
          Length = 311

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KV+ RAG G DN+D+  A    ++VMNTP GN+  TAEHA++L++++ R+IP AN+
Sbjct: 62  AKKLKVIARAGAGVDNIDVPTAKENNMLVMNTPGGNANATAEHALALIMSVLRKIPYAND 121

Query: 65  STHKGKWEKFNFMGVE 80
           +THKGKWEK N  G E
Sbjct: 122 TTHKGKWEKKNIKGAE 137


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ GIVV+N+P GN+I  AEHA++LML+++R IP
Sbjct: 57  VIEAATQLKIIGRAGVGVDNVDVPTATKKGIVVVNSPEGNTIAAAEHALALMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S   GKWE+  F GVE
Sbjct: 117 DANQSVKAGKWERKKFTGVE 136


>gi|147676347|ref|YP_001210562.1| D-3-phosphoglycerate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
 gi|146272444|dbj|BAF58193.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [Pelotomaculum thermopropionicum SI]
          Length = 526

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KVVGRAG+G DN+D+  A+  GI+V+N P GN++  AEH I++ML++AR IP
Sbjct: 58  IIEKAARLKVVGRAGVGVDNIDVPAATARGILVVNAPEGNTLAVAEHTIAMMLSLARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKW+K +FMGVE
Sbjct: 118 QANASLRAGKWDKKSFMGVE 137


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP ANES 
Sbjct: 63  QLKIIGRAGVGVDNIDVKAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIPAANESV 122

Query: 67  HKGKWEKFNFMGVE 80
              KW++  FMG E
Sbjct: 123 KANKWDRKRFMGAE 136


>gi|298705972|emb|CBJ29093.1| D-3-phosphoglycerate dehydrogenase [Ectocarpus siliculosus]
          Length = 623

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  MKV+GRAG+G DN+D+  A+R G++VMNTP GN+++TA+ AISL+ + AR+IP
Sbjct: 139 LLAKATNMKVIGRAGVGIDNIDVAEATRKGVLVMNTPGGNTVSTAQLAISLLCSAARRIP 198

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKWE+  FMG E
Sbjct: 199 EADISMKAGKWERKKFMGQE 218


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAATQLKIIGRAGVGVDNIDVQAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S    KWE+  F+G E
Sbjct: 117 EANQSVKNDKWERKRFIGAE 136


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++M+A+AR IP
Sbjct: 85  IIQAGSQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMMALARHIP 144

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S  + KWE+  F+G E
Sbjct: 145 DANKSVKESKWERKQFIGTE 164


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           VAN ST  GKWE+  F+G E
Sbjct: 117 VANNSTLLGKWERKKFVGNE 136


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 59/74 (79%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  QLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
            + KW++  FMG E
Sbjct: 123 KENKWDRKRFMGTE 136


>gi|197123004|ref|YP_002134955.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
 gi|196172853|gb|ACG73826.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
          Length = 528

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+S+T AE A++++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSVTVAELALAMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  F G E
Sbjct: 119 AATASVKAGKWEKKRFQGHE 138


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN ST  GKWE+  F+G E
Sbjct: 117 IANSSTLLGKWERKKFVGNE 136


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 63/80 (78%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSNKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN ST  GKWE+  F+G E
Sbjct: 117 IANSSTLLGKWERKKFVGNE 136


>gi|220917793|ref|YP_002493097.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955647|gb|ACL66031.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 528

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+S+T AE A++++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSVTVAELALAMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  F G E
Sbjct: 119 AATASVKAGKWEKKRFQGHE 138


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +K++GRAG+G DNVD+  A+  GI+V N P GN+I   EH +S+MLA++R IP
Sbjct: 58  VIAAGKNLKIIGRAGVGIDNVDVPAATEKGIIVANAPEGNTIAACEHTLSMMLAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWE+  FMGVE
Sbjct: 118 QANASLKSGKWERSKFMGVE 137


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  AS+ GIVVMN P GN+ T AEHA+++M+A+ R +P
Sbjct: 57  IIEAADNLKVVGRAGIGLDNVDVAAASQKGIVVMNAPDGNATTAAEHAVAMMMALTRNVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK  F G E
Sbjct: 117 QATASMKEGKWEKKKFQGRE 136


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +K VGRAG+G DN+D+  A+R GI+V+N P GN+I+TAEH  ++++A+AR IP
Sbjct: 59  LLAGARNLKAVGRAGVGVDNIDIEAATRRGIIVVNAPDGNTISTAEHTFAMLMALARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++ +F+GVE
Sbjct: 119 QAYASIQSGKWDRKSFVGVE 138


>gi|153005366|ref|YP_001379691.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
 gi|152028939|gb|ABS26707.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
          Length = 528

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAG+G DNVDL  A+R G+VVMNTP G+SIT AE A+S++LA++R + 
Sbjct: 59  LLDKAARLKVIGRAGVGVDNVDLAAATRRGVVVMNTPGGSSITVAELALSMILALSRHVA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  F G E
Sbjct: 119 AATGSVKAGKWEKKRFQGHE 138


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 60/74 (81%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  QLKIIGRAGVGVDNIDVPAATRRGIMVVNSPEGNTIAAAEHALAMMLSLSRHIPEANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
            + KWE+ NF+G E
Sbjct: 123 KEKKWERKNFIGSE 136


>gi|197098608|ref|NP_001126309.1| D-3-phosphoglycerate dehydrogenase [Pongo abelii]
 gi|71153760|sp|Q5R7M2|SERA_PONAB RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|55731044|emb|CAH92238.1| hypothetical protein [Pongo abelii]
          Length = 533

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 183 VIEAANQLKIIGRAGVGVDNVDVPAATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 242

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKW++ +F GVE
Sbjct: 243 AASQSVKSGKWDRKSFTGVE 262


>gi|5771523|gb|AAD51415.1|AF171237_1 3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|2674062|gb|AAB88664.1| 3-phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 533

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|23308577|ref|NP_006614.2| D-3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|21264510|sp|O43175|SERA_HUMAN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|12653075|gb|AAH00303.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|12655003|gb|AAH01349.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|15030035|gb|AAH11262.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|48145707|emb|CAG33076.1| PHGDH [Homo sapiens]
 gi|56204622|emb|CAI22212.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205096|emb|CAI22407.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|119577112|gb|EAW56708.1| phosphoglycerate dehydrogenase, isoform CRA_b [Homo sapiens]
 gi|123982516|gb|ABM82999.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|157928102|gb|ABW03347.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|189067496|dbj|BAG37755.1| unnamed protein product [Homo sapiens]
 gi|261860040|dbj|BAI46542.1| phosphoglycerate dehydrogenase [synthetic construct]
          Length = 533

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|312144313|ref|YP_003995759.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
 gi|311904964|gb|ADQ15405.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
          Length = 534

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           LS AK +KV+GRAG G DN+DL  A++ GI V NTP GN+I+  EH + LMLA+AR IP 
Sbjct: 59  LSKAKSLKVIGRAGTGYDNIDLDEATKKGIFVFNTPTGNTISAVEHTLGLMLALARNIPQ 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN++ H   W++  + GVE
Sbjct: 119 ANQALHNDIWDRKKYQGVE 137


>gi|148727271|ref|NP_001092041.1| D-3-phosphoglycerate dehydrogenase [Pan troglodytes]
 gi|156633629|sp|A5A6P1|SERA_PANTR RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|146741516|dbj|BAF62414.1| phosphoglycerate dehydrogenase [Pan troglodytes verus]
          Length = 533

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 61/79 (77%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+K++ RAG+GTDN+D+  A+  GIVV+N P GN+I  AEH I++MLA+AR IP 
Sbjct: 58  INAAKKLKIIARAGVGTDNIDVAAATERGIVVVNAPEGNTIAAAEHTIAMMLALARNIPQ 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +  +G+WEK  F+GVE
Sbjct: 118 ASAALKQGRWEKKKFVGVE 136


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIAAGTQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S    KWE+  F+G E
Sbjct: 117 EANQSVKNNKWERKRFIGAE 136


>gi|158522862|ref|YP_001530732.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511688|gb|ABW68655.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 527

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNV++  A++ GIVVMNTP GN+ITTAEHAI++M+A++R IP
Sbjct: 58  VITAATNLKVIGRAGIGLDNVNVPAATQKGIVVMNTPTGNTITTAEHAIAMMMALSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G+WEK    G E
Sbjct: 118 QATISLKAGRWEKKKLQGQE 137


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 59/75 (78%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN+S
Sbjct: 62  KQLKIIGRAGVGVDNVDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPEANQS 121

Query: 66  THKGKWEKFNFMGVE 80
               +W++  F+G E
Sbjct: 122 VKNSQWDRKRFIGAE 136


>gi|56204623|emb|CAI22213.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205098|emb|CAI22409.1| phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 499

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 29  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 88

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 89  QATASMKDGKWERKKFMGTE 108


>gi|193787479|dbj|BAG52685.1| unnamed protein product [Homo sapiens]
          Length = 499

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 29  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 88

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 89  QATASMKDGKWERKKFMGTE 108


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  QLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPEANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
              KWE+  F+G E
Sbjct: 123 KNNKWERKRFIGAE 136


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG G DN+D   A+ AGI+VMNTP GN+++ AEH  +++ A+ARQIP A+ + 
Sbjct: 77  RLKIIGRAGTGVDNIDTDAATHAGIIVMNTPGGNTLSAAEHTCAMISALARQIPQAHATM 136

Query: 67  HKGKWEKFNFMGVE 80
            +GKW++ NFMGVE
Sbjct: 137 KQGKWDRKNFMGVE 150


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/75 (54%), Positives = 58/75 (77%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K +K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP ANES
Sbjct: 62  KNLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSMSRFIPAANES 121

Query: 66  THKGKWEKFNFMGVE 80
              G+W +  F GVE
Sbjct: 122 MKAGEWNRKAFTGVE 136


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  IIEAADKLKIIGRAGVGVDNVDVQAATRKGIVVVNSPEGNTIAAAEHALAMMLSMSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S    +W++  F+GVE
Sbjct: 117 EANQSIINAQWDRKKFVGVE 136


>gi|301786056|ref|XP_002928441.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Ailuropoda
           melanoleuca]
 gi|281341105|gb|EFB16689.1| hypothetical protein PANDA_018382 [Ailuropoda melanoleuca]
          Length = 533

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|90079521|dbj|BAE89440.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|218781218|ref|YP_002432536.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762602|gb|ACL05068.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 526

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A++ G+VVMNTP GN +TTAEHAIS+ML++ R IP
Sbjct: 58  LLEAAPNLKVVGRAGIGLDNVDIPAATKRGVVVMNTPGGNVVTTAEHAISMMLSLTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKW+K    G E
Sbjct: 118 RGTASLKAGKWDKKLLQGKE 137


>gi|90076160|dbj|BAE87760.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|109014689|ref|XP_001114128.1| PREDICTED: d-3-phosphoglycerate dehydrogenase isoform 3 [Macaca
           mulatta]
          Length = 533

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|166900094|sp|Q60HD7|SERA_MACFA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|90075028|dbj|BAE87194.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|52782263|dbj|BAD51978.1| 3-phosphoglycerate dehydrogenase [Macaca fascicularis]
          Length = 533

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S AKK++++GRAG+G DNVD+  A+R G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  VISEAKKLRIIGRAGVGVDNVDVPTATRKGVLVVNSPGGNTIAAAEHALAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G W++  ++G E
Sbjct: 117 PANASMFAGGWDRKKYVGNE 136


>gi|330839849|ref|YP_004414429.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329747613|gb|AEC00970.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
          Length = 527

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 56  VIDKAAKLKIIGRAGVGVDNIDVAAATARGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +ANE+  KG+W +  ++GVE
Sbjct: 116 IANETMQKGEWNRKKYVGVE 135


>gi|260888757|ref|ZP_05900020.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
 gi|260861510|gb|EEX76010.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 58  VIDKAAKLKIIGRAGVGVDNIDVAAATARGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +ANE+  KG+W +  ++GVE
Sbjct: 118 IANETMQKGEWNRKKYVGVE 137


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN ST  GKWE+  F+G E
Sbjct: 117 FANSSTLLGKWERKKFVGNE 136


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLA++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRQGIVVVNSPQGNTIAAAEHAIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W +  F+GVE
Sbjct: 117 EANVSVKSGQWNRKQFIGVE 136


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 59/74 (79%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANASV 122

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  F+G E
Sbjct: 123 KRGEWDRKTFVGAE 136


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 59/74 (79%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANASV 122

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  F+G E
Sbjct: 123 KRGEWDRKTFVGAE 136


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  KLQIIGRAGVGVDNIDVPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIPDANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
              KWE+  F+G E
Sbjct: 123 KANKWERNRFIGTE 136


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP AN+S 
Sbjct: 63  KLQIIGRAGVGVDNIDVPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIPDANQSV 122

Query: 67  HKGKWEKFNFMGVE 80
              KWE+  F+G E
Sbjct: 123 KANKWERNRFIGTE 136


>gi|296228521|ref|XP_002759845.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Callithrix jacchus]
          Length = 533

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    ++L++ARQIP
Sbjct: 63  VISAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMILSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|291398138|ref|XP_002715722.1| PREDICTED: phosphoglycerate dehydrogenase [Oryctolagus cuniculus]
          Length = 533

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKGGKWERKKFMGTE 142


>gi|189219266|ref|YP_001939907.1| D-3-phosphoglycerate dehydrogenase [Methylacidiphilum infernorum
           V4]
 gi|189186124|gb|ACD83309.1| Phosphoglycerate dehydrogenase and ACT domains [Methylacidiphilum
           infernorum V4]
          Length = 531

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           KK+KV+GRAG+G DNVD+  A+  GIVVMNTP GN+I TAEH  SL+LA+AR +  A+ S
Sbjct: 67  KKLKVIGRAGVGIDNVDVDAATEKGIVVMNTPGGNTIATAEHTFSLLLALARNVAQAHAS 126

Query: 66  THKGKWEKFNFMGVE 80
              G+W++ NF G+E
Sbjct: 127 MQLGEWKRKNFEGIE 141


>gi|90077516|dbj|BAE88438.1| unnamed protein product [Macaca fascicularis]
          Length = 299

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH+I LMLA+AR+I 
Sbjct: 59  VIEAAPRLKIIARAGVGVDNVDVKAATERGIMVINAPESTSITVAEHSIGLMLALARKIS 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +GKWEK  FMG+E
Sbjct: 119 LADKSVKEGKWEKNRFMGIE 138


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++VVGRAG+G DNVD   A+R GIVVMNTP  N++  AE  ++LM+ +AR +P
Sbjct: 56  LMAAAPKLRVVGRAGVGVDNVDAEAATRRGIVVMNTPGANAVAVAELTLALMIGLARNLP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN + H GKWEK +  GVE
Sbjct: 116 RANATMHAGKWEKKSLQGVE 135


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S AKK++++GRAG+G DNVD+  A+R G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  VISEAKKLRIIGRAGVGVDNVDVPTATRKGVLVVNSPGGNTIAAAEHALAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G W++  ++G E
Sbjct: 117 QANGSMFAGGWDRKKYVGNE 136


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 57/73 (78%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLA++R IP AN S  
Sbjct: 64  LKIIGRAGVGVDNVDVPAATRQGIVVVNSPQGNTIAAAEHAIAMMLALSRHIPEANVSVK 123

Query: 68  KGKWEKFNFMGVE 80
            G+W +  F+GVE
Sbjct: 124 NGQWNRKQFIGVE 136


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 59/75 (78%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           +K++++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP AN S
Sbjct: 79  QKLRIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDANAS 138

Query: 66  THKGKWEKFNFMGVE 80
           T  G W++ +F+G E
Sbjct: 139 TKSGGWDRKSFVGTE 153


>gi|111225204|ref|YP_715998.1| D-3-phosphoglycerate dehydrogenase [Frankia alni ACN14a]
 gi|111152736|emb|CAJ64480.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Frankia alni ACN14a]
          Length = 530

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 60/79 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A++ G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAASRLKVVARAGIGLDNVDVAAATQRGVMVVNAPTSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN+S   G+W++  F GVE
Sbjct: 118 ANQSLRGGEWKRSKFSGVE 136


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH+I LMLA+AR+I 
Sbjct: 59  VIEAAPRLKIIARAGVGVDNVDVKAATDRGIMVINAPESTSITVAEHSIGLMLALARKIA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A+ S  +GKWEK  FMG+E
Sbjct: 119 IADRSVKEGKWEKNRFMGIE 138


>gi|294496187|ref|YP_003542680.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
 gi|292667186|gb|ADE37035.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
          Length = 523

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K+VGRAG+G DN+D+  A+  GI+V+N P GN ++ AEH I++ML++AR IP
Sbjct: 56  VIEAADKLKIVGRAGVGVDNIDIPAATEKGIIVVNAPEGNMLSAAEHTIAMMLSMARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  F+GVE
Sbjct: 116 QATASLKAGKWERKKFLGVE 135


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEH +++ML++AR IP
Sbjct: 57  VIEAANQLKIIGRAGVGVDNVDVPAATRKGIIVVNSPEGNTIAAAEHTLAMMLSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN +   G+W++  F GVE
Sbjct: 117 DANAAVKAGQWDRKRFTGVE 136


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPTATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDANTSL 122

Query: 67  HKGKWEKFNFMGVE 80
            KG+W++  F+G E
Sbjct: 123 KKGEWDRKTFVGAE 136


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMDAGKQLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMAVARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A   T  G+W++ +F+GVE
Sbjct: 119 QAYLKTVGGEWDRKSFLGVE 138


>gi|93279902|pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate
           Dehydrogenase
 gi|93279903|pdb|2G76|B Chain B, Crystal Structure Of Human 3-Phosphoglycerate
           Dehydrogenase
          Length = 335

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 83  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 142

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 143 QATASMKDGKWERKKFMGTE 162


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPTATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDANTSL 122

Query: 67  HKGKWEKFNFMGVE 80
            KG+W++  F+G E
Sbjct: 123 KKGEWDRKTFVGAE 136


>gi|300087849|ref|YP_003758371.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527582|gb|ADJ26050.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 526

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++++GRAG+G DNVD+  AS  GI+V+N P GN+I+ AEHA +LML++AR IP
Sbjct: 59  VIAAGKKLQIIGRAGVGVDNVDINSASERGIIVVNAPTGNTISAAEHAFALMLSLARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    +W++ +F+G E
Sbjct: 119 QANASLKSCQWKRSDFLGTE 138


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 58/74 (78%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANASV 122

Query: 67  HKGKWEKFNFMGVE 80
             G+W++  F+G E
Sbjct: 123 KSGEWDRKTFVGAE 136


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (72%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVVGRAG+G DN+DL  ASR GI+V+N P GN++   EH + +M+A AR IP
Sbjct: 63  LLERAKRLKVVGRAGVGVDNIDLEAASRRGILVVNAPTGNTLAATEHTMGMMIAAARLIP 122

Query: 61  VANES-THKGKWEKFNFMGVE 80
            A++S   + KWE+  FMGVE
Sbjct: 123 YAHKSLKEERKWERKKFMGVE 143


>gi|74012733|ref|XP_849042.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
          Length = 411

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +AR IP
Sbjct: 44  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARHIP 103

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 104 QATASMKDGKWERKKFMGTE 123


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KVVGRAG+G DN+D+  A+  G++V+N P GN+I+ AEHAI++M ++AR IP
Sbjct: 56  VLENAGRLKVVGRAGVGVDNIDVEAATERGVIVINAPEGNTISAAEHAIAMMTSLARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W++  FMGVE
Sbjct: 116 NASASMKAGEWKRSKFMGVE 135


>gi|91774294|ref|YP_566986.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
 gi|91713309|gb|ABE53236.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
          Length = 523

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A+  GI+V+N P GN ++ AEH I++M+++AR IP
Sbjct: 56  VIEAADNLKIIGRAGVGVDNVDVDAATEKGIIVVNAPEGNMLSAAEHTIAMMMSMARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    KWE+ NFMGVE
Sbjct: 116 QANASLKAKKWERKNFMGVE 135


>gi|196001599|ref|XP_002110667.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
 gi|190586618|gb|EDV26671.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
          Length = 520

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 56/75 (74%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K +K++GRAG G DN+D+  A+  G++VMNTP GN+++ AEH  +LM+ +ARQ+P A  S
Sbjct: 66  KNLKIIGRAGTGVDNIDIKAATECGVIVMNTPGGNTLSAAEHTCTLMVCLARQVPQAAAS 125

Query: 66  THKGKWEKFNFMGVE 80
             +G+W++  +MG+E
Sbjct: 126 MREGRWDRKKYMGIE 140


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 59/74 (79%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA++++LA++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMILALSRHIPDANASV 122

Query: 67  HKGKWEKFNFMGVE 80
            +G W++ +F+G E
Sbjct: 123 KRGAWDRNSFVGAE 136


>gi|73981259|ref|XP_849835.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981286|ref|XP_849919.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981343|ref|XP_850035.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
          Length = 533

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +AR IP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARHIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  ++K++GRAG+G DNVD+  ASR GI+VMN P GN++   E  ++LMLA AR++P
Sbjct: 61  LIENPGRLKIIGRAGVGLDNVDIEAASRKGIIVMNAPTGNTLAATELTMALMLAAARKVP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN+S   G+W++  FMG++
Sbjct: 121 LANQSLKAGEWDRKRFMGIQ 140


>gi|257054946|ref|YP_003132778.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256584818|gb|ACU95951.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
          Length = 531

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR IP
Sbjct: 62  VLAEATKLKVVARAGVGLDNVDVAEATERGVLVVNAPTSNIVSAAEHAIALLLAVARNIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   G+W++  F GVE
Sbjct: 122 AADQSLRSGEWKRSAFTGVE 141


>gi|78042498|ref|NP_001030189.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
 gi|71153759|sp|Q5EAD2|SERA_BOVIN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|59857639|gb|AAX08654.1| phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  IINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QAAASMKDGKWERKKFMGTE 142


>gi|86821596|gb|AAI05480.1| Phosphoglycerate dehydrogenase [Bos taurus]
 gi|296489452|gb|DAA31565.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  IINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QAAASMKDGKWERKKFMGTE 142


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 58/74 (78%), Gaps = 1/74 (1%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KV+GRAG+G DN+DL  A++ GI+V+N P GN+ITT EHA ++M+A+AR IP A   T
Sbjct: 65  RLKVIGRAGVGVDNIDLEAATKRGIIVINAPDGNTITTCEHAFAMMMALARHIPQAYAKT 124

Query: 67  HKGKWEKFNFMGVE 80
            KG+W++  F+GVE
Sbjct: 125 IKGEWDR-KFLGVE 137


>gi|77920705|ref|YP_358520.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77546788|gb|ABA90350.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 535

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L H + +K+V RAG+G DNVD+  AS  GI+V+N P+GN  + AEH +++ML++ R +P
Sbjct: 58  LLEHCRNLKIVARAGVGIDNVDVDAASSRGIIVVNAPYGNVNSAAEHTMAVMLSLCRNVP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           VAN S  +G+W++  F G E
Sbjct: 118 VANTSLKQGEWQRAPFTGCE 137


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMTAGKNLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A   T  G W++  F+GVE
Sbjct: 119 QAYAKTIGGTWDRKTFLGVE 138


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (76%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP A   T 
Sbjct: 66  LKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIPQAYAKTI 125

Query: 68  KGKWEKFNFMGVE 80
            G W++ +F+GVE
Sbjct: 126 GGSWDRKSFLGVE 138


>gi|291276391|ref|YP_003516163.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
 gi|290963585|emb|CBG39417.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
          Length = 527

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 55/74 (74%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++GRAG+G DN+D+  A++ GI+V N+P GN+I  AEH + L+ A+ R IP+AN S 
Sbjct: 61  KLKIIGRAGVGVDNIDIEAATQKGIIVTNSPDGNTIAAAEHTLGLIFALTRNIPLANASV 120

Query: 67  HKGKWEKFNFMGVE 80
            +GKWE+  F+G E
Sbjct: 121 QEGKWERSKFVGRE 134


>gi|307826385|ref|ZP_07656587.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
 gi|307732562|gb|EFO03437.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
          Length = 527

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++GRAGIG DNVD+  A+  GI+VMNTP  N+ TTAE AI+ M++++R +P
Sbjct: 59  VLQAAKNLKLIGRAGIGVDNVDIPAATELGIIVMNTPDANATTTAELAIAHMMSLSRHLP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKWE+   MG E
Sbjct: 119 TADRSVRAGKWERSKLMGSE 138


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 59/74 (79%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEHA++++L+++R IP AN S 
Sbjct: 63  QLKIIGRAGVGVDNVDVPAATRKGIIVVNSPEGNTIAAAEHALAMILSLSRHIPDANASV 122

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  F+G E
Sbjct: 123 KRGEWDRKTFVGAE 136


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A ++KV+GRAG G DN+D+  AS  G +VMNTP  N+   AEH I++MLA+AR IP
Sbjct: 58  LIENAPRLKVIGRAGTGVDNIDVKAASARGALVMNTPGANATAAAEHTIAMMLALARHIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S  +G+W+K  FMG E
Sbjct: 118 QATQSMREGRWDKKRFMGTE 137


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMAAGKNLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A   T  G W++  F+GVE
Sbjct: 119 QAYAKTIGGTWDRKTFLGVE 138


>gi|238927354|ref|ZP_04659114.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
 gi|238884636|gb|EEQ48274.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
          Length = 565

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA+AR IP
Sbjct: 94  VLERAGKLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTVAMMLAMARNIP 153

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ + H G+W +  ++GVE
Sbjct: 154 TADATMHAGQWNRKAYVGVE 173


>gi|304437357|ref|ZP_07397316.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369613|gb|EFM23279.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 563

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA+AR IP
Sbjct: 92  VLERAGKLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTVAMMLAMARNIP 151

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ + H G+W +  ++GVE
Sbjct: 152 TADATMHAGQWNRKAYVGVE 171


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMEAGKQLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMAVARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A   T  G W++ +F+GVE
Sbjct: 119 QAYLKTVGGVWDRKSFLGVE 138


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AEHAI+L+LA AR +P
Sbjct: 59  VFEHAKKLRVVARAGVGLDNVDVEAATKAGVMVVNAPTSNIVTAAEHAIALLLATARNVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++  + GVE
Sbjct: 119 QAHAALKQGEWKRSKYTGVE 138


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (76%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP A   T 
Sbjct: 66  LKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIPQAYAKTV 125

Query: 68  KGKWEKFNFMGVE 80
            G W++ +F+GVE
Sbjct: 126 GGTWDRKSFLGVE 138


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 56/73 (76%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP A   T 
Sbjct: 66  LKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIPQAYAKTV 125

Query: 68  KGKWEKFNFMGVE 80
            G W++ +F+GVE
Sbjct: 126 GGTWDRKSFLGVE 138


>gi|298252299|ref|ZP_06976102.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
 gi|297546891|gb|EFH80759.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
          Length = 575

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K+VGRAG+G DN+D   A+R GI+V+N+P GN +  AEH I++++++AR +P
Sbjct: 76  VLSAGTNLKIVGRAGVGVDNIDTNAATRLGIIVVNSPTGNIMAAAEHTIAMLMSLARHVP 135

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKW++  FMG+E
Sbjct: 136 AANASIKGGKWDRSRFMGIE 155


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A+  GI+V N P GN+I   EH I++M A++R IP
Sbjct: 58  VIEAADSLKIIGRAGVGIDNVDVPAATAKGIIVANAPEGNTIAACEHTIAMMFAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWE+  FMGVE
Sbjct: 118 QANSSLKGGKWERSKFMGVE 137


>gi|126313575|ref|XP_001367170.1| PREDICTED: similar to Phosphoglycerate dehydrogenase [Monodelphis
           domestica]
          Length = 533

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++++ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QAAASMKNGKWERKKFMGTE 142


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
          Length = 530

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 61/79 (77%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K+KV+ RAG+G DN+D+  A+ AG++V+N P  N ++ AEHAI L+LA+AR+IP+
Sbjct: 60  IAAARKLKVIARAGVGLDNIDVKAATNAGVMVVNAPQSNIVSAAEHAIGLLLAVARRIPL 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN S   G+W++  F+GVE
Sbjct: 120 ANASLKGGEWKRSKFVGVE 138


>gi|86742318|ref|YP_482718.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
 gi|86569180|gb|ABD12989.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
          Length = 529

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVV RAGIG DNVD+  A++ G++V+N P  N ++ AEHAI+L+LA+AR++P
Sbjct: 57  VLATAGKLKVVARAGIGLDNVDVAAATQRGVMVVNAPQSNIVSAAEHAIALLLAVARRVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+E+   G+W++  ++GVE
Sbjct: 117 AASEALRGGEWKRSKYVGVE 136


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DN+D+  AS+ G+VVMNTP GN+I+TAEHA +LM ++AR+IP
Sbjct: 62  VMEAAPNLKVIGRAGVGVDNIDVPAASKRGVVVMNTPGGNTISTAEHAFALMTSLARKIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   GK+++  F G E
Sbjct: 122 QAHANVASGKFDRKTFQGTE 141


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++VVGRAG+G DNVD+  A++ GIVVMNTP GN+I+TAE   S+++A+AR+IP
Sbjct: 56  VIEAAPKLRVVGRAGVGVDNVDVDAATQRGIVVMNTPSGNTISTAELTFSMLMALARKIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W +  F GVE
Sbjct: 116 QAHSSMKAGEWNRKAFSGVE 135


>gi|149600926|ref|XP_001515318.1| PREDICTED: similar to Phosphoglycerate dehydrogenase
           [Ornithorhynchus anatinus]
          Length = 533

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    ++L++ARQIP
Sbjct: 63  VIDAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMILSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKW++  FMG E
Sbjct: 123 QASASMKDGKWDRKKFMGTE 142


>gi|67971102|dbj|BAE01893.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++ MNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLGMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  FMG E
Sbjct: 123 QATASMKDGKWERKKFMGTE 142


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A++++++GRAG+G DNVDL  A+R GIVV+N+P GN+I  AEHAI+LM++++R + 
Sbjct: 57  VIEAAQRLRIIGRAGVGVDNVDLQAATRKGIVVVNSPEGNTIAAAEHAIALMMSLSRHVG 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+GVE
Sbjct: 117 EANASLKAGQWKRSQFIGVE 136


>gi|167465145|ref|ZP_02330234.1| phosphoglycerate dehydrogenase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 527

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GRAG+G DN+DL  A++ GIVV+N P GN+I T EH  ++++A+AR IP
Sbjct: 59  IMEAAPRLKVIGRAGVGVDNIDLEAATKRGIVVINAPDGNTIATCEHTFAMIMAVARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A + T  G+W++ +F+GVE
Sbjct: 119 QAYKKTISGEWDRKSFLGVE 138


>gi|156373763|ref|XP_001629480.1| predicted protein [Nematostella vectensis]
 gi|156216481|gb|EDO37417.1| predicted protein [Nematostella vectensis]
          Length = 487

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (74%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K +K++GRAG G DN+D V AS  G++VMNTP GN+++ AEH  +L+ ++AR IP A+ S
Sbjct: 68  KNLKIIGRAGTGVDNIDTVAASLHGVLVMNTPGGNTLSAAEHTCALISSLARHIPQASAS 127

Query: 66  THKGKWEKFNFMGVE 80
           T +GKWE+  FMG E
Sbjct: 128 TKEGKWERKQFMGNE 142


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (75%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           KM+ V RAG+G DN+D+  A+R G+VVMNTP GN+++ AEH I+L+LA++R+IP A+ + 
Sbjct: 64  KMRAVARAGVGVDNIDVAAATRKGVVVMNTPGGNTVSAAEHTIALLLALSRRIPAADATM 123

Query: 67  HKGKWEKFNFMGVE 80
             G W++  F+G E
Sbjct: 124 KAGGWDRNKFVGTE 137


>gi|298674284|ref|YP_003726034.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
 gi|298287272|gb|ADI73238.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
          Length = 525

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K++GRAG+G DN+D+  A+  GI+V+NTP GN I+ AEH IS+M+A+ R IP
Sbjct: 56  VINAADNLKIIGRAGVGVDNIDVDAATNKGIIVVNTPEGNMISAAEHTISMMMAMCRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    KWE+  FMGVE
Sbjct: 116 QAHASLKSRKWERKKFMGVE 135


>gi|119480099|ref|XP_001260078.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
 gi|119408232|gb|EAW18181.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
          Length = 582

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+L++A+AR IP
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALLIAMARNIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  F+GVE
Sbjct: 124 EACSSLKSGKWERSKFVGVE 143


>gi|322381790|ref|ZP_08055744.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154178|gb|EFX46500.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 535

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GRAG+G DN+DL  A++ GIVV+N P GN+I T EH  ++++A+AR IP
Sbjct: 67  IMEAAPRLKVIGRAGVGVDNIDLEAATKRGIVVINAPDGNTIATCEHTFAMIMAVARNIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A + T  G+W++ +F+GVE
Sbjct: 127 QAYKKTISGEWDRKSFLGVE 146


>gi|159128988|gb|EDP54102.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus A1163]
          Length = 584

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+L++A+AR IP
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALLMAMARNIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWE+  F+GVE
Sbjct: 124 EACSSLKSGKWERSKFVGVE 143


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VIEAGKNLKIIGRAGVGVDNVDIPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S    +W +  F+G E
Sbjct: 117 DANQSVKAKEWNRKKFIGAE 136


>gi|62860140|ref|NP_001015929.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
 gi|89268114|emb|CAJ83914.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
          Length = 509

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A ES   GKW++  FMG E
Sbjct: 124 QAAESMRAGKWDRKKFMGSE 143


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+GRAG+G DN+D+  A+R GI+V+N P GN+I   EH I LMLAI+R+IP
Sbjct: 59  VIERAKNLKVIGRAGVGVDNIDVEEATRKGILVINAPEGNTIAACEHTIGLMLAISRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A     +GKWE+ +F+G E
Sbjct: 119 QAFSLLRQGKWERKSFIGNE 138


>gi|110645315|gb|AAI18689.1| hypothetical protein LOC548683 [Xenopus (Silurana) tropicalis]
          Length = 509

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A ES   GKW++  FMG E
Sbjct: 124 QAAESMRAGKWDRKKFMGSE 143


>gi|26345686|dbj|BAC36494.1| unnamed protein product [Mus musculus]
          Length = 533

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++  FMG E
Sbjct: 123 QATASMKDGKWDRKKFMGTE 142


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 57/73 (78%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP AN S  
Sbjct: 64  LKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIPDANLSIK 123

Query: 68  KGKWEKFNFMGVE 80
           + KW++  F+G E
Sbjct: 124 ENKWDRKRFIGTE 136


>gi|52353955|ref|NP_058662.2| D-3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|55584180|sp|Q61753|SERA_MOUSE RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH;
           AltName: Full=A10
 gi|41529270|dbj|BAD08449.1| 3-phosphoglycerate dehyrogenase [Mus musculus]
 gi|56104627|gb|AAH86668.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|74146580|dbj|BAE41303.1| unnamed protein product [Mus musculus]
 gi|83404941|gb|AAI10674.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|148707012|gb|EDL38959.1| mCG11110 [Mus musculus]
          Length = 533

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++  FMG E
Sbjct: 123 QATASMKDGKWDRKKFMGTE 142


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++K++GRAG+G DN+D+  A+  GI+V N P GN++  AEH I LML++AR IP
Sbjct: 59  VLEKARRLKIIGRAGVGVDNIDVKAATAKGIIVANAPGGNTVAAAEHTIGLMLSLARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A   T  G W++ +FMGVE
Sbjct: 119 EACARTKSGVWDRKSFMGVE 138


>gi|13928850|ref|NP_113808.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|3122856|sp|O08651|SERA_RAT RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|1944614|emb|CAA66374.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|7688285|emb|CAB89828.1| 3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|55562727|gb|AAH86327.1| Phgdh protein [Rattus norvegicus]
 gi|149030526|gb|EDL85563.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
 gi|149030528|gb|EDL85565.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
          Length = 533

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++  FMG E
Sbjct: 123 QATASMKDGKWDRKKFMGTE 142


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS  K++K VGRAG+G DN+D+  A++AGI V+N P GN+I+TAEH+ ++++A+AR IP
Sbjct: 59  VLSAGKRLKAVGRAGVGVDNIDINAATQAGIPVINAPDGNTISTAEHSFAMLMAVARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++    G W++ +F GVE
Sbjct: 119 QAHKKLVDGTWDRKSFQGVE 138


>gi|312216238|emb|CBX96189.1| similar to d-3-phosphoglycerate dehydrogenase [Leptosphaeria
           maculans]
          Length = 620

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AKK+KVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 99  LLSQAKKLKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTIALLMAVARNVA 158

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKWE+   +GVEA
Sbjct: 159 DASQSIKAGKWERSRLVGVEA 179


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+GRAG+G DN+D+  A+R GI+V+N P GN+I   EH I LMLAI+R+IP
Sbjct: 59  VIEKAKNLKVIGRAGVGVDNIDVEEATRKGILVINAPEGNTIAACEHTIGLMLAISRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A     +GKWE+ +F+G E
Sbjct: 119 QAFSLLKQGKWERKSFIGNE 138


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KV+GRAG+G DN+D+  A+  GI+V+N+P  NSI+ AEH  +++L+I+R+IP
Sbjct: 66  IIDAGKRLKVIGRAGVGVDNIDVERATEKGILVVNSPEANSISAAEHTFAMLLSISRKIP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKWE+   MGVE
Sbjct: 126 AANVSLKSGKWERKKHMGVE 145


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 57  VITAGSQLKIIGRAGVGVDNIDIPSATRQGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+S  + +W++ +F+G E
Sbjct: 117 QANQSIKEHRWDRKSFIGAE 136


>gi|73748439|ref|YP_307678.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
 gi|73660155|emb|CAI82762.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
          Length = 526

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKTATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G E
Sbjct: 117 RANASLKSGQWKRNEFVGSE 136


>gi|147669219|ref|YP_001214037.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
 gi|146270167|gb|ABQ17159.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
          Length = 526

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G E
Sbjct: 117 RANASLKSGQWKRNEFVGSE 136


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 57/74 (77%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEHA  LM+A++R +  AN+S 
Sbjct: 65  RLRCIARAGVGTDNIDKDAATRLGIVVMNTPTGNTVSTAEHAFCLMMALSRNVASANQSL 124

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  +MG +
Sbjct: 125 VEGRWDRKKYMGSQ 138


>gi|289432486|ref|YP_003462359.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
 gi|288946206|gb|ADC73903.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
          Length = 526

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G E
Sbjct: 117 RANASLKSGQWKRNEFVGSE 136


>gi|194210920|ref|XP_001501069.2| PREDICTED: similar to phosphoglycerate dehydrogenase isoform 1
           [Equus caballus]
          Length = 545

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 75  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 134

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++  FMG E
Sbjct: 135 QATASMKGGKWDRKKFMGTE 154


>gi|312194898|ref|YP_004014959.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
 gi|311226234|gb|ADP79089.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
          Length = 527

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A K+KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAAPKLKVVARAGIGLDNVDVPAATTRGVMVVNAPQSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A++S   G+W++  + GVE
Sbjct: 118 ADQSLQNGEWKRSKYTGVE 136


>gi|258651703|ref|YP_003200859.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258554928|gb|ACV77870.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
          Length = 530

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 58/79 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N IT AEHAI+L+L++AR+IP 
Sbjct: 60  LAAAPQLKVVARAGIGLDNVDVPAATAKGVLVVNAPQSNIITAAEHAIALLLSVARKIPA 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S   G+W++  F GVE
Sbjct: 120 ADASFRAGEWKRSKFTGVE 138


>gi|147902547|ref|NP_001091250.1| phosphoglycerate dehydrogenase [Xenopus laevis]
 gi|120577618|gb|AAI30205.1| LOC100037051 protein [Xenopus laevis]
          Length = 509

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKNGIIVMNTPTGNSISAAELTCGLVLSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A ES   GKW++  FMG E
Sbjct: 124 QAAESMRAGKWDRKKFMGSE 143


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAG+G DN+D+  A+  G++VMN P GN++ TAEH  SL+L++A+ IP
Sbjct: 58  ILRAAHHLKVVGRAGVGVDNIDVEAATARGVLVMNAPSGNTLATAEHTFSLLLSLAKNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A  S   G+WEK  F+ VE G
Sbjct: 118 QATASMKGGRWEKGAFLSVELG 139


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +AK +K++ RAG+G DN+D+  A+  GI+V+N P   SIT AEHA+ LML+++R+I 
Sbjct: 57  VIENAKNLKIIARAGVGVDNIDVQAATDHGILVVNAPQSTSITVAEHAMGLMLSLSRKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A+ S   GKWEK  FMG+E
Sbjct: 117 IADASVKAGKWEKSKFMGME 136


>gi|269926541|ref|YP_003323164.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790201|gb|ACZ42342.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 524

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    +++V+ RAGIG DN+D+  A++ GI+V+N P GN++  AEHAI+L+L++AR IP
Sbjct: 58  IIEAGDRLQVIARAGIGVDNIDVDAATKRGILVVNAPLGNTVAAAEHAIALILSLARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W++  FMGVE
Sbjct: 118 QADASIRRGEWQRSKFMGVE 137


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  ++K+K + RAG+G DN+D+  A++ GIVVMNTP GN I+TAEH I+L+ +++R +P
Sbjct: 66  VLEKSEKLKAICRAGVGVDNIDVPAATKKGIVVMNTPAGNIISTAEHTIALLCSLSRFVP 125

Query: 61  VANESTHKGKWEKFNFMG 78
            A  S  +GKWEK  F G
Sbjct: 126 QACASVKEGKWEKKKFTG 143


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+ RAG G DN+D+  AS+ GI+V+NTP  N+I+ AE  ++LML ++R +P
Sbjct: 57  VLSQADNLKVIARAGSGYDNIDVEAASKRGIIVLNTPGQNTISAAEQTMALMLGLSRNLP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ANE+ H+G W++  + GVE
Sbjct: 117 QANEALHEGIWDRNKYQGVE 136


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++ +GRAG+G DNVD+  A+R G++V N P GN++   EH +++ML++AR IP
Sbjct: 59  VITAGKKLRFIGRAGVGVDNVDVDAATRQGVIVANAPEGNTLAATEHTMAMMLSLARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S  K +W++  FMGVE
Sbjct: 119 QANASLKKKEWKRSKFMGVE 138


>gi|237785818|ref|YP_002906523.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758730|gb|ACR17980.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 532

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++K++GRAG+G DNVD+  A++ G++V+N P  N  +  EHAI+L+LA ARQIP
Sbjct: 62  VLDAAKELKIIGRAGVGLDNVDIEGATQRGVMVVNAPTSNIHSACEHAITLLLAAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++ +F GVE
Sbjct: 122 QADQSLRQGEWKRSSFKGVE 141


>gi|258574947|ref|XP_002541655.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901921|gb|EEP76322.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 568

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK ++VV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR+IP
Sbjct: 66  VLQAAKNLRVVARAGVGVDNVDVDTATKLGIVVVNSPSGNIGAAAEHTIALMLSMARKIP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWE+  F+GVE
Sbjct: 126 HACSSLKEGKWERSKFVGVE 145


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K+V RAG+G DNVD+  A++ G+VV+N P GN+I+TAEH  ++M A+ R IP
Sbjct: 65  LLSRMPRLKIVARAGVGVDNVDIQAATKHGVVVINAPDGNTISTAEHTFAMMCALLRNIP 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKW++  + G E
Sbjct: 125 QANASVKSGKWDRKAYQGTE 144


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 57/73 (78%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DN+D+  A++AGI+V+N+P GN+I  AEHAI+LM+A++R IP AN S  
Sbjct: 64  LKIIGRAGVGVDNIDVPAATKAGILVVNSPEGNTIAAAEHAIALMMALSRHIPDANASLK 123

Query: 68  KGKWEKFNFMGVE 80
            G W +  F+GVE
Sbjct: 124 SGLWNRQEFVGVE 136


>gi|194336592|ref|YP_002018386.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309069|gb|ACF43769.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 526

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 53/74 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++GRAG G DN+DL  A+R GI+VMNTP GN+++ AEH  ++ML+ AR+IP A    
Sbjct: 63  KLKLIGRAGAGVDNIDLEAATRNGIIVMNTPGGNTVSAAEHTCAMMLSAARRIPQATADL 122

Query: 67  HKGKWEKFNFMGVE 80
            +G W K  F GVE
Sbjct: 123 KQGNWSKTKFSGVE 136


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (72%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++V+GRAG+G DNVDL  A+R GI V+N P GN++  AEH ++LMLA+ R IP A+ S  
Sbjct: 30  LQVIGRAGVGVDNVDLDAATRQGIPVVNAPTGNTVAAAEHTLALMLAMVRHIPQADASVR 89

Query: 68  KGKWEKFNFMGVE 80
            G+W +  FMGVE
Sbjct: 90  MGEWRRSAFMGVE 102


>gi|20093758|ref|NP_613605.1| dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
 gi|19886661|gb|AAM01535.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 252

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +KV+ RAG+G DN+D+  A+  GIVV+N P  +SI+ AEH +SLML +AR+IP
Sbjct: 63  LIEEAENLKVIARAGVGVDNIDVEAATERGIVVVNAPESSSISVAEHTMSLMLVLARRIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W++  FMGVE
Sbjct: 123 QADRSVRRGEWDRKLFMGVE 142


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 56/76 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA +++VV RAG G DN+DL  A+ AGI+V+N P  N+++  EH ++LMLAIAR + 
Sbjct: 257 LLAHAPRLRVVARAGTGVDNIDLQAATEAGILVLNAPGANAVSAGEHTVALMLAIARNLI 316

Query: 61  VANESTHKGKWEKFNF 76
            AN +TH G+WE+  F
Sbjct: 317 DANATTHAGRWERKRF 332


>gi|270307961|ref|YP_003330019.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
 gi|270153853|gb|ACZ61691.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
          Length = 526

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LML++AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLSMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G E
Sbjct: 117 RANASLKSGQWKRNEFVGSE 136


>gi|239736188|gb|ACS12894.1| 3-phosphoglycerate dehydrogenase-like protein [Chironex fleckeri]
          Length = 520

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S A  +K+VGRAG G DN+DL  A+  G+ VMNTP GN+++ AEH  ++M ++AR IP
Sbjct: 63  VFSAAPNLKLVGRAGTGVDNIDLKAATNNGVFVMNTPGGNTMSAAEHTCAMMFSLARHIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S  +GKWE+  FMG E
Sbjct: 123 QGYMSMQEGKWERSKFMGCE 142


>gi|320529979|ref|ZP_08031055.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
 gi|320137776|gb|EFW29682.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
          Length = 534

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 63  VIARAENLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSMARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+E+  +G+W +  ++GVE
Sbjct: 123 AADETMQRGEWNRKAYVGVE 142


>gi|312880178|ref|ZP_07739978.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
 gi|310783469|gb|EFQ23867.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
          Length = 549

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 56/78 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAG+G DNVDL  ASR G+VV+N P GN+++ AE  ++LML + R+ P
Sbjct: 59  LLEAAPVLKVVGRAGVGVDNVDLPEASRRGVVVINAPTGNTLSAAEQTLALMLGLIRRTP 118

Query: 61  VANESTHKGKWEKFNFMG 78
            AN S  +G+W++  FMG
Sbjct: 119 QANASMRRGEWDRKRFMG 136


>gi|311740551|ref|ZP_07714378.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304071|gb|EFQ80147.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 528

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAATKLKIVGRAGVGLDNVDIPTATDKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  KG+W++ +F GVE
Sbjct: 119 AADQSLRKGEWKRSSFKGVE 138


>gi|225561271|gb|EEH09552.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus G186AR]
          Length = 598

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKWE+   +GVE
Sbjct: 126 DGCSSLKNGKWERSRLVGVE 145


>gi|57234596|ref|YP_181341.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
 gi|57225044|gb|AAW40101.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
          Length = 526

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LML++AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLSMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G E
Sbjct: 117 RANASLKSGQWKRNEFVGSE 136


>gi|20093737|ref|NP_613584.1| D-3-phosphoglycerate dehydrogenase [Methanopyrus kandleri AV19]
 gi|19886634|gb|AAM01514.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 522

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+ RAG+G DN+D+  A+  GI+V+N P  +SI+ AEH + L+LA+AR+IP
Sbjct: 57  LIEEAKNLKVIARAGVGVDNIDVKAATERGIIVVNAPESSSISVAEHTMGLILALARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W++  FMGVE
Sbjct: 117 QADRSVRRGEWDRKRFMGVE 136


>gi|240277875|gb|EER41382.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H143]
 gi|325095932|gb|EGC49242.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H88]
          Length = 598

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKWE+   +GVE
Sbjct: 126 DGCSSLKNGKWERSRLVGVE 145


>gi|261198128|ref|XP_002625466.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239595429|gb|EEQ78010.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239615717|gb|EEQ92704.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ER-3]
 gi|327356769|gb|EGE85626.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 602

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVAAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKWE+   +GVE
Sbjct: 126 NGCSSLKDGKWERSRLVGVE 145


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH + L+L+++R+I 
Sbjct: 58  VIEAADKLKIIARAGVGVDNVDVQAATERGIMVINAPESTSITVAEHTMGLILSLSRKIS 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A+ S   GKWEK  FMG+E
Sbjct: 118 IADSSVKDGKWEKSRFMGIE 137


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 58/73 (79%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DN+D+  A++AGI+V+N+P GN+I  AEHAI+LM+A++R I  AN S  
Sbjct: 64  LKIIGRAGVGVDNIDVAAATKAGILVVNSPEGNTIAAAEHAIALMMALSRHIADANASLK 123

Query: 68  KGKWEKFNFMGVE 80
            G+W++  F+GVE
Sbjct: 124 AGQWKRQEFVGVE 136


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  M VVGRAG+G DN+DL  A+  G++V+N P GN+I  AE  ++++L ++R +P
Sbjct: 58  VLDHANNMIVVGRAGVGVDNIDLAAATNKGVLVVNAPDGNTIAAAELTMAMILGLSRSVP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN +   GKW+K  FMGVE
Sbjct: 118 QANATLRSGKWDKKAFMGVE 137


>gi|124486358|ref|YP_001030974.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
 gi|124363899|gb|ABN07707.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
          Length = 527

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A KMK +GRAG+G DN+D   A++ GI+V N P GN++   EH I++M+A+AR IP
Sbjct: 58  IIEAADKMKYIGRAGVGVDNIDCEAATKKGIIVSNAPEGNTLAATEHTIAMMMAMARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  KG+W++  FMG E
Sbjct: 118 QASASLKKGEWKRSKFMGNE 137


>gi|116754525|ref|YP_843643.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
 gi|116665976|gb|ABK15003.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
          Length = 523

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DNVD+  A++ GI+V+N P GN+I+ AEH I++ML++AR IP
Sbjct: 56  VINAADRLKVIARAGVGVDNVDVDAATKKGIIVVNAPGGNTISAAEHTIAMMLSLARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W +  + GVE
Sbjct: 116 QAHASVRRGEWNRKKYTGVE 135


>gi|110598440|ref|ZP_01386712.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
 gi|110339974|gb|EAT58477.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
          Length = 526

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK++++GRAG G DN+D+  A+R GI+VMNTP GN+I+ AEH  ++ML+ AR IP
Sbjct: 57  IIEAGKKLQLIGRAGAGVDNIDIEAATRNGIIVMNTPGGNTISAAEHTCAMMLSAARLIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A     +G W K  F GVE
Sbjct: 117 QATADLKQGNWNKTKFTGVE 136


>gi|158312947|ref|YP_001505455.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
 gi|158108352|gb|ABW10549.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
          Length = 529

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 60/79 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAAPRLKVVARAGIGLDNVDVPAATNRGVMVVNAPQSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ES   G+W++  ++GVE
Sbjct: 118 AHESLVGGEWKRSKYVGVE 136


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN+DL  A+  GI+V+N+P   SIT AEH + L+L++AR+  
Sbjct: 56  VIDKADNLKIIARAGVGVDNIDLNAATEKGIMVVNSPESTSITVAEHTMGLLLSLARKSA 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +GKWEK  FMGVE
Sbjct: 116 IADKSVKEGKWEKKKFMGVE 135


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN+DL  A+  GI+V+N+P   SIT AEH + L+L++AR+  
Sbjct: 56  VIDKADNLKIIARAGVGVDNIDLNAATEKGIMVVNSPESTSITVAEHTMGLLLSLARKSA 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +GKWEK  FMGVE
Sbjct: 116 IADKSVKEGKWEKKKFMGVE 135


>gi|292669667|ref|ZP_06603093.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292648464|gb|EFF66436.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 526

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 55  VLERADRLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSLARNIP 114

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ + H G W +  ++GVE
Sbjct: 115 AADATMHTGGWNRKAYVGVE 134


>gi|296803933|ref|XP_002842819.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
 gi|238846169|gb|EEQ35831.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
          Length = 571

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  LLQAARKLKVVARAGVGVDNIDIDAATKQGIVVVNSPSGNNMAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    +WE+   +GVE
Sbjct: 128 DACSSLKSNRWERSRLVGVE 147


>gi|172040439|ref|YP_001800153.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
 gi|171851743|emb|CAQ04719.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
          Length = 530

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VLEAAKNLKIVGRAGVGLDNVDIETATERGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++ +F GVE
Sbjct: 122 AADKTLRDGEWKRSSFKGVE 141


>gi|149030527|gb|EDL85564.1| 3-phosphoglycerate dehydrogenase, isoform CRA_b [Rattus norvegicus]
 gi|149030529|gb|EDL85566.1| 3-phosphoglycerate dehydrogenase, isoform CRA_b [Rattus norvegicus]
          Length = 140

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQIP 122

Query: 61  VANESTHKGKWEKFNF 76
            A  S   GKW++  F
Sbjct: 123 QATASMKDGKWDRKKF 138


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+GRAG+G DN+DL  A+R GI+V+N P GN+I  AEH  ++M+++AR IP
Sbjct: 60  VIESAKKLKVIGRAGVGVDNIDLEAATRRGILVINAPDGNTIAAAEHTFAMMISLARHIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W +  ++GVE
Sbjct: 120 AAHRDLLQGNWNRKKWIGVE 139


>gi|193213940|ref|YP_001995139.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
 gi|193087417|gb|ACF12692.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
          Length = 526

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +K++GRAG G DN+D+  A+R GI+VMNTP GN+++ AEHA  ++LA AR IP A+ 
Sbjct: 61  ADNLKLIGRAGAGVDNIDIEAATRKGIIVMNTPGGNTVSAAEHACGMLLATARNIPQASA 120

Query: 65  STHKGKWEKFNFMGVE 80
             H+  W+K  +MG E
Sbjct: 121 QMHQAVWDKKKWMGAE 136


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DN+D+  A++ GI+V+N P GN++   EH +++MLA+AR IP
Sbjct: 56  VIDAAANLKVIGRAGVGVDNIDVEAATKRGIIVLNAPEGNTVAATEHTMAMMLALARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   G+W++  FMGVE
Sbjct: 116 QAHATMKAGEWQRSKFMGVE 135


>gi|257791620|ref|YP_003182226.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|317487964|ref|ZP_07946548.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
 gi|257475517|gb|ACV55837.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|316912946|gb|EFV34471.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
          Length = 526

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 55/76 (72%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +++++GRAG+G DNVD+  A+  GI+V N P  N ++ AEHAI LMLA AR++P AN 
Sbjct: 63  ADRLRIIGRAGVGVDNVDVEAATEHGIIVCNAPTSNIVSAAEHAIGLMLACARKVPQANA 122

Query: 65  STHKGKWEKFNFMGVE 80
           S H+G WE+  + GVE
Sbjct: 123 SMHEGVWERGKYTGVE 138


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +K++GRAG+G DN+DL  AS+ GI+V+N+P GN+I  AEH  +LM+A+ R IP
Sbjct: 57  IIEAAENLKIIGRAGVGVDNIDLAAASKKGIIVVNSPEGNTIAAAEHTFALMMALLRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +GKW +  F G E
Sbjct: 117 QAHAALKEGKWLRKEFTGYE 136


>gi|198430449|ref|XP_002130537.1| PREDICTED: similar to 3-phosphoglycerate dehydrogenase [Ciona
           intestinalis]
          Length = 523

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  K+ ++GRAG G DNVD+  A++ G++VMNTP GN+++ AEH  +L+  +AR +P
Sbjct: 63  IIENCPKLSIIGRAGTGVDNVDVKFATKKGVIVMNTPGGNTLSAAEHTCTLVCCLARNVP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKW++  FMG E
Sbjct: 123 AADASVKAGKWDRKAFMGHE 142


>gi|325833264|ref|ZP_08165770.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
 gi|325485646|gb|EGC88114.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
          Length = 530

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 55/76 (72%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +++++GRAG+G DNVD+  A+  GI+V N P  N ++ AEHAI LMLA AR++P AN 
Sbjct: 67  ADRLRIIGRAGVGVDNVDVEAATEHGIIVCNAPTSNIVSAAEHAIGLMLACARKVPQANA 126

Query: 65  STHKGKWEKFNFMGVE 80
           S H+G WE+  + GVE
Sbjct: 127 SMHEGVWERGKYTGVE 142


>gi|327288752|ref|XP_003229089.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Anolis
           carolinensis]
          Length = 531

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+GRAG G DNVD+  A+R GI+VMNTP GNS++ AE    +++++ARQIP
Sbjct: 68  VINAAAKLQVIGRAGTGVDNVDVDAATRKGILVMNTPTGNSLSAAELTCGMIMSLARQIP 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKW++  FMG+E
Sbjct: 128 QAAASMKEGKWDRKKFMGME 147


>gi|315039759|ref|XP_003169257.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
 gi|311337678|gb|EFQ96880.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
          Length = 562

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GI+V+N+P GN++  AEH I+L++ +AR IP
Sbjct: 60  LLQAATKLKVVARAGVGVDNIDVDAATKQGIIVVNSPSGNNVAAAEHTIALLMCMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+   +GVE
Sbjct: 120 DACSSLKSNKWERSRLVGVE 139


>gi|306835934|ref|ZP_07468927.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
 gi|304568208|gb|EFM43780.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
          Length = 528

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAAPKLKIVGRAGVGLDNVDIDTATNKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++ +F GVE
Sbjct: 119 AADQSLREGEWKRSSFKGVE 138


>gi|189201403|ref|XP_001937038.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984137|gb|EDU49625.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 573

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKKMKVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTITLLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKWE+   +GVEA
Sbjct: 125 DASQSIKAGKWERSRLVGVEA 145


>gi|255324581|ref|ZP_05365698.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
 gi|255298487|gb|EET77787.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
          Length = 528

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAATKLKIVGRAGVGLDNVDIPAATDKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++ +F GVE
Sbjct: 119 AADQSLREGEWKRSSFKGVE 138


>gi|330934580|ref|XP_003304604.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
 gi|311318673|gb|EFQ87289.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
          Length = 586

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKKMKVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTIALLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKWE+   +GVEA
Sbjct: 125 DASQSIKAGKWERSRLVGVEA 145


>gi|227501755|ref|ZP_03931804.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
 gi|227077780|gb|EEI15743.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
          Length = 528

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAAPKLKIVGRAGVGLDNVDIDTATNKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++ +F GVE
Sbjct: 119 AADQSLREGEWKRSSFKGVE 138


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+GRAG+G DN+DL  A+R GI+V+N P GN+I  AEH  ++M+++AR IP
Sbjct: 60  VIESAKKLKVIGRAGVGVDNIDLEAATRRGILVINAPDGNTIAAAEHTFAMMISLARHIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W +  ++GVE
Sbjct: 120 AAHRDLLQGHWNRKKWIGVE 139


>gi|326777649|ref|ZP_08236914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657982|gb|EGE42828.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+GRAG+G DNVD+  ASRAG++V+N P  N ++ AEH + L+LA+AR IP 
Sbjct: 60  IAAGRRLKVIGRAGVGLDNVDVAAASRAGVMVVNAPTSNIVSAAEHTVGLLLAVARNIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +  +G+WE+  F GVE
Sbjct: 120 AHGALKEGRWERSRFTGVE 138


>gi|182437034|ref|YP_001824753.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465550|dbj|BAG20070.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 530

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+GRAG+G DNVD+  ASRAG++V+N P  N ++ AEH + L+LA+AR IP 
Sbjct: 60  IAAGRRLKVIGRAGVGLDNVDVAAASRAGVMVVNAPTSNIVSAAEHTVGLLLAVARNIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +  +G+WE+  F GVE
Sbjct: 120 AHGALKEGRWERSRFTGVE 138


>gi|326924873|ref|XP_003208648.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Meleagris
           gallopavo]
          Length = 490

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAG G DNVD+  A+R G++VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VLEAAGRLQVVGRAGTGVDNVDVEAATRKGVLVMNTPTGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKW++  +MG+E
Sbjct: 123 QAAASMKEGKWDRKKYMGME 142


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     GKW++  ++G E
Sbjct: 117 QANAGMRAGKWDRKKYVGNE 136


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  IIEAAPRLKIIGRAGVGVDNVDVPTATKNGVLVVNSPEGNTIAAAEHALAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G W +  ++G E
Sbjct: 117 AAHSSTASGGWNRKAYVGNE 136


>gi|291287172|ref|YP_003503988.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884332|gb|ADD68032.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 544

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  K+K++GRAG+G DNVD+  AS  GI+VMN P GN++   E  + +ML++ R++P
Sbjct: 61  LIENPGKLKIIGRAGVGLDNVDIEAASMKGIIVMNAPTGNTLAACELTMGMMLSVVRKLP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN+ T  G+W++  FMG++
Sbjct: 121 LANQVTKSGEWDRKRFMGIQ 140


>gi|50751002|ref|XP_422226.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 525

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAG G DNVD+  A+R G++VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VLEAAGRLQVVGRAGTGVDNVDVDAATRKGVLVMNTPTGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKW++  +MG+E
Sbjct: 123 QAAASMKEGKWDRKKYMGME 142


>gi|323141567|ref|ZP_08076450.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413909|gb|EFY04745.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 528

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  + ++KV+GRAG+G DN+D+  A+  GIVV+NTP GN++   EH +++M+A+ R IP
Sbjct: 56  VIEASTRLKVIGRAGVGVDNIDIPAATAKGIVVLNTPEGNTMAATEHTVAMMMAMTRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +GKW++ +F G++
Sbjct: 116 QAHQSIQEGKWDRKSFDGIQ 135


>gi|32474150|ref|NP_867144.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|32444687|emb|CAD74689.1| phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|327541027|gb|EGF27580.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica WH47]
          Length = 540

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 57/74 (77%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEH  +++LA++R I  AN+S 
Sbjct: 65  RLRALVRAGVGTDNIDKPAATRRGIVVMNTPAGNTVSTAEHTFAMLLAMSRNIAAANQSL 124

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  FMG +
Sbjct: 125 VEGRWDRKKFMGTQ 138


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K +GRAGIG DN+D+  A++ GI+V N P  N++  AEH + LMLA+AR+IP
Sbjct: 56  VIEAAGRLKAIGRAGIGVDNIDIEAATKRGILVANAPESNTVAAAEHTLGLMLAVARRIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W +  F GVE
Sbjct: 116 AADASLRRGEWNRAAFKGVE 135


>gi|326474476|gb|EGD98485.1| D-3-phosphoglycerate dehydrogenase [Trichophyton tonsurans CBS
           112818]
          Length = 570

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLRAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+   +GVE
Sbjct: 128 DACSSLKSNKWERSRLVGVE 147


>gi|326481542|gb|EGE05552.1| phosphoglycerate dehydrogenase [Trichophyton equinum CBS 127.97]
          Length = 571

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLRAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+   +GVE
Sbjct: 128 DACSSLKSNKWERSRLVGVE 147


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++MLA++R +P
Sbjct: 57  IIEAATRLKIIGRAGVGVDNVDVEAATQRGVLVVNSPEGNTIAAAEHALAMMLALSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G WE+  ++G E
Sbjct: 117 QAHVSTMAGGWERKKYVGNE 136


>gi|327321766|gb|AEA48241.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum]
          Length = 530

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVLVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++ +F GVE
Sbjct: 122 AADATLREGEWKRSSFNGVE 141


>gi|171681876|ref|XP_001905881.1| hypothetical protein [Podospora anserina S mat+]
 gi|170940897|emb|CAP66547.1| unnamed protein product [Podospora anserina S mat+]
          Length = 588

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+KVV RAG+G DN+D+  A+  GI+V+N+P GN +  AEH I+L++A AR +P
Sbjct: 76  LLAAGSKLKVVARAGVGVDNIDVKAATEQGIIVVNSPSGNILAAAEHTIALLMATARNVP 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + +  +GKWE+   +GVE G
Sbjct: 136 RGDGTLKQGKWERGKLVGVEVG 157


>gi|213964733|ref|ZP_03392933.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
 gi|213952926|gb|EEB64308.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
          Length = 531

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A++ G++V+N P  N  +  EHAI+L+LA ARQ+P
Sbjct: 62  VLEAAPNLKIVGRAGVGLDNVDIDTATKRGVMVVNAPTSNIHSACEHAIALLLATARQLP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W++ +F GVE
Sbjct: 122 AADASLREGEWKRSSFKGVE 141


>gi|302666561|ref|XP_003024878.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
 gi|291188954|gb|EFE44267.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
          Length = 571

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D   A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLQAASKLKVVARAGVGVDNIDADAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+   +GVE
Sbjct: 128 DACSSLKSNKWERSRLVGVE 147


>gi|20089481|ref|NP_615556.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
 gi|19914387|gb|AAM04036.1| phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
          Length = 523

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG+G DNVD+  A++ GI+V N P GN I+ AEH I +M+A++R IP
Sbjct: 56  VIEAADNLKIVGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHTIGMMMAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    +W++  FMGVE
Sbjct: 116 QANASLKGREWKRNKFMGVE 135


>gi|317050557|ref|YP_004111673.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945641|gb|ADU65117.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 544

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L H   +++VVGRAG+G DNVD+  AS+ GIVV+NTP GN++   EH ++++LA  R I
Sbjct: 62  LLDHTSGRLRVVGRAGVGLDNVDVEAASKKGIVVLNTPTGNTLAATEHTMAMLLAACRMI 121

Query: 60  PVANESTHKGKWEKFNFMGVE 80
           P A+ +   GKW++ +FMG E
Sbjct: 122 PKAHNTLVGGKWDRKSFMGFE 142


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAAGRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     GKW++  ++G E
Sbjct: 117 QANAGMRAGKWDRKKYVGNE 136


>gi|148263798|ref|YP_001230504.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146397298|gb|ABQ25931.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 541

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAGKKLKMVARAGVGIDNVDIDYASSKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F GVE
Sbjct: 118 KANASLKSGEWKRAPFTGVE 137


>gi|19552504|ref|NP_600506.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|62390170|ref|YP_225572.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|145295425|ref|YP_001138246.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum R]
 gi|21324052|dbj|BAB98677.1| Phosphoglycerate dehydrogenase and related dehydrogenases or
           D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glutamicum ATCC 13032]
 gi|41325506|emb|CAF19986.1| Phosphoglycerate Dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|140845345|dbj|BAF54344.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 530

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++ +F GVE
Sbjct: 122 AADATLREGEWKRSSFNGVE 141


>gi|291238608|ref|XP_002739220.1| PREDICTED: phosphoglycerate dehydrogenase-like [Saccoglossus
           kowalevskii]
          Length = 405

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG G DN+DL  +S+ G++VMNTP GN+++ AEH  +++ A++R IP
Sbjct: 62  VIEAATNLKIIGRAGTGVDNIDLNASSKKGVIVMNTPSGNTLSAAEHTCAMICAMSRNIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKW++  FMG E
Sbjct: 122 QAHMSMKSGKWDRKAFMGSE 141


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIEAASKLRIIGRAGVGVDNVDVPAATKRGVIVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G W++  ++G E
Sbjct: 117 HAHGSTMAGGWDRKKYVGNE 136


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 56/73 (76%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++V+ RAG+G DN+D+  A+R GI+V+N+P GN+I+  EH +++ML+++R IP A++S  
Sbjct: 66  LRVIARAGVGVDNIDVDAATRKGIIVVNSPGGNTISATEHTLAMMLSLSRNIPQAHKSAA 125

Query: 68  KGKWEKFNFMGVE 80
            GKWE+  F GVE
Sbjct: 126 AGKWEREKFKGVE 138


>gi|227832959|ref|YP_002834666.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|262182554|ref|ZP_06041975.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|227453975|gb|ACP32728.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
          Length = 528

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQ+P
Sbjct: 59  VLAAAENLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSACEQAIALLLATARQVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++ +F GVE
Sbjct: 119 AADQSLRQGEWKRSSFKGVE 138


>gi|158522823|ref|YP_001530693.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511649|gb|ABW68616.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 532

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 51/76 (67%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K+K V RAGIG DNVD+  A++ G+ VMNTP GN +TTAEH I++M+A+ R IP    
Sbjct: 65  APKLKAVARAGIGLDNVDIPAATKHGVAVMNTPEGNVVTTAEHTIAMMMALTRNIPQGTL 124

Query: 65  STHKGKWEKFNFMGVE 80
           S   G+WEK    G E
Sbjct: 125 SLRSGQWEKKKLQGRE 140


>gi|21227855|ref|NP_633777.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
 gi|20906268|gb|AAM31449.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
          Length = 540

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A++ GI+V N P GN I+ AEH I++M++++R IP
Sbjct: 73  IIEAADNLKIIGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHTIAMMMSMSRNIP 132

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    +W++  FMGVE
Sbjct: 133 QANASLKAREWKRNKFMGVE 152


>gi|260577503|ref|ZP_05845445.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
 gi|258604372|gb|EEW17607.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
          Length = 529

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 61  VLEAAPKLQIVGRAGVGLDNVDIDTATSRGVMVANAPTSNIHSACEHAISLLLSTARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++ +F GVE
Sbjct: 121 AADKTLRDGEWKRSSFKGVE 140


>gi|68536373|ref|YP_251078.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
 gi|68263972|emb|CAI37460.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
          Length = 529

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 61  VLEAAPKLQIVGRAGVGLDNVDIDTATSRGVMVANAPTSNIHSACEHAISLLLSTARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++ +F GVE
Sbjct: 121 AADKTLRDGEWKRSSFKGVE 140


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KV+GRAG+G DN+D   A+  GIVV+N P GN+I  AEH +++ML +AR++P A  
Sbjct: 62  AKKLKVIGRAGVGVDNIDRNAATNKGIVVVNAPDGNTIAAAEHTMAMMLGLARKVPAACG 121

Query: 65  STHKGKWEKFNFMGVE 80
               G W+K  F+GVE
Sbjct: 122 KLKNGIWDKKAFLGVE 137


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVVGRAG+G DNVDL  ASR GI+V+NTP  N++  AE  I+ M A+ R++ 
Sbjct: 59  LLERAKRLKVVGRAGVGVDNVDLEAASRRGILVVNTPGANTVGAAELTIAHMYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A+ES  +G+W +  FMG E
Sbjct: 119 LAHESMLQGEWNRKKFMGEE 138


>gi|148690212|gb|EDL22159.1| mCG50387 [Mus musculus]
          Length = 204

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S A+K++VVGRAG G DNVDL  A+R GI+VMNTP  NS++  E    +++ +ARQIP
Sbjct: 65  VISAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNVNSLSAEELTCGMIMCLARQIP 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      GKW++  FMG E
Sbjct: 125 QATAWMKDGKWDQKKFMGTE 144


>gi|255932639|ref|XP_002557876.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582495|emb|CAP80682.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 596

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LM+++AR+IP
Sbjct: 64  VLRAAKNLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALMMSMARKIP 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            +  S   GKWE+  F+GVE
Sbjct: 124 ESCASLKDGKWERSKFVGVE 143


>gi|126179793|ref|YP_001047758.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
 gi|125862587|gb|ABN57776.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
          Length = 527

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K +GRAG G DN+D   A+R GI+V N P GN++   EH +++ML++AR IP A  S 
Sbjct: 64  KLKFIGRAGAGVDNIDTDAATRRGIIVANAPEGNTLAATEHTMAMMLSLARNIPQATASL 123

Query: 67  HKGKWEKFNFMGVE 80
            KG+W++  FMGVE
Sbjct: 124 KKGEWKRSKFMGVE 137


>gi|154313912|ref|XP_001556281.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
 gi|150849045|gb|EDN24238.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
          Length = 487

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK +KVV RAG+G DN+D+  A++ GI+V+N+P GN    AEH I+L++A+AR +P
Sbjct: 75  ILAAAKNLKVVARAGVGVDNIDVEAATKHGIIVVNSPSGNIAAAAEHTIALLMAVARNVP 134

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G WE+   +G E G
Sbjct: 135 AGDRSLRSGGWERGKLVGTEVG 156


>gi|323704756|ref|ZP_08116333.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535682|gb|EGB25456.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 533

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S  K +KV+GRAG G DN+DL+ A+  GI+V+NTP GN I+ AEH I LML+IAR IP
Sbjct: 56  LISKGKNLKVIGRAGNGVDNIDLLAATEKGIIVVNTPEGNIISAAEHTIGLMLSIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      G + +  F GVE
Sbjct: 116 QAYIGAKNGDFRRNKFKGVE 135


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S  K +KV+GRAG G DN+DL+ A+  GI+V+NTP GN I+ AEH I LML+IAR IP
Sbjct: 56  LISKGKNLKVIGRAGNGVDNIDLLAATEKGIIVVNTPEGNIISAAEHTIGLMLSIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      G + +  F GVE
Sbjct: 116 QAYNGAINGDFRRNKFKGVE 135


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D+  A+R GIVVMNTP GN+I+TAEH I++M++++R I 
Sbjct: 62  VLEGQSRLKAIVRAGVGVDNIDIPAATRQGIVVMNTPGGNTISTAEHTIAMMMSLSRNIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWE+  F G +
Sbjct: 122 PAAASMREGKWERKLFTGTQ 141


>gi|254430175|ref|ZP_05043878.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
 gi|197624628|gb|EDY37187.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
          Length = 528

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIAAAGKLRIIGRAGVGVDNVDVPAATKRGVLVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G W++  ++G E
Sbjct: 117 HAHGSTMAGGWDRKTYVGNE 136


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML ++R IP
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLTLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW++  F+G E
Sbjct: 117 QAHGGMRAGKWDRKKFVGNE 136


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIEAAGKLRIIGRAGVGVDNVDVPAATKRGVIVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G W++  ++G E
Sbjct: 117 HAHVSTMAGGWDRKKYVGNE 136


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAASKLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW++  ++G E
Sbjct: 117 QAHAGMRVGKWDRKKYVGNE 136


>gi|227504457|ref|ZP_03934506.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
 gi|227199105|gb|EEI79153.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
          Length = 528

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLAAATNLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S  +G+W++  F GVE
Sbjct: 119 AADQSLRQGEWKRSCFKGVE 138


>gi|322437164|ref|YP_004219376.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
 gi|321164891|gb|ADW70596.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
          Length = 570

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K++V+GRAG+G DN+D   A+  GIVVMNTP  N++  AE  + LM+++ R IP
Sbjct: 76  LLESAPKLRVIGRAGVGVDNIDTAAATHRGIVVMNTPGANAVAVAELTLGLMISMGRSIP 135

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN++ H+G W+K +  G E
Sbjct: 136 RANKTMHEGVWDKKSLQGSE 155


>gi|300858316|ref|YP_003783299.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685770|gb|ADK28692.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206033|gb|ADL10375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis C231]
 gi|302330586|gb|ADL20780.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276270|gb|ADO26169.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis I19]
          Length = 531

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAISL+LA ARQIP
Sbjct: 62  VFDAAAKLKIVGRAGVGLDNVDIAAATERGVMVVNAPTSNIHSACEHAISLLLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W++ +F GVE
Sbjct: 122 AADASLRGQEWKRSSFTGVE 141


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|169619920|ref|XP_001803372.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
 gi|111058367|gb|EAT79487.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
          Length = 571

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+KVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKLKVVARAGVGVDNVDVASATTHGIIVVNSPSGNINAAAEHTIALLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S   GKWE+   +GVEA
Sbjct: 125 DAAQSIKAGKWERSRLVGVEA 145


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (75%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK++K++ RAGIG +N+ +  A+  GIVV NTP G++ T AEHAI++M+++AR IP A+E
Sbjct: 62  AKRLKIIARAGIGVENIAMDAANIKGIVVTNTPLGSTTTIAEHAIAMMMSLARLIPQAHE 121

Query: 65  STHKGKWEKFNFMG 78
           S  +GKW+   F+G
Sbjct: 122 SMSQGKWQSTEFLG 135


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +  K+K++GRAG+G DNVD+  AS+ GI+VMN P GN++   E  + +MLA AR+IP
Sbjct: 61  LLENPGKLKIIGRAGVGLDNVDIEAASKKGIIVMNAPTGNTLAATELTMGMMLAAARKIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W +  FMG++
Sbjct: 121 AAHISLKNGEWNRKKFMGIQ 140


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP
Sbjct: 67  VIEAAKSLKLIGRAGVGVDNIDLTAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARHIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   GKW++ +++GVE
Sbjct: 127 QAFNTLKNGKWDRKSYVGVE 146


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L   ++M+ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEH  +LMLA++R++  
Sbjct: 60  LEGNRRMRAIARAGVGTDNIDKNAATRLGIVVMNTPTGNTLSTAEHTFTLMLALSRRVAE 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A      GKW++  FMG +
Sbjct: 120 AYHKLIGGKWDRKTFMGTQ 138


>gi|986918|gb|AAB67986.1| A10 [Mus musculus]
          Length = 485

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
          +++ A+K++VVGRA  G DNVDL   +R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 15 VINAAEKLQVVGRAVTGVDNVDLEPPTRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 74

Query: 61 VANESTHKGKWEKFNFMGVE 80
              S   GKW++  FMG E
Sbjct: 75 QTTASMKDGKWDRKKFMGTE 94


>gi|118580120|ref|YP_901370.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
 gi|118502830|gb|ABK99312.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 539

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K++K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L++   R+I 
Sbjct: 58  VLDAGKRLKIVARAGVGIDNVDVDYASSKGVIVINAPFGNTNSAAEHALALLMTFCRKIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN S   G+W++  F G E
Sbjct: 118 IANASLKSGEWKRAPFTGYE 137


>gi|73668955|ref|YP_304970.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
 gi|72396117|gb|AAZ70390.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
          Length = 523

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A++ GI+V N+P GN I+ AEH I++M+A++R IP
Sbjct: 56  IIEAADNLKIIGRAGVGIDNVDVDAATKKGIIVANSPEGNMISAAEHTIAMMMAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    +W++  F GVE
Sbjct: 116 QANASLKGKEWKRSKFTGVE 135


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  VAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANSALKNGEWKRSKYTGVE 139


>gi|288559935|ref|YP_003423421.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
 gi|288542645|gb|ADC46529.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
          Length = 524

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DNVD+  A++ GI+V+N P   SIT AEH + L+L+  R+I 
Sbjct: 56  VIEKADNLKIIARAGVGVDNVDVNAATKKGIMVVNAPESTSITVAEHTMGLILSTIRKIA 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++ST  GKWEK  FMG+E
Sbjct: 116 IADKSTKAGKWEKKAFMGME 135


>gi|154270428|ref|XP_001536069.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150409996|gb|EDN05384.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 603

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRA +G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 71  VLQAGKNLKVVGRAVVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 130

Query: 61  VANESTHKGKWEKFNFMGVE 80
               S   GKWE+   +GVE
Sbjct: 131 DGCSSLKNGKWERSRLVGVE 150


>gi|25027935|ref|NP_737989.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium efficiens
           YS-314]
 gi|259506328|ref|ZP_05749230.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
 gi|23493218|dbj|BAC18189.1| putative D-3-phosphoglycerate dehydrogenase [Corynebacterium
           efficiens YS-314]
 gi|259166108|gb|EEW50662.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
          Length = 530

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHA+SL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVMVANAPTSNIHSACEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   G+W++ +F GVE
Sbjct: 122 AADATLRDGEWKRSSFNGVE 141


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  VAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|288932457|ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
 gi|288894705|gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
          Length = 527

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+K++GRAG+G DN+D+  A+  GI+V+N P GN+I+TAE  + L+++ AR+IP
Sbjct: 57  IIERGEKLKIIGRAGVGVDNIDVDAATERGIIVVNAPGGNTISTAELTMGLIISAARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +GKWE+  F G+E
Sbjct: 117 QADRSVKEGKWERKKFEGLE 136


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML ++R IP
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLTLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW++  ++G E
Sbjct: 117 QAHGGMQAGKWDRKKYVGNE 136


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 56/76 (73%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP A  
Sbjct: 73  AKNLKLIGRAGVGVDNIDLAAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARHIPQAFN 132

Query: 65  STHKGKWEKFNFMGVE 80
           +   GKW++ +++GVE
Sbjct: 133 TLKNGKWDRKSYVGVE 148


>gi|38233698|ref|NP_939465.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38199959|emb|CAE49627.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae]
          Length = 531

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VLNAATNLKIVGRAGVGLDNVDIATATDKGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++ +F GVE
Sbjct: 122 AADKTLRVGEWKRSSFKGVE 141


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++L++A  R + 
Sbjct: 58  LLDAAKNLKMVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHTMALLMAACRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           VAN S   G+W++  F GVE
Sbjct: 118 VANASLKAGEWKRAPFTGVE 137


>gi|78189340|ref|YP_379678.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
 gi|78171539|gb|ABB28635.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
          Length = 538

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++++GRAG G DN+DL  A+R GIVVM+TP GN+++ AEH  +++LA AR IP
Sbjct: 69  VLAKATQLELIGRAGTGVDNIDLEAATRQGIVVMSTPGGNAVSAAEHTCAMLLAAARHIP 128

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A     +G W K  + G+E
Sbjct: 129 QAMADLKQGNWNKHLYAGIE 148


>gi|303311837|ref|XP_003065930.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105592|gb|EER23785.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039874|gb|EFW21808.1| D-3-phosphoglycerate dehydrogenase [Coccidioides posadasii str.
           Silveira]
          Length = 589

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LMLA AR+I 
Sbjct: 66  VLQTAKNLKVVARAGVGVDNVDVDTATKLGIVVVNSPAGNVGAAAEHTIALMLATARKIS 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+  F+GVE
Sbjct: 126 HACSSLKGDKWERSKFVGVE 145


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG GTDN+D+  A++ G++V NTP  NSI+  E  I+LM+A AR + 
Sbjct: 59  LLEKATKLRIVGRAGNGTDNIDIHAATKKGVIVANTPESNSISACELGIALMMACARDVS 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           VA++    GKW + +F GVE
Sbjct: 119 VADKDMKAGKWSRNSFEGVE 138


>gi|320105785|ref|YP_004181375.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
 gi|319924306|gb|ADV81381.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
          Length = 537

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K++V+GRAG+G DN+D   A+  GIVVMNTP  N++  AE  + LM+ +AR IP
Sbjct: 57  LLESAPKLRVIGRAGVGVDNIDAPAATHKGIVVMNTPGANAVAVAELTLGLMITMARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN + H G W+K +  G E
Sbjct: 117 RANATMHAGVWDKKSLQGQE 136


>gi|296119581|ref|ZP_06838139.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
 gi|295967464|gb|EFG80731.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
          Length = 528

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAISL+L+ ARQIP
Sbjct: 59  VLEAASNLKIVGRAGVGLDNVDVPAATTRGVMVVNAPTSNIHSACEHAISLLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++ +F GVE
Sbjct: 119 QADATLREGEWKRSSFKGVE 138


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  IAAAKRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|222056517|ref|YP_002538879.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
 gi|221565806|gb|ACM21778.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
          Length = 540

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   + +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+LA  R I 
Sbjct: 58  LLDAGRNLKMVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHAMALLLAFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F GVE
Sbjct: 118 KANASLKNGEWKRAPFTGVE 137


>gi|310794865|gb|EFQ30326.1| phosphoglycerate dehydrogenase [Glomerella graminicola M1.001]
          Length = 567

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  KK++VV RAG+G DN+D+  A+  GI+V+N+P GN    AEH I+L+LA AR + 
Sbjct: 76  VLAAGKKLRVVARAGVGVDNIDVDTATERGIIVVNSPNGNIFAAAEHTIALLLATARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 136 RADTTMKEGKWERSKLVGVEVG 157


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH +++M ++AR IP
Sbjct: 67  VIEAAKSLKLIGRAGVGVDNIDLAAATEHGIIVVNAPDGNTNSAAEHTVAMMTSLARHIP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   GKW++ +++GVE
Sbjct: 127 QAFNTLKNGKWDRKSYVGVE 146


>gi|302524967|ref|ZP_07277309.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
 gi|302433862|gb|EFL05678.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
          Length = 532

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR++P
Sbjct: 62  VLGATTQLKVVARAGVGLDNVEVPAATERGVLVVNAPTSNIVSAAEHAVALLLAVARRVP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   G+W++ +F GVE
Sbjct: 122 AADQSLRGGEWKRSSFSGVE 141


>gi|148265877|ref|YP_001232583.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146399377|gb|ABQ28010.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 539

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++L+LA  R I 
Sbjct: 58  LLDAAKKLKMVARAGVGIDNVDVDYASARGVIVVNAPFGNTNSAAEHTMALLLAFYRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F G E
Sbjct: 118 KANASLKSGEWKRAPFTGYE 137


>gi|300933674|ref|ZP_07148930.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium resistens DSM
           45100]
          Length = 530

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 55/76 (72%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP A++
Sbjct: 66  APKLQIVGRAGVGLDNVDIETATARGVMVANAPTSNIHSACEHAISLLLSTARQIPAADK 125

Query: 65  STHKGKWEKFNFMGVE 80
           +   G+W++ +F GVE
Sbjct: 126 TLRDGEWKRSSFKGVE 141


>gi|325675891|ref|ZP_08155575.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
 gi|325553862|gb|EGD23540.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
          Length = 530

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  + AEHA+SL+L+ ARQIP
Sbjct: 62  VLAAATKLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSAAEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 122 AADRTLREKTWKRSSFNGTE 141


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIERAEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  F G+E
Sbjct: 117 QATASLKRGEWDRKRFKGIE 136


>gi|299136357|ref|ZP_07029541.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
 gi|298602481|gb|EFI58635.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
          Length = 540

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++++GRAG+G DN+D   A+R GIVVMNTP  N++  AE  + LM+++ R IP AN + 
Sbjct: 64  KLRIIGRAGVGVDNIDANEATRRGIVVMNTPGANAVAVAELTLGLMISMCRAIPRANAAL 123

Query: 67  HKGKWEKFNFMGVE 80
           H GKWEK +  G E
Sbjct: 124 HVGKWEKKSLQGSE 137


>gi|260812008|ref|XP_002600713.1| hypothetical protein BRAFLDRAFT_123498 [Branchiostoma floridae]
 gi|229286002|gb|EEN56725.1| hypothetical protein BRAFLDRAFT_123498 [Branchiostoma floridae]
          Length = 323

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (73%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG G DNVD+  A++  IVVMNTP GN+++ AEH   L+ ++ARQIP A+ S  
Sbjct: 70  LKIVGRAGTGVDNVDIPSATKKNIVVMNTPGGNTLSAAEHTCFLIGSLARQIPQAHMSMR 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  FMG E
Sbjct: 130 EGRWDRKKFMGNE 142


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A+K+K++GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIENAEKLKIIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTLGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  F G+E
Sbjct: 117 QATASLKRGEWDRKRFKGIE 136


>gi|148654451|ref|YP_001274656.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
 gi|148566561|gb|ABQ88706.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
          Length = 524

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++VVGRAG G DN+DL  A+R GI+V+N P  NS+  AE  I+L+L++AR IP
Sbjct: 57  VLAAGTRLRVVGRAGTGVDNIDLEAATRQGIMVVNAPASNSVAVAELTIALILSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   GKWE+  FMG E
Sbjct: 117 QAHSSVVAGKWERNRFMGFE 136


>gi|189346493|ref|YP_001943022.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
 gi|189340640|gb|ACD90043.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
          Length = 526

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG G DN+D+  A+R GI+VMNTP GN+++ AEHA  +++A AR IP
Sbjct: 57  IIECGKNLKLIGRAGAGVDNIDIEAATRHGIIVMNTPGGNTVSAAEHACGMLMAAARMIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      G W K  F G+E
Sbjct: 117 QATAELKAGLWNKKKFTGIE 136


>gi|119193730|ref|XP_001247470.1| hypothetical protein CIMG_01241 [Coccidioides immitis RS]
          Length = 585

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LM+  AR+I 
Sbjct: 66  VLQTAKKLKVVARAGVGVDNVDVDTATKLGIVVVNSPAGNVGAAAEHTIALMMGTARKIS 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+  F+GVE
Sbjct: 126 HACSSLKGDKWERSKFVGVE 145


>gi|300781348|ref|ZP_07091202.1| phosphoglycerate dehydrogenase [Corynebacterium genitalium ATCC
           33030]
 gi|300533055|gb|EFK54116.1| phosphoglycerate dehydrogenase [Corynebacterium genitalium ATCC
           33030]
          Length = 527

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAI+L+L+ ARQIP
Sbjct: 59  VLEAAPNLRIVGRAGVGLDNVDVPTATERGVMVVNAPTSNIHSACEHAIALLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++ +F GVE
Sbjct: 119 AADKTLRDGEWKRSSFKGVE 138


>gi|300783616|ref|YP_003763907.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793130|gb|ADJ43505.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 532

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 57/74 (77%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR++P A++S 
Sbjct: 68  QLKVVARAGVGLDNVEVPAATERGVLVVNAPTSNIVSAAEHAVALLLAVARRVPAADQSL 127

Query: 67  HKGKWEKFNFMGVE 80
             G+W++ +F GVE
Sbjct: 128 RGGEWKRSSFSGVE 141


>gi|302408012|ref|XP_003001841.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
 gi|261359562|gb|EEY21990.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
          Length = 630

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  KK+KVV RAG+G DN+D+  A++ GI+V+N+P GN +  AEH I+L+ A AR + 
Sbjct: 76  VLAAGKKLKVVARAGVGVDNIDVDAATQHGIIVVNSPAGNILAAAEHTIALLFATARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +   GKWE+   +GVE G
Sbjct: 136 RADTTMKDGKWERGKLVGVEVG 157


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVPAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIEKAEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  F G+E
Sbjct: 117 QATASLKRGEWDRKRFKGIE 136


>gi|302542286|ref|ZP_07294628.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459904|gb|EFL22997.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 533

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 125 ANAALKNGEWKRSKYTGVE 143


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   +K+KVV RAG+G DN+D   A++ GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 60  ILKAGQKLKVVARAGVGVDNIDTETATKEGIIVINAPDGNTISATEHSVAMILSMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W++  F G E
Sbjct: 120 QAHASLSHGEWDRKTFRGTE 139


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  LAAAKQLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|312140491|ref|YP_004007827.1| d-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
 gi|311889830|emb|CBH49147.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
          Length = 530

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  + AEHA+SL+L+ ARQIP
Sbjct: 62  VLAAATKLKIVGRAGVGLDNVDIPAATDRGVMVVNAPTSNIHSAAEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 122 AADRTLREKTWKRSSFNGTE 141


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+ RAG+G DNVDL  A+  GI+V+N+P  +S++ AE  I  ML+ AR IP
Sbjct: 57  IIDVAKKLKVIARAGVGVDNVDLQAATEKGIIVVNSPDASSVSVAELTIGFMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++ +F GVE
Sbjct: 117 QATASLKRGEWDRKSFKGVE 136


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIEKAEKLKVIGRAGVGVDNIDVDAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  F G+E
Sbjct: 117 QATASLKRGEWDRKRFKGIE 136


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AK +KVVGRAG+G DN+DL  ASR GI+V+N P GN++   EH + +M+  AR IP
Sbjct: 61  LFERAKNLKVVGRAGVGVDNIDLDEASRRGILVVNAPTGNTLAATEHTMGMMICAARAIP 120

Query: 61  VANES-THKGKWEKFNFMGVE 80
            A+ S   + +W++  FMGVE
Sbjct: 121 YAHNSLKEERRWDRKKFMGVE 141


>gi|322710973|gb|EFZ02547.1| d-3-phosphoglycerate dehydrogenase [Metarhizium anisopliae ARSEF
           23]
          Length = 572

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV RAG+G DN+++  A+  GI+V+N+P GN +  AEH I+L+LA AR + 
Sbjct: 73  VLQAGKKLKVVARAGVGVDNINVPAATTQGIIVINSPAGNILAAAEHTIALLLATARNVG 132

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 133 RADGTIKEGKWERSKLVGVEVG 154


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++++ RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R +P
Sbjct: 58  LLDAGTKLRLIARAGVGIDNVDVDYASSRGVIVVNAPFGNTNSAAEHAMALLLSFCRNVP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F G E
Sbjct: 118 RANGSLKSGEWKRAPFTGYE 137


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+D   A+  GI+V+N P GN+I  AE  +++MLA+AR++P
Sbjct: 59  VIEAATKLKVIGRAGVGVDNIDRTAATNKGILVVNAPDGNTIAAAELTMAMMLALARKVP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A      G W+K  F+GVE
Sbjct: 119 MACSKLKNGVWDKKAFLGVE 138


>gi|111023450|ref|YP_706422.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110822980|gb|ABG98264.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 531

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++LMLA ARQIP
Sbjct: 62  VLAAGTKLKIVARAGVGLDNVDVAAATERGVMVVNAPTSNIHTAAEHAVALMLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +    +W++  F GVE
Sbjct: 122 AADATLRDREWKRSKFNGVE 141


>gi|327301994|ref|XP_003235689.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
 gi|326461031|gb|EGD86484.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
          Length = 571

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR I 
Sbjct: 68  VLQAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIS 127

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    KWE+   +GVE
Sbjct: 128 DACSSLKSNKWERSRLVGVE 147


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 54/73 (73%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DNVDL  A+  G+VV+N P GN+I+TAEH  +++ ++ R IP AN+S  
Sbjct: 75  LKIIGRAGVGVDNVDLDAATANGVVVVNAPDGNTISTAEHTFAMLASVVRNIPQANQSMK 134

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 135 EGRWDRKLYTGTE 147


>gi|296127708|ref|YP_003634960.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
 gi|296019524|gb|ADG72761.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
          Length = 534

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  G++V+N+P GN+I  +EH I+LMLA++R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGVIVVNSPDGNTIAASEHTIALMLAVSRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  ST + KWE+  F G E
Sbjct: 116 PAAVSTKEAKWERDKFTGNE 135


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 64  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 123

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 124 ANTALKNGEWKRSKYTGVE 142


>gi|322699487|gb|EFY91248.1| d-3-phosphoglycerate dehydrogenase [Metarhizium acridum CQMa 102]
          Length = 1253

 Score = 83.2 bits (204), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV RAG+G DN+++  A+  GI+V+N+P GN +  AEH I+L+LA AR + 
Sbjct: 73  VLQAGKKLKVVARAGVGVDNINVPAATTQGIIVINSPAGNILAAAEHTIALLLATARNVG 132

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 133 RADGTIKEGKWERSKLVGVEVG 154


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KV+GRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ M A+ R++ 
Sbjct: 59  LLERAEKLKVIGRAGVGVDNVDLEEASRRGILVVNTPGANTIGAAEITMAHMYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S   G+W++  FMG E
Sbjct: 119 LAHDSVKAGEWKRSKFMGEE 138


>gi|159468538|ref|XP_001692431.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
 gi|158278144|gb|EDP03909.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
          Length = 587

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 51/72 (70%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ A+AR IP A+ S 
Sbjct: 102 RLKVVGRAGVGVDNVDLAAATEAGCLVVNAPTANTVAAAEHGIALLCAMARNIPQADASM 161

Query: 67  HKGKWEKFNFMG 78
             G W++  ++G
Sbjct: 162 KAGSWDRSAYVG 173


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K+++ +GRAG G DN+D+  A+R G++V N P GN++   EH +++M ++ R IP
Sbjct: 58  VIEAGKRLRFIGRAGAGVDNIDMNAATRRGVIVANAPEGNTLAATEHTMAMMQSLCRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  FMGVE
Sbjct: 118 QANASMQAGEWKRSKFMGVE 137


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAG+G DN+D+  A+  GI+V+N P GN++   EH ++LML++AR +P
Sbjct: 57  VMESAPNLKVVGRAGVGVDNIDVSTATERGIIVVNAPDGNTMAATEHTMALMLSLARNLP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W+K  F+GVE
Sbjct: 117 QADARLKSGVWDKKAFVGVE 136


>gi|323698530|ref|ZP_08110442.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfovibrio sp. ND132]
 gi|323458462|gb|EGB14327.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfovibrio desulfuricans ND132]
          Length = 394

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (67%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K+VGR G+GTDN+DL  A   G++V   P GN+  TAEHA+ LM AIAR++P A+ + 
Sbjct: 66  KLKIVGRGGVGTDNIDLEAAKELGVIVKFAPNGNTNATAEHALGLMFAIARKVPFAHRTL 125

Query: 67  HKGKWEKFNFMGVE 80
             G W K  F GVE
Sbjct: 126 MGGTWHKKRFKGVE 139


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A+K++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  LAAARKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VLESASHLKVVARAGVGVDNIDINAATLNGIIVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G W +  F GVE
Sbjct: 120 NAHASLQQGAWNRKAFRGVE 139


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK M++VGRAG G DN+++  A+  G++VMNTP GN+++TAE  +S +LA+AR IP
Sbjct: 98  LITAAKNMRIVGRAGTGVDNINVPAATSKGVLVMNTPGGNTVSTAELTMSHILALARNIP 157

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  + G E
Sbjct: 158 QAVSSMKEGRWDRKKYTGTE 177


>gi|226365951|ref|YP_002783734.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
 gi|226244441|dbj|BAH54789.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
          Length = 531

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++LMLA ARQIP
Sbjct: 62  VLAAGTKLKIVARAGVGLDNVDVPAATERGVMVVNAPTSNIHTAAEHAVALMLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +    +W++  F GVE
Sbjct: 122 AADATLRDREWKRSKFNGVE 141


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  VAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VLESASHLKVVARAGVGVDNIDINAATLNGIIVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G W +  F GVE
Sbjct: 120 NAHASLQQGAWNRKAFRGVE 139


>gi|237834647|ref|XP_002366621.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|211964285|gb|EEA99480.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|221486089|gb|EEE24359.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           GT1]
 gi|221503586|gb|EEE29277.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           VEG]
          Length = 604

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 56/78 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ H +K+K++GRAG+G DNV +  A+  GI V+N+P GN++  AE  + LM+A+AR+IP
Sbjct: 71  IIKHGQKLKIIGRAGVGVDNVCVDAATAQGIFVVNSPNGNTMAAAELTLGLMMALARKIP 130

Query: 61  VANESTHKGKWEKFNFMG 78
            A+ S  +G+W +  FMG
Sbjct: 131 QADASVSRGEWTRSKFMG 148


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSSATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRNKYTGVE 139


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN++   A++ G++V+N P GN+I+  EH+++++LA+ARQIP
Sbjct: 59  VIEAADNLKIIARAGVGVDNINKDAATKRGVLVINAPDGNTISATEHSMAMILAMARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +GKW +  F G E
Sbjct: 119 MAHQSLKEGKWNRSEFKGTE 138


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|327438749|dbj|BAK15114.1| phosphoglycerate dehydrogenase [Solibacillus silvestris StLB046]
          Length = 541

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP
Sbjct: 73  VIEAAKNLKLIGRAGVGVDNIDLNAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARFIP 132

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   GKW++ +++GVE
Sbjct: 133 QAFNTLKNGKWDRKSYVGVE 152


>gi|319441148|ref|ZP_07990304.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium variabile DSM
           44702]
          Length = 531

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAI+L+L+ ARQIP
Sbjct: 62  VLAAAPKLQIVGRAGVGLDNVDIETATAKGVMVANAPTSNIHSACEHAIALLLSAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++    +W++ +F GVE
Sbjct: 122 AADKTLRDAEWKRSSFKGVE 141


>gi|307111670|gb|EFN59904.1| hypothetical protein CHLNCDRAFT_56437 [Chlorella variabilis]
          Length = 609

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  AS  G +V+N P  N++  AEH I+L+ A+AR +P A+ + 
Sbjct: 131 RLKVVGRAGVGIDNVDLAAASEMGCLVVNAPTANTVAAAEHGIALLCALARNVPQADAAM 190

Query: 67  HKGKWEKFNFMGV 79
             G+WE+  ++GV
Sbjct: 191 KGGRWERSKWVGV 203


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K +GRAG G DN+D   A++ GI+V N P GN++   EH +++M ++AR+IP
Sbjct: 58  VIEAAAKLKFIGRAGAGVDNIDTNAATQRGIIVANAPAGNTLAACEHTLAMMASLARKIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  FMGVE
Sbjct: 118 QATASVKRGEWKRSAFMGVE 137


>gi|298528388|ref|ZP_07015792.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512040|gb|EFI35942.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 394

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++GR G+GTDN+DL  A   G+VV   P GN   TAEH I LM AIAR++P A+ + 
Sbjct: 66  KLKIIGRGGVGTDNIDLQAAKECGVVVKFAPHGNINATAEHVIGLMFAIARKVPFAHHTL 125

Query: 67  HKGKWEKFNFMGVE 80
             G W K  F GVE
Sbjct: 126 KSGIWHKARFKGVE 139


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IINSASRLKVIARAGVGVDNIDIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W++  F GVE
Sbjct: 120 QAHQSLRNKEWKRKAFRGVE 139


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKQLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|325003700|ref|ZP_08124812.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia sp. P1]
          Length = 536

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 58/79 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ + ++KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+L+ AR +P 
Sbjct: 66  LAASTRLKVVARAGVGLDNVDVDAATSRGVMVVNAPTSNIVSAAEHAIALLLSAARHVPA 125

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S  +G+W++ ++ GVE
Sbjct: 126 ADASLRQGQWKRSSYGGVE 144


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+GTDN++L  A+R GIVVMNTP GN+ +TAEH I++M+A++R I 
Sbjct: 59  ILKDQPRLKAIVRAGVGTDNINLPAATREGIVVMNTPAGNTTSTAEHTIAMMMALSRNIA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      G W++ +F G +
Sbjct: 119 PAASKLRDGVWDRKSFTGTQ 138


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAARKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRNKYTGVE 139


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+++V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R + 
Sbjct: 58  LLDAGKKLRLVARAGVGIDNVDVDYASSRGVIVVNAPFGNTNSAAEHAMALLLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F G E
Sbjct: 118 RANGSLKSGEWKRAPFTGYE 137


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV R G+G DN+DL  AS+ GI+V+N+P GN++   E  + ++ +IAR+IP
Sbjct: 59  LLEAGKKLKVVARVGVGVDNIDLGAASKMGIIVLNSPTGNTLAATELTMGMIFSIARKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F+G +
Sbjct: 119 QANNSLLSGEWKREKFLGTQ 138


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 59/81 (72%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++KVVGRAG+G DN+D+  A+  G+VV+N P  N+ +TAEHA  L++A+AR IP
Sbjct: 55  VLARGTRLKVVGRAGVGVDNIDVAAATERGVVVVNVPGANTYSTAEHAFGLLIAVARNIP 114

Query: 61  VANES-THKGKWEKFNFMGVE 80
            A+ +   +G+W++ +F+G E
Sbjct: 115 QAHHALAREGRWDRMSFVGTE 135


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IITAASNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKW++  F G E
Sbjct: 120 QAHQSLKSGKWDRKAFRGTE 139


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A+R G+VV+N P GN+I+TAEH  ++M ++ R+IP
Sbjct: 56  LLQKMTNLKIVGRAGVGVDNIDVDAATRYGVVVINAPNGNTISTAEHTFAMMASLVRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G+E
Sbjct: 116 QAHISVKSREWNRSAFVGIE 135


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 58/76 (76%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++++L+++R +P A+ 
Sbjct: 61  ADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMLLSVSRHVPQAHG 120

Query: 65  STHKGKWEKFNFMGVE 80
           S   G W++  ++G E
Sbjct: 121 SMRSGAWDRKKYVGNE 136


>gi|225458719|ref|XP_002283022.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 605

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (68%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S  +++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH ++L+ A+AR I  A
Sbjct: 122 SAGRRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGVALLTAMARNIAQA 181

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKWE+  ++GV
Sbjct: 182 DASVKAGKWERSKYVGV 198


>gi|302142267|emb|CBI19470.3| unnamed protein product [Vitis vinifera]
          Length = 532

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (68%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S  +++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH ++L+ A+AR I  A
Sbjct: 64  SAGRRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGVALLTAMARNIAQA 123

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKWE+  ++GV
Sbjct: 124 DASVKAGKWERSKYVGV 140


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DNVDL  A+  GI+V+N+P  +SI+ AE A+ LML+ AR IP
Sbjct: 57  IIDAADNLKVIARAGVGVDNVDLTAATEKGIIVVNSPDASSISVAELALGLMLSSARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++ +F G+E
Sbjct: 117 QATASLKRGEWDRKSFKGME 136


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLRVVARAGVGLDNVDVSSATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|156740285|ref|YP_001430414.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
 gi|156231613|gb|ABU56396.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
          Length = 524

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++VVGRAG G DN+DL  A+R GI+V+N P  NS+  AE  I L+L++AR IP
Sbjct: 57  VLAAGTRLRVVGRAGTGVDNIDLDAATRQGIMVVNAPASNSVAVAELTIGLILSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   GKWE+  FMG E
Sbjct: 117 QAHSTVVAGKWERNRFMGFE 136


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 57/74 (77%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AE A++LML+++R +P A+ ST
Sbjct: 67  RLRIIGRAGVGVDNVDVPTATQQGVLVVNSPEGNTIAAAEQALALMLSLSRHVPQAHAST 126

Query: 67  HKGKWEKFNFMGVE 80
             G W++  ++G E
Sbjct: 127 MAGGWDRKKYVGNE 140


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 57/74 (77%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AE A++LML+++R +P A+ ST
Sbjct: 63  RLRIIGRAGVGVDNVDVPTATQQGVLVVNSPEGNTIAAAEQALALMLSLSRHVPQAHAST 122

Query: 67  HKGKWEKFNFMGVE 80
             G W++  ++G E
Sbjct: 123 MAGGWDRKKYVGNE 136


>gi|39971783|ref|XP_367282.1| hypothetical protein MGG_07207 [Magnaporthe oryzae 70-15]
 gi|145019699|gb|EDK03927.1| hypothetical protein MGG_07207 [Magnaporthe oryzae 70-15]
          Length = 586

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 58/82 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A K++VV RAG+G DN+++  A++ GI+V+N+P GN +  AEH ++L+LA AR + 
Sbjct: 76  VLSAAAKLRVVARAGVGVDNINVDAATKQGIIVVNSPAGNIVAAAEHTVALLLATARHVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  + KWE+   +GVE G
Sbjct: 136 RADSTLKQRKWERSKLVGVEVG 157


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+D+  A++ G++V+N P GN+I+  EH+++++L++AR IP
Sbjct: 59  IIEAAPNLKVIARAGVGVDNIDVDAATKHGVIVINAPDGNTISATEHSMAMILSMARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKW++  + G E
Sbjct: 119 QAHQSLKDGKWDRKTYRGTE 138


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++K++GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  I LMLA AR I 
Sbjct: 56  LIERGKRLKIIGRAGVGVDNIDVEAATERGIIVVNAPDASSISVAELTIGLMLAAARNIV 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S  +G+W +  F G+E
Sbjct: 116 QANNSVKRGEWNRKKFKGIE 135


>gi|288919125|ref|ZP_06413464.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
 gi|288349469|gb|EFC83707.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
          Length = 529

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHA++L+L++AR++P 
Sbjct: 58  LAAAPRLKVVARAGIGLDNVDVPAATSRGVMVVNAPQSNIVSAAEHAVALLLSVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  ++GVE
Sbjct: 118 AHGALVGGEWKRSKYVGVE 136


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KV+GRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ + A+ R++ 
Sbjct: 59  LLERAEKLKVIGRAGVGVDNVDLEEASRRGILVVNTPGANTIGAAEITMAHLYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S   G+W++  FMG E
Sbjct: 119 LAHDSVKAGEWKRSKFMGEE 138


>gi|46135935|ref|XP_389659.1| hypothetical protein FG09483.1 [Gibberella zeae PH-1]
          Length = 591

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 55/77 (71%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           +K++VV RAG+G DN+D+  AS  G++V+N+P GN +  AEH I+L+L+ AR +  A+ S
Sbjct: 78  RKLRVVARAGVGVDNIDVPAASTQGVIVVNSPSGNILAAAEHTIALLLSAARNVGQADGS 137

Query: 66  THKGKWEKFNFMGVEAG 82
             +G+WE+   +GVE G
Sbjct: 138 VKEGRWERSKLVGVEVG 154


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVVGRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ + A+ R++ 
Sbjct: 59  LLERAEKLKVVGRAGVGVDNVDLEEASRRGILVINTPGANTIGAAEITMAHLYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +G+W++  FMG E
Sbjct: 119 LAHKSMLEGQWDRKRFMGEE 138


>gi|300870001|ref|YP_003784872.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
 gi|300687700|gb|ADK30371.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
          Length = 534

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I  +EH I+LMLAI+R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGIIVVNSPDGNTIAASEHTIALMLAISRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  ST + KW +  F G E
Sbjct: 116 PAVVSTKEAKWNRDKFTGNE 135


>gi|225619505|ref|YP_002720762.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
 gi|225214324|gb|ACN83058.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
          Length = 534

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I  +EH I+LMLA++R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGIIVVNSPDGNTIAASEHTIALMLAVSRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  ST + KW +  F G E
Sbjct: 116 PAAVSTKEAKWNRDKFTGNE 135


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K +GRAG+G DN+D   A+R GI+V N P GN++   EH +++M+A+AR IP AN S  
Sbjct: 69  LKFIGRAGVGVDNIDTDAATRQGIIVANAPEGNTLAATEHTVAMMMALARNIPQANASVK 128

Query: 68  KGKWEKFNFMGVE 80
           + +W++  F G+E
Sbjct: 129 RHEWKRSKFTGIE 141


>gi|317154068|ref|YP_004122116.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316944319|gb|ADU63370.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 394

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (67%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K+VGR G+GTDN+DL  A   G++V   P GN+  TAEHA+ LM AIAR++P A+ + 
Sbjct: 66  RLKIVGRGGVGTDNIDLEAAKELGVIVKFAPNGNTNATAEHALGLMFAIARRVPFAHHTL 125

Query: 67  HKGKWEKFNFMGVE 80
             G W K  F GVE
Sbjct: 126 MDGVWHKKRFSGVE 139


>gi|302786926|ref|XP_002975234.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
 gi|300157393|gb|EFJ24019.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
          Length = 629

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  AN S 
Sbjct: 150 RLKVVGRAGVGIDNVDLQAATEMGCLVVNAPTANTVAAAEHGIALLAALARNVAQANASV 209

Query: 67  HKGKWEKFNFMGV 79
             GKW++  F GV
Sbjct: 210 KSGKWQRNKFTGV 222


>gi|302894595|ref|XP_003046178.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727105|gb|EEU40465.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 568

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   +K++VV RAG+G DN+D+  A+  GI+V+N+P GN I  AEH I+L+LA AR I 
Sbjct: 73  VLQAGRKLRVVARAGVGVDNIDVPAATTQGIIVVNSPSGNIIAAAEHTIALLLATARNIG 132

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++   +G EA
Sbjct: 133 QADSSVKAGRWDRSKLVGSEA 153


>gi|312898434|ref|ZP_07757824.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
 gi|310620353|gb|EFQ03923.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
          Length = 538

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+K+VGRAG+G D++DL  A+  GI+V+N P  N+I   EH  +++LA+ R IP
Sbjct: 61  VIEKAKKLKIVGRAGVGIDSIDLKAATARGIIVVNAPTSNTIAATEHTCAMILAVTRHIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   G+W +  F G++
Sbjct: 121 QAHDSLMSGEWNREKFTGIQ 140


>gi|297156963|gb|ADI06675.1| D-3-phosphoglycerate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 534

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IAAAKNLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 125 ANAALKNGEWKRSKYTGVE 143


>gi|54026192|ref|YP_120434.1| D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM 10152]
 gi|54017700|dbj|BAD59070.1| putative D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM
           10152]
          Length = 532

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++L+LA ARQIP
Sbjct: 62  VLEAGKNLKIVARAGVGLDNVDVPAATERGVMVVNAPTSNIHTAAEHAVTLLLAAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++  F GVE
Sbjct: 122 AADATLREHTWQRSKFNGVE 141


>gi|321477734|gb|EFX88692.1| hypothetical protein DAPPUDRAFT_41785 [Daphnia pulex]
          Length = 374

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+++VGRAG G DNVD+  A+R G++VMNTP GN+++ AEH  +++ A++R IP
Sbjct: 62  VLAAATKLRLVGRAGTGLDNVDISAATRRGVLVMNTPGGNTMSAAEHTCAMIAALSRHIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G W++  +MG E
Sbjct: 122 QACAALKNGVWDRKTYMGNE 141


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K ++++ RAG+G DN+D+  A+  GI+V+N P   SIT AEH + LML +AR+I 
Sbjct: 57  VIEAGKNLEIIARAGVGVDNIDVGAATEKGIMVVNAPESTSITVAEHTMGLMLTLARKIV 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +G+W +  FMG+E
Sbjct: 117 LADKSVRRGEWNRSKFMGIE 136


>gi|227548065|ref|ZP_03978114.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079863|gb|EEI17826.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 554

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+  G++V N P  N  +  EHAI+L+LA ARQIP
Sbjct: 86  VIEAAPQLKIIGRAGVGLDNVDIDAATERGVMVANAPTSNIHSACEHAIALLLATARQIP 145

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++    +W++  F GVE
Sbjct: 146 AADKTLRDAEWKRSAFKGVE 165


>gi|302785179|ref|XP_002974361.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
 gi|300157959|gb|EFJ24583.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
          Length = 545

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  AN S 
Sbjct: 66  RLKVVGRAGVGIDNVDLQAATEMGCLVVNAPTANTVAAAEHGIALLAALARNVAQANASV 125

Query: 67  HKGKWEKFNFMGV 79
             GKW++  F GV
Sbjct: 126 KSGKWQRNKFTGV 138


>gi|224060560|ref|XP_002300235.1| predicted protein [Populus trichocarpa]
 gi|118485917|gb|ABK94804.1| unknown [Populus trichocarpa]
 gi|222847493|gb|EEE85040.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (67%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S   ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+LM A+AR +  A
Sbjct: 114 SSGGRLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALMAAMARNVAQA 173

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKWE+  ++GV
Sbjct: 174 DASVKAGKWERNKYVGV 190


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAEKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANTALKNGEWKRSKYTGVE 139


>gi|256380010|ref|YP_003103670.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
 gi|255924313|gb|ACU39824.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
          Length = 532

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 55/74 (74%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+L++ARQIP A+ + 
Sbjct: 68  KLKVVARAGVGLDNVEVPAATERGVMVVNAPTSNIVSAAEHAVALLLSVARQIPAAHATL 127

Query: 67  HKGKWEKFNFMGVE 80
             G W++ +F GVE
Sbjct: 128 AGGAWKRSSFNGVE 141


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAHKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|305682015|ref|ZP_07404819.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
 gi|305658488|gb|EFM47991.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
          Length = 531

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L  ARQIP
Sbjct: 62  VLEAAPHLKIVGRAGVGLDNVDIATATERGVMVANAPTSNIHSACEHAISLLLTTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++  F GVE
Sbjct: 122 AADATLRQHTWKRSEFTGVE 141


>gi|307326525|ref|ZP_07605720.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
 gi|306887933|gb|EFN18924.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
          Length = 533

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IALAKKLKVVARAGVGLDNVDVSTATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 125 ASAALKNGEWKRSKYTGVE 143


>gi|320160110|ref|YP_004173334.1| D-3-phosphoglycerate dehydrogenase [Anaerolinea thermophila UNI-1]
 gi|319993963|dbj|BAJ62734.1| D-3-phosphoglycerate dehydrogenase [Anaerolinea thermophila UNI-1]
          Length = 314

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 52/75 (69%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K++KVVGRAGIG DN+DL  A  AG+ V+N+P   +++ AE A+ LMLA+ R+IP A+ S
Sbjct: 64  KRLKVVGRAGIGVDNIDLNAARAAGVTVVNSPLATTVSVAELAMGLMLALVREIPRADAS 123

Query: 66  THKGKWEKFNFMGVE 80
             + KW K  F G E
Sbjct: 124 MKQNKWLKKEFEGHE 138


>gi|225022672|ref|ZP_03711864.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224944580|gb|EEG25789.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 558

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L  ARQIP
Sbjct: 89  VLEAAPHLKIVGRAGVGLDNVDIATATERGVMVANAPTSNIHSACEHAISLLLTTARQIP 148

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++  F GVE
Sbjct: 149 AADATLRQHTWKRSEFTGVE 168


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 53/76 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++VV RAG G DN+D+  A+ AGI+V+N P  N+++  EH I+L+LA+ RQIP
Sbjct: 252 VLAAGPSLRVVARAGTGVDNIDVQGATEAGILVLNAPGANAVSAGEHTIALLLALTRQIP 311

Query: 61  VANESTHKGKWEKFNF 76
            AN + H G+WE+  F
Sbjct: 312 DANAAVHAGRWERKRF 327


>gi|41054619|ref|NP_955871.1| D-3-phosphoglycerate dehydrogenase [Danio rerio]
 gi|33990002|gb|AAH56334.1| Zgc:65956 [Danio rerio]
          Length = 527

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG G DNVD+  A++ GI+VMNTP GN+++ AE   +L+++++R IP A  S  
Sbjct: 70  LKIIGRAGTGVDNVDVDAATKRGIIVMNTPSGNTLSAAELTCALVMSLSRHIPQAVISMK 129

Query: 68  KGKWEKFNFMGVE 80
            GKW++  FMG E
Sbjct: 130 DGKWDRKKFMGSE 142


>gi|125556326|gb|EAZ01932.1| hypothetical protein OsI_23958 [Oryza sativa Indica Group]
          Length = 613

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNVAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|326490081|dbj|BAJ94114.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504998|dbj|BAK02886.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAMARNVAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KSGKWQRSKYVGV 206


>gi|125598081|gb|EAZ37861.1| hypothetical protein OsJ_22207 [Oryza sativa Japonica Group]
          Length = 613

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNVAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|242096578|ref|XP_002438779.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
 gi|241917002|gb|EER90146.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
          Length = 613

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGVDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAMARNVAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRSKYVGV 206


>gi|55792494|gb|AAV65345.1| plastid phosphoglycerate dehydrogenase [Prototheca wickerhamii]
          Length = 231

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  AS +G +V+N P  N+I  AEH ISL+ A+AR +  A+ S 
Sbjct: 121 RLRVVGRAGVGIDNVDLTAASESGCLVVNAPTANTIAAAEHGISLLTALARNVAQADASM 180

Query: 67  HKGKWEKFNFMGVE 80
             G W++  ++GV 
Sbjct: 181 KAGGWDRTTYVGVS 194


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ RAG+G DN+D+  A++ GIVV+N P GN+I+TAEH  +++ ++ R+IP
Sbjct: 71  LMEKMSSLKIIARAGVGVDNIDIDAATKHGIVVVNAPDGNTISTAEHTFAMICSLLRKIP 130

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W++  F G E
Sbjct: 131 QANASIKAGEWKRKAFQGTE 150


>gi|115469298|ref|NP_001058248.1| Os06g0655100 [Oryza sativa Japonica Group]
 gi|113596288|dbj|BAF20162.1| Os06g0655100 [Oryza sativa Japonica Group]
          Length = 629

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNVAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 63  VASAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQ 122

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+++   G+W++  + GVE
Sbjct: 123 ASQALKGGEWKRSKYTGVE 141


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D   A+R GIVVMNTP GN+ +TAE  I+LM+A+AR I 
Sbjct: 59  VLKGQPRLKAIVRAGVGVDNIDRAAATREGIVVMNTPAGNTTSTAEQTIALMMALARNIG 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +  +GKWE+    G +
Sbjct: 119 PAYATMKEGKWERKKLTGTQ 138


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K +GRAG+G DN+D+  A+R GIVV+N P GN+I  AE  ++ +LAIAR + 
Sbjct: 58  IIEAADRLKAIGRAGVGVDNIDVEAATRKGIVVVNAPEGNTIAAAELTVAHILAIARNVG 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   GKW++  + G+E
Sbjct: 118 SANLSLKGGKWDRSKYTGIE 137


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS+AK +K++GRAG+G DN+++  A++ GIVV+N+P GN I+ AEH   L++++ R IP
Sbjct: 59  ILSNAKNLKIIGRAGVGVDNINVEAATKYGIVVVNSPEGNIISAAEHTFGLIISLLRNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W++  F G E
Sbjct: 119 QADRSVRNLEWKRNKFTGHE 138


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+V RAG+G DN+DL  A++ G+VV+N P GN+I+TAEH  +++ ++ R+IP
Sbjct: 72  LLQKMPNLKIVARAGVGVDNIDLDAATKHGVVVVNAPDGNTISTAEHTFAMISSLLRKIP 131

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G+W +  F G E
Sbjct: 132 QANASIKAGEWNRKAFQGSE 151


>gi|302503639|ref|XP_003013779.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
 gi|291177345|gb|EFE33139.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
          Length = 575

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (66%), Gaps = 4/84 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNV----DLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           +L  A K+KVV RAG+G DN+    D+  A++ GIVV+N+P GN++  AEH I+L++ +A
Sbjct: 68  VLQAASKLKVVARAGVGVDNIVTPEDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMA 127

Query: 57  RQIPVANESTHKGKWEKFNFMGVE 80
           R IP A  S    +WE+   +GVE
Sbjct: 128 RNIPDACSSLKSNQWERSRLVGVE 151


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  VIQAASQLKVIARAGVGVDNIDIDAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G+E
Sbjct: 120 QAHQSLRNKEWNRKAFRGIE 139


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN I+  EH+I+++LA+AR IP
Sbjct: 60  IINSASRLKVIARAGVGVDNIDIEAATLKGILVINAPDGNIISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F GVE
Sbjct: 120 QAHQSLRNKEWNRKAFRGVE 139


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 63  VAAAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQ 122

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+++   G+W++  + GVE
Sbjct: 123 ASQALKGGEWKRSKYTGVE 141


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 56  VAAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 115

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 116 ANTALKNGEWKRSKYTGVE 134


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A++ GI+V+NTP GN+I  AE  I LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVEAATQRGILVVNTPAGNTIAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAALNGDFRRDRFKGVE 135


>gi|258645797|ref|ZP_05733266.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
 gi|260403167|gb|EEW96714.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
          Length = 530

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 54/76 (71%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KV+GRAG+G D +D+  A+  GI V+NTP  N+I   EH ++LML+I R IP A++
Sbjct: 61  ATNLKVIGRAGVGIDGIDIPEATAKGITVVNTPESNTIAACEHTLALMLSITRYIPQAHQ 120

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++ +F G++
Sbjct: 121 SIMEGRWDRKSFTGIQ 136


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 63  VAAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 122

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 123 ANTALKNGEWKRSKYTGVE 141


>gi|295657214|ref|XP_002789178.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
 gi|226284495|gb|EEH40061.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
          Length = 608

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
               +   GKWE+   +G+E
Sbjct: 126 EGCSTLKAGKWERSRLVGIE 145


>gi|116789697|gb|ABK25346.1| unknown [Picea sitchensis]
          Length = 622

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +P A+ S 
Sbjct: 143 RLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALIASMARNVPQASASM 202

Query: 67  HKGKWEKFNFMGV 79
             GKW++  F+GV
Sbjct: 203 KAGKWQRNKFVGV 215


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 69  VAAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 128

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 129 ANTALKNGEWKRSKYTGVE 147


>gi|296131563|ref|YP_003638810.1| D-3-phosphoglycerate dehydrogenase [Thermincola sp. JR]
 gi|296030141|gb|ADG80909.1| D-3-phosphoglycerate dehydrogenase [Thermincola potens JR]
          Length = 523

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +K++GRAG+G DN+D+  A+ AGI+V+N P GN+I   E  ++LMLA+AR +P
Sbjct: 58  VIAAGKNLKIIGRAGVGVDNIDIPAATNAGILVVNAPDGNTIAATEQTMALMLALARNLP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++   +G W +  + GVE
Sbjct: 118 QAHKDLKEGLWNRKLYTGVE 137


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 63  VAAAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQ 122

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A ++   G+W++  + GVE
Sbjct: 123 AGQALKAGEWKRSKYTGVE 141


>gi|116202061|ref|XP_001226842.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
 gi|88177433|gb|EAQ84901.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
          Length = 1359

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K++VV RAG+G DN+D+  A++ G++V+N+P GN +  AEH ++L+LA AR + 
Sbjct: 76  VLAAASKLRVVARAGVGVDNIDVEAATQHGVIVVNSPSGNIVAAAEHTVALLLACARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+     G+WE+   +GVE G
Sbjct: 136 RADAGMKGGRWERGKLVGVEVG 157


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAATNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G W++  F G E
Sbjct: 118 KANSSLKGGAWKRAPFTGYE 137


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 116 QAHVSVKSREWNRSAFVGTE 135


>gi|118471239|ref|YP_886720.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
 gi|118172526|gb|ABK73422.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
          Length = 528

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP
Sbjct: 59  VIAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 119 AADATLRERSWKRSSFSGTE 138


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAANRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAATNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G W++  F G E
Sbjct: 118 KANSSLKGGAWKRAPFTGYE 137


>gi|309791398|ref|ZP_07685905.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
 gi|308226531|gb|EFO80252.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
          Length = 525

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++V+GRAG G DN+D+  A+R GIVV+N P  N++  AE  I L+L++AR IP A+ S 
Sbjct: 63  KLRVIGRAGTGVDNIDVEAATRQGIVVVNAPASNNVAVAELTIGLILSMARNIPQAHASL 122

Query: 67  HKGKWEKFNFMGVE 80
             GKWE+  F G E
Sbjct: 123 QGGKWERTKFSGWE 136


>gi|95930938|ref|ZP_01313668.1| hypothetical protein Dace_0698 [Desulfuromonas acetoxidans DSM 684]
 gi|95133064|gb|EAT14733.1| hypothetical protein Dace_0698 [Desulfuromonas acetoxidans DSM 684]
          Length = 147

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++++L+  R + 
Sbjct: 58  LLDCATNLKIVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHTMAILLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +AN S   G+W++  F G E
Sbjct: 118 IANASLKSGEWKRAPFTGHE 137


>gi|168014318|ref|XP_001759699.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689238|gb|EDQ75611.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  ++ S 
Sbjct: 92  KLKVVGRAGVGIDNVDLEAATELGCLVVNAPTANTVAAAEHGIALLTAMARNVAPSDSSM 151

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 152 KSGKWERNKYVGV 164


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINHASNLKVIARAGVGVDNIDIKSATLNGILVVNAPDGNTISATEHSVAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    +W +  F GVE
Sbjct: 120 QAYTSLKNKEWNRKAFKGVE 139


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 116 QAHISVKSREWNRSAFVGTE 135


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 116 QAHISVKSREWNRSAFVGTE 135


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 398 IINHASNLKVIARAGVGVDNIDIKSATLNGILVVNAPDGNTISATEHSVAMILAMARNIP 457

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S    +W +  F GVE
Sbjct: 458 QAYTSLKNKEWNRKAFKGVE 477


>gi|182415332|ref|YP_001820398.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
 gi|177842546|gb|ACB76798.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
          Length = 529

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAG+G DNVD+  A+  G++VMNTP GN+I TAE   + +L  AR +P
Sbjct: 58  VIAAAPLLKVVGRAGVGVDNVDVDAATERGVIVMNTPSGNTIATAELTFTHLLCGARPVP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G W++ +F G+E
Sbjct: 118 QAAASMRAGNWDRKSFSGIE 137


>gi|134102592|ref|YP_001108253.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004723|ref|ZP_06562696.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133915215|emb|CAM05328.1| D-3-phosphoglycerate dehydrogenase (PgdH) [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 531

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR + 
Sbjct: 62  VLAATTRLKVVARAGVGLDNVEVPAATERGVMVVNAPTSNIVSAAEHAVALLLAVARNVA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W++ +F GVE
Sbjct: 122 AADASLRAGEWKRSSFSGVE 141


>gi|255538186|ref|XP_002510158.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223550859|gb|EEF52345.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 598

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KSGKWQRSKYVGV 191


>gi|47218064|emb|CAG09936.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 584

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG G DNVD+  A++ GI+VMNTP GN+I+ AE   +L+++++R +P
Sbjct: 63  VIDAADNLKIIGRAGTGVDNVDVDAATKKGIIVMNTPSGNTISAAELTCALLMSLSRNVP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G W++  FMG E
Sbjct: 123 QAVISMKEGHWDRKKFMGSE 142


>gi|225165807|ref|ZP_03727591.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
 gi|224799953|gb|EEG18398.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
          Length = 529

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG+G DNVD+  A+  G+VVMNTP GN+I TAE   + +L  +R + 
Sbjct: 58  VIAAAPQLKVVGRAGVGVDNVDVEAATERGVVVMNTPAGNTIATAELTFTHILCGSRPVS 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKW++ +F GVE
Sbjct: 118 QAAASMREGKWDRKSFSGVE 137


>gi|296140550|ref|YP_003647793.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
 gi|296028684|gb|ADG79454.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
          Length = 528

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVPAATERGVLVVNAPTSNIHTAAEHAVALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  + +W++  F GVE
Sbjct: 119 AADATLREHEWKRSKFNGVE 138


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D+  A+R GIVVMNTP GN+++TAEH ++L+LA++R I 
Sbjct: 64  VLRGQTRLKAIVRAGVGVDNIDVTTATRQGIVVMNTPGGNTLSTAEHTLALLLALSRNIA 123

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G+W++  + G +
Sbjct: 124 PACASLKAGRWDRSKYTGSQ 143


>gi|308177181|ref|YP_003916587.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744644|emb|CBT75616.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
          Length = 531

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N I+ AE  +  ++++AR+IP 
Sbjct: 62  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIISAAELTVGHIVSLARRIPA 121

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN S   G+W++ +F GVE
Sbjct: 122 ANASLKNGEWKRSSFTGVE 140


>gi|224137644|ref|XP_002327177.1| predicted protein [Populus trichocarpa]
 gi|222835492|gb|EEE73927.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 118 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASI 177

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 178 KSGKWQRSKYVGV 190


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DN+DL  A+  G++V+N P GN+ + AEH +++++A++R IP
Sbjct: 60  LIEKASNLKIIGRAGVGVDNIDLEAATENGVIVVNAPNGNTNSAAEHTMAMIMALSRNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +  + +W++  F+GVE
Sbjct: 120 QAYHALKQKQWDRKRFVGVE 139


>gi|284045014|ref|YP_003395354.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
 gi|283949235|gb|ADB51979.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
          Length = 541

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++V+GRAG+G +NVD+  A+R GIVV N P  N +T AEH ++L+L++AR +P A+ S  
Sbjct: 70  LRVIGRAGVGVNNVDVPAATRRGIVVANAPQSNVVTAAEHTMALLLSLARNVPQAHRSLT 129

Query: 68  KGKWEKFNFMGVE 80
             +WE+  F GVE
Sbjct: 130 DHRWERSKFGGVE 142


>gi|224105607|ref|XP_002313870.1| predicted protein [Populus trichocarpa]
 gi|222850278|gb|EEE87825.1| predicted protein [Populus trichocarpa]
          Length = 543

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 52/77 (67%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S   ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +  A
Sbjct: 60  SSGGRLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTIAAAEHGIALLAAMARNVAQA 119

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKW++  ++GV
Sbjct: 120 DASVKAGKWQRNKYVGV 136


>gi|311030775|ref|ZP_07708865.1| D-3-phosphoglycerate dehydrogenase [Bacillus sp. m3-13]
          Length = 524

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    ++VV RAG+G DN+D+  A++ G+VV+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LLSSLSNLQVVARAGVGVDNIDITAATKRGVVVINAPDGNTISTAEHTFAMISSLVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN +    +W +  F+G E
Sbjct: 116 QANMNVKGAQWSRKKFIGTE 135


>gi|226305887|ref|YP_002765847.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229493419|ref|ZP_04387208.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
 gi|226185004|dbj|BAH33108.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229319735|gb|EEN85567.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
          Length = 530

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K++GRAG+G DNV++  A+  G++V+N P  N  + AEHA++L+++ ARQIP
Sbjct: 62  VLAAGTKLKIIGRAGVGLDNVEIPAATERGVMVVNAPTSNIHSAAEHAVALLMSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++  +  W++  F GVE
Sbjct: 122 AADKTLRENTWKRSKFNGVE 141


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R + 
Sbjct: 58  LLDAAHNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S   G W++  F G E
Sbjct: 118 KANSSLKGGAWKRAPFTGYE 137


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K++VVGRAG G DN+DL  A++ GI+V+N P  NSI  AE  I LM+ +AR IP
Sbjct: 57  VLAAGTKLRVVGRAGTGVDNIDLAAANQQGILVVNAPASNSIAVAELTIGLMIGLARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   GKWE+  + G E
Sbjct: 117 QAHTALQNGKWERSKYGGWE 136


>gi|167036576|ref|YP_001664154.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115004|ref|YP_004185163.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855410|gb|ABY93818.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928095|gb|ADV78780.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 531

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KVVGRAG G DN+D+  A+  GI+V+NTP GN++  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVVGRAGNGVDNIDVTAATEKGILVVNTPAGNTVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  VAAAGRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +   G+W++  + GVE
Sbjct: 121 ANAALKNGEWKRSKYTGVE 139


>gi|226289513|gb|EEH45017.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb18]
          Length = 598

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
                   GKWE+   +GVE
Sbjct: 126 EGCSILKAGKWERSRLVGVE 145


>gi|224063477|ref|XP_002301163.1| predicted protein [Populus trichocarpa]
 gi|222842889|gb|EEE80436.1| predicted protein [Populus trichocarpa]
          Length = 598

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KAGKWQRSKYVGV 191


>gi|297844730|ref|XP_002890246.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gi|297336088|gb|EFH66505.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
          Length = 613

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +MKVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+  +AR +  A+ S 
Sbjct: 145 RMKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLACMARNVAQADASI 204

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 205 KAGKWERSKYVGV 217


>gi|225680421|gb|EEH18705.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb03]
          Length = 518

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
                   GKWE+   +GVE
Sbjct: 126 EGCSILKAGKWERSRLVGVE 145


>gi|225428898|ref|XP_002285358.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 595

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A+ S 
Sbjct: 116 RLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNVAQADASV 175

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 176 KSGKWQRNKYVGV 188


>gi|156047579|ref|XP_001589794.1| hypothetical protein SS1G_09516 [Sclerotinia sclerotiorum 1980]
 gi|154693911|gb|EDN93649.1| hypothetical protein SS1G_09516 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 190

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 53/82 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  K +KVV RAG+G DN+D+  A+   I+V+N+P GN    AEH I+L++A+AR +P
Sbjct: 74  ILAAGKNLKVVARAGVGVDNIDVESATTHAIIVVNSPSGNIAAAAEHTIALLMAVARNVP 133

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G WE+   +G E G
Sbjct: 134 AGDRSLRGGGWERGKLVGTEVG 155


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IIEAASNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   G+W +  F G E
Sbjct: 120 QAHQSLKAGEWNRKAFRGTE 139


>gi|289610696|emb|CBI60195.1| unnamed protein product [Sordaria macrospora]
          Length = 97

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 42/49 (85%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAI 49
          +L  AK +KVVGRAGIG DNVD+  AS AG+VVMNTPFGNSITTAEHAI
Sbjct: 49 ILDAAKNLKVVGRAGIGVDNVDIPAASAAGVVVMNTPFGNSITTAEHAI 97


>gi|324513534|gb|ADY45559.1| D-3-phosphoglycerate dehydrogenase [Ascaris suum]
          Length = 504

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 49/74 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++GRAG G DN+DL  A+  GI+VMNTP GNS + AE     +L++AR +P A  S 
Sbjct: 68  KLKLIGRAGTGIDNIDLAAATEYGIIVMNTPAGNSRSAAELTCVCILSLARHLPQAVASM 127

Query: 67  HKGKWEKFNFMGVE 80
             GKW +  +MG E
Sbjct: 128 KAGKWARKEYMGEE 141


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus
          thermodenitrificans NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus
          thermodenitrificans NG80-2]
          Length = 465

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 52/75 (69%)

Query: 6  KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
          K +K+VGRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP A+ S
Sbjct: 2  KNLKIVGRAGVGVDNIDIDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIPQAHIS 61

Query: 66 THKGKWEKFNFMGVE 80
              +W +  F+G E
Sbjct: 62 VKSREWNRSAFVGKE 76


>gi|167998190|ref|XP_001751801.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696899|gb|EDQ83236.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 630

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR    A+ S 
Sbjct: 147 RLKVVGRAGVGIDNVDLDAATELGCLVVNAPTANTVAAAEHGIALLTAMARNAAPADASM 206

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 207 KSGKWERSKYVGV 219


>gi|262203115|ref|YP_003274323.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
 gi|262086462|gb|ACY22430.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
          Length = 531

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K++ RAG+G DNVD+  A+  G++V+N P  N  T AEHAI+L+++ ARQIP
Sbjct: 62  VLDAGKKLKIIARAGVGLDNVDVPAATARGVMVVNAPTSNIHTAAEHAIALLMSAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +     W++  F GVE
Sbjct: 122 AADATLRAHTWKRSAFNGVE 141


>gi|240991833|ref|XP_002404432.1| D-3-phosphoglycerate dehydrogenase, putative [Ixodes scapularis]
 gi|215491559|gb|EEC01200.1| D-3-phosphoglycerate dehydrogenase, putative [Ixodes scapularis]
          Length = 473

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           + +KV+GRAG G DN+D   A+R GI+V+N P GN+++ AE   ++++ ++R+IP A  S
Sbjct: 67  QALKVIGRAGTGVDNIDCDAATRQGILVINAPGGNTLSAAELTCAMIVTLSREIPAATMS 126

Query: 66  THKGKWEKFNFMGVE 80
              GKW++  FMG E
Sbjct: 127 LKAGKWDRKTFMGNE 141


>gi|326505978|dbj|BAJ91228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326514850|dbj|BAJ99786.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 617

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+LM A+AR +  A+ S 
Sbjct: 138 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALMCAMARNVAQADASL 197

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 198 KAGKWARTKYVGV 210


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
            HA  +KVVGRAG G DN+D+  A+  GI+V+NTP  N+++ AEH I L++A  R +  A
Sbjct: 59  QHATNLKVVGRAGNGVDNIDMDGATNRGIIVVNTPEANTVSAAEHTIGLLIASTRNVAQA 118

Query: 63  NESTHKGKWEKFNFMGVE 80
           N      +W++ NF GVE
Sbjct: 119 NAKIKNREWDRSNFKGVE 136


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH +++++++AR+IP
Sbjct: 60  LIEKASNLKIIGRAGVGVDNIDLEAATEHGIIVVNAPDGNTNSAAEHTMAMIMSMARKIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +    +W++ +++GVE
Sbjct: 120 QAFHALRNQQWDRKSYVGVE 139


>gi|291301774|ref|YP_003513052.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570994|gb|ADD43959.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 533

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 53/74 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++VV RAG+G DNVD+ VA+  G++V+N P  N ++ AE A++L+LA AR   +A+ S 
Sbjct: 68  KLQVVARAGVGLDNVDINVATERGVMVVNAPTSNIVSAAEQAVALLLATARNTTIADASL 127

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  F GVE
Sbjct: 128 KRGEWKRSQFTGVE 141


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VIEKASNLKVIARAGVGVDNIDIDAATLQGILVINAPDGNTISATEHSVAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F GVE
Sbjct: 120 QAHASLKNKEWNRKAFKGVE 139


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           LS  + +KV+GRAG+G DN+DL  AS+ GIVV+N P GN++   EH ++ ML   R +P 
Sbjct: 60  LSFCENLKVIGRAGVGVDNIDLDEASKRGIVVLNMPTGNTLAATEHTMTHMLNCLRFMPN 119

Query: 62  AN-ESTHKGKWEKFNFMGVE 80
           AN E  +K KW++  +MG+E
Sbjct: 120 ANYELKYKHKWDRKKWMGIE 139


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F GVE
Sbjct: 120 QAHQSLRNKEWNRKAFRGVE 139


>gi|18394525|ref|NP_564034.1| PGDH (3-PHOSPHOGLYCERATE DEHYDROGENASE); phosphoglycerate
           dehydrogenase [Arabidopsis thaliana]
 gi|3122858|sp|O04130|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic;
           Short=3-PGDH; Flags: Precursor
 gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 624

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +  A+ S 
Sbjct: 145 RLKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASI 204

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 205 KAGKWERSKYVGV 217


>gi|297830606|ref|XP_002883185.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329025|gb|EFH59444.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 585

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 106 RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 165

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 166 KAGKWTRNKYVGV 178


>gi|211906486|gb|ACJ11736.1| phosphoglycerate dehydrogenase [Gossypium hirsutum]
          Length = 602

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (67%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S   ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A
Sbjct: 119 SSGGRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTVAAAEHGIALLAAMARNVAQA 178

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKW++  ++GV
Sbjct: 179 DASVKAGKWQRNKYVGV 195


>gi|14596141|gb|AAK68798.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 516

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 37  RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 96

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 97  KAGKWTRNKYVGV 109


>gi|169630385|ref|YP_001704034.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium abscessus ATCC
           19977]
 gi|169242352|emb|CAM63380.1| D-3-phosphoglycerate dehydrogenase (SerA) [Mycobacterium abscessus]
          Length = 523

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 54  VLAAGTKLKIVARAGVGLDNVDVKAATARGVLVVNAPTSNIHSAAEHAVTLLLATARQIP 113

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S     W++ +F G E
Sbjct: 114 AADASLKAHTWKRSSFNGTE 133


>gi|225443272|ref|XP_002273552.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 624

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +  A+ S 
Sbjct: 145 RLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNVAQADASM 204

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 205 KAGKWQRNKYVGV 217


>gi|224034059|gb|ACN36105.1| unknown [Zea mays]
          Length = 612

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 133 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 192

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 193 KAGKWQRNKYVGV 205


>gi|260889453|ref|ZP_05900716.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
 gi|260860864|gb|EEX75364.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
          Length = 530

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG GTDN+++  A+  G++V NTP  N+++  E AI LMLA AR I 
Sbjct: 59  LLDKAKNLKIVGRAGNGTDNINIPEATAHGVIVANTPDSNTVSACEIAIGLMLASARNIV 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     GKWE+  F+G E
Sbjct: 119 AANNFIKSGKWEREIFVGSE 138


>gi|308081353|ref|NP_001183055.1| hypothetical protein LOC100501398 [Zea mays]
 gi|238009062|gb|ACR35566.1| unknown [Zea mays]
          Length = 598

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KAGKWQRNKYVGV 191


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F GVE
Sbjct: 120 QAHQSLRNKEWNRKAFRGVE 139


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F GVE
Sbjct: 120 QAHQSLRNKEWNRKAFRGVE 139


>gi|255555301|ref|XP_002518687.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223542068|gb|EEF43612.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 596

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (67%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           S   ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A
Sbjct: 113 SSGGRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTVAAAEHGIALLAAMARNVAQA 172

Query: 63  NESTHKGKWEKFNFMGV 79
           + S   GKW++  ++GV
Sbjct: 173 DASVKAGKWQRNKYVGV 189


>gi|94442940|emb|CAJ91152.1| D-3-phosphoglycerate dehydrogenase [Platanus x acerifolia]
          Length = 223

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +  A+ S 
Sbjct: 145 RLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASI 204

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 205 KAGKWQRNKYVGV 217


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F GVE
Sbjct: 120 QAHQSLRNKEWNRKAFRGVE 139


>gi|42565022|ref|NP_566637.2| D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative
           [Arabidopsis thaliana]
 gi|11994471|dbj|BAB02473.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 588

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 109 RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 168

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 169 KAGKWTRNKYVGV 181


>gi|168002445|ref|XP_001753924.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694900|gb|EDQ81246.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 523

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH ISL+ A+AR +  A+ S 
Sbjct: 44  RLKVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGISLLTAMARNVAQASASM 103

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 104 KAGKWQRNKWVGV 116


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +MLA AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW++ +F G+E
Sbjct: 117 QATASIKSGKWDRKSFKGME 136


>gi|196248715|ref|ZP_03147415.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic region
           [Geobacillus sp. G11MC16]
 gi|196211591|gb|EDY06350.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic region
           [Geobacillus sp. G11MC16]
          Length = 223

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLEKMTNLKIVGRAGVGVDNIDIDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 116 QAHISVKSREWNRSAFVGKE 135


>gi|217070860|gb|ACJ83790.1| unknown [Medicago truncatula]
          Length = 229

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +  A+ S 
Sbjct: 151 KLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNVSQADASL 210

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 211 KAGKWLRSKYVGV 223


>gi|15235282|ref|NP_195146.1| EDA9 (embryo sac development arrest 9); ATP binding [Arabidopsis
           thaliana]
 gi|2911042|emb|CAA17552.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|7270370|emb|CAB80137.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|17380672|gb|AAL36166.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|23297595|gb|AAN12903.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 603

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|21536501|gb|AAM60833.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
          Length = 603

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|239618528|ref|YP_002941850.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507359|gb|ACR80846.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
          Length = 307

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K+KVVGRAG+G DNVD+  A   GI V NTP  N+I+ AE  I L++A+ RQIP
Sbjct: 58  ILKAGTKLKVVGRAGVGLDNVDVSTAKELGIRVYNTPGANAISAAELTIGLLIALMRQIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
                  +GKWEK    G E
Sbjct: 118 RGTNGLKEGKWEKKKLKGHE 137


>gi|319948224|ref|ZP_08022380.1| D-3-phosphoglycerate dehydrogenase [Dietzia cinnamea P4]
 gi|319438099|gb|EFV93063.1| D-3-phosphoglycerate dehydrogenase [Dietzia cinnamea P4]
          Length = 530

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K++GRAG+G DNV++  A+  G++V+N P  N  + AEHA++L++A  RQIP
Sbjct: 62  VLAAAPNLKIIGRAGVGLDNVEIPAATERGVMVVNAPTSNIHSAAEHAVALLMAACRQIP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F GVE
Sbjct: 122 AADRTLREHTWKRSSFNGVE 141


>gi|297798490|ref|XP_002867129.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312965|gb|EFH43388.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 603

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|290967984|ref|ZP_06559533.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781890|gb|EFD94469.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
          Length = 530

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 53/76 (69%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K+KV+GRAG+G D++D+  A++ GI+V+N P  N++   EH  ++++AI R IP A+ 
Sbjct: 61  AGKLKVIGRAGVGVDSIDIKTATQRGIIVVNAPTANTVAATEHTCAMIMAITRHIPQAHN 120

Query: 65  STHKGKWEKFNFMGVE 80
           S   G+W++  F G++
Sbjct: 121 SLMAGEWQRERFTGIQ 136


>gi|307265064|ref|ZP_07546624.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919862|gb|EFN50076.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 533

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN++  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNTVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+KV+GRAG G DN+DL  A++ GI+V+NTP  N I+ AEH I L+LA  R   
Sbjct: 61  LYDAAKKLKVIGRAGNGVDNIDLDGATKRGIIVVNTPEANIISAAEHTIGLLLASCRNTV 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN+   +G WE+ +  G E
Sbjct: 121 RANKMLEEGIWERKDLKGSE 140


>gi|326501108|dbj|BAJ98785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504920|dbj|BAK06751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 616

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+  +AR +  A+ + 
Sbjct: 136 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLACMARNVSQADAAL 195

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 196 KAGKWQRTKYVGV 208


>gi|217074366|gb|ACJ85543.1| unknown [Medicago truncatula]
          Length = 473

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +  A+ S 
Sbjct: 151 KLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNVSQADASL 210

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 211 KAGKWLRSKYVGV 223


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  G+VV+N P  +SI+ AE    LML+ AR IP
Sbjct: 57  IIDASENLKVIARAGVGVDNVDLDAATEKGVVVVNAPDASSISVAELMFGLMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  KG+W++ +F G+E
Sbjct: 117 QATASLKKGEWDRKSFKGME 136


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R+IP
Sbjct: 56  LLEKMPNLKIIGRAGVGVDNIDVDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 116 QAHISVKSREWNRSAFVGNE 135


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAG+G DNVD+  A++AG++V+N P  N  + AEH ++++LA AR IP
Sbjct: 59  VIAAAPKLRVIARAGVGLDNVDVEAATKAGVMVVNAPTSNITSAAEHTVAMILASARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +   G+W++  + GVE
Sbjct: 119 QAHAALKGGEWKRSKYTGVE 138


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R+IP
Sbjct: 42  LLEKMPNLKIIGRAGVGVDNIDVDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRRIP 101

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S    +W +  F+G E
Sbjct: 102 QAHISVKSREWNRSAFVGNE 121


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  KG+W++ +F G+E
Sbjct: 117 QATASIKKGEWDRKSFKGME 136


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  ++++V+GRAG G DN+D+  A+R GI+V+N P  N++  AE  I L+L +AR+IP
Sbjct: 57  VITAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAELTIGLLLCLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W + +F+G E
Sbjct: 117 QAHASVQSGRWARNDFIGWE 136


>gi|302837628|ref|XP_002950373.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
 gi|300264378|gb|EFJ48574.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
          Length = 539

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 52/72 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G D+VDL  A+  G +V+N P  N++  AEH I+L+ A+AR IP A+ + 
Sbjct: 56  RLKVVGRAGVGVDHVDLTAATEYGCLVVNAPTANTLAAAEHGIALLCAMARNIPQADAAM 115

Query: 67  HKGKWEKFNFMG 78
             G+W++ +F+G
Sbjct: 116 KSGRWDRSSFLG 127


>gi|42408279|dbj|BAD09434.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|42409460|dbj|BAD09817.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|215769351|dbj|BAH01580.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 621

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ ++AR +  A+ + 
Sbjct: 140 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLASMARNVSQADAAL 199

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 200 KAGKWQRTKYVGV 212


>gi|313896802|ref|ZP_07830350.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974719|gb|EFR40186.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 161

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 53/69 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 56  VIARAENLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSMARNIP 115

Query: 61  VANESTHKG 69
            A+E+  +G
Sbjct: 116 AADETMQRG 124


>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa]
 gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa]
          Length = 637

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A+ S 
Sbjct: 158 KLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLAAMARNVAQADASM 217

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 218 KAGQWQRNKYVGV 230


>gi|125561721|gb|EAZ07169.1| hypothetical protein OsI_29415 [Oryza sativa Indica Group]
          Length = 621

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ ++AR +  A+ + 
Sbjct: 140 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLASMARNVSQADAAL 199

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 200 KAGKWQRTKYVGV 212


>gi|242074584|ref|XP_002447228.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
 gi|241938411|gb|EES11556.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
          Length = 620

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 141 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 200

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 201 KAGQWQRNKYVGV 213


>gi|326390875|ref|ZP_08212427.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993134|gb|EGD51574.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 533

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVTAATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGIDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  KG+W++ +F G+E
Sbjct: 117 QATASIKKGEWDRKSFKGME 136


>gi|298704813|emb|CBJ48961.1| Phosphoglycerate dehydrogenase, incomplete [Ectocarpus siliculosus]
          Length = 304

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML  + ++ +VGRAG G DN+DL  AS  G+ V+N P GNS + AE  + LML ++R I 
Sbjct: 48  MLVASPRVAIVGRAGSGVDNIDLKAASELGVPVVNAPTGNSGSVAELVMGLMLGVSRSIS 107

Query: 61  VANESTHKGKWEKFNFMG 78
            A ++T +G+W K NF G
Sbjct: 108 SARDTTRRGEWAKSNFTG 125


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K+V RAG+G DN+D+  +++ G+VV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLAKMPNLKIVARAGVGVDNIDIEASTKRGVVVINAPNGNTISTAEHTFAMMASLFRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
             N S    +W +  F+G E
Sbjct: 116 QGNASVKAREWNRSAFVGTE 135


>gi|90399366|emb|CAH68268.1| H0212B02.14 [Oryza sativa Indica Group]
 gi|116311962|emb|CAJ86321.1| OSIGBa0113E10.4 [Oryza sativa Indica Group]
          Length = 613

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|115460988|ref|NP_001054094.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|32488924|emb|CAE04505.1| OSJNBb0059K02.15 [Oryza sativa Japonica Group]
 gi|113565665|dbj|BAF16008.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|125550010|gb|EAY95832.1| hypothetical protein OsI_17701 [Oryza sativa Indica Group]
 gi|215768007|dbj|BAH00236.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 613

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K+V RAG+G DN+D+  +++ G+VV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLAKMPNLKIVARAGVGVDNIDIEASTKRGVVVINAPNGNTISTAEHTFAMMASLFRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
             N S    +W +  F+G E
Sbjct: 116 QGNASVKAREWNRSAFVGTE 135


>gi|70989461|ref|XP_749580.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
 gi|66847211|gb|EAL87542.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
          Length = 635

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 24/104 (23%)

Query: 1   MLSHAKKMKVVGRAGIGTDNV------------------------DLVVASRAGIVVMNT 36
           +L  AK++KVV RAG+G DNV                        D+  A++ GIVV+N+
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVGELAQPPLPPSPSLGSWPLTSHRTDVEEATKLGIVVVNS 123

Query: 37  PFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE 80
           P GN    AEH I+L++A+AR IP A  S   GKWE+  F+GVE
Sbjct: 124 PSGNIGAAAEHTIALLMAMARNIPEACSSLKSGKWERSKFVGVE 167


>gi|222629679|gb|EEE61811.1| hypothetical protein OsJ_16432 [Oryza sativa Japonica Group]
          Length = 544

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 65  RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 124

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 125 KAGKWQRNKYVGV 137


>gi|315425645|dbj|BAJ47304.1| D-3-phosphoglycerate dehydrogenase [Candidatus Caldiarchaeum
           subterraneum]
          Length = 310

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 50/73 (68%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG+G DNVDL  A+R G+ V+NTP  ++ + AE  I LM+A+AR+I   ++   
Sbjct: 67  LKVVGRAGVGLDNVDLEAAARHGVKVLNTPESSTESVAELVIGLMIAVARKIAWCDKQVR 126

Query: 68  KGKWEKFNFMGVE 80
            GKW K   MGVE
Sbjct: 127 SGKWPKSEAMGVE 139


>gi|168028593|ref|XP_001766812.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682021|gb|EDQ68443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 565

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A+ S 
Sbjct: 87  RLKVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGIALLTAMARNVAQASASM 146

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 147 KAGKWQRNKWVGV 159


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  G+VV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGVVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  KG+W++ +F G+E
Sbjct: 117 QATASIKKGEWDRKSFKGME 136


>gi|17532191|ref|NP_496868.1| hypothetical protein C31C9.2 [Caenorhabditis elegans]
 gi|3874647|emb|CAB05694.1| C. elegans protein C31C9.2, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 322

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A K+K+VGRAG G DN+D+  AS   I+VMNTP  NS + AE   +L+L+++R +P
Sbjct: 63  LAASAGKLKLVGRAGTGVDNIDVPAASANKILVMNTPQANSRSAAELTCTLILSLSRHVP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW + +FMG E
Sbjct: 123 QAAASMKAGKWARKDFMGEE 142


>gi|297832018|ref|XP_002883891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329731|gb|EFH60150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 602

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+ R +  A+ S 
Sbjct: 123 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMVRNVSQADASV 182

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 183 KSGEWKRNKYVGV 195


>gi|257125820|ref|YP_003163934.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
 gi|257049759|gb|ACV38943.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
          Length = 530

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG GTDN+++  A+  G++V NTP  N+++  E AI LM+A +R I 
Sbjct: 59  LLDKAKNLKIVGRAGNGTDNINIPEATAHGVIVANTPDSNTVSACEIAIGLMIATSRNIV 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     GKWE+  F+G E
Sbjct: 119 AANNFIRSGKWEREIFVGNE 138


>gi|289579412|ref|YP_003478039.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
 gi|289529125|gb|ADD03477.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
          Length = 533

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  + LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNIVAAAELTVGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|297545554|ref|YP_003677856.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843329|gb|ADH61845.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 533

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  + LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNIVAAAELTVGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  F+G E
Sbjct: 123 SREWNRTAFVGAE 135


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  F+G E
Sbjct: 123 SREWNRTAFVGAE 135


>gi|114565585|ref|YP_752739.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336520|gb|ABI67368.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 530

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++K+VGRAG G DN+D+ V +R G++V NTP  N+I+ AE  ISL+L+  R   
Sbjct: 59  LIRRAKRLKIVGRAGNGIDNIDVDVCTRYGVIVANTPDSNTISAAEQTISLLLSSIRNTA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+E    G W++  F GVE
Sbjct: 119 WASEYLKGGTWDRKPFRGVE 138


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  F+G E
Sbjct: 123 SREWNRTAFVGAE 135


>gi|240849475|ref|NP_001155671.1| D-3-phosphoglycerate dehydrogenase [Acyrthosiphon pisum]
 gi|239799336|dbj|BAH70594.1| ACYPI006664 [Acyrthosiphon pisum]
          Length = 335

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KV+GRAG G DN+DL  A+ AGI+V+NTP GNS +  E   SL+L++AR +P   +S  
Sbjct: 76  LKVIGRAGTGVDNIDLDSATNAGILVLNTPGGNSNSACELTCSLILSLARNVPQGCQSLK 135

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  +MG E
Sbjct: 136 EGRWDRKLYMGTE 148


>gi|332018401|gb|EGI58995.1| D-3-phosphoglycerate dehydrogenase [Acromyrmex echinatior]
          Length = 511

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++VVGRAG G DN+DL  A+R G+VV+NTP GNSI+  E   +L+ A+AR +  A +S  
Sbjct: 69  LRVVGRAGTGVDNIDLQAATRKGVVVLNTPGGNSISACELTCALISALARNVAQAAQSLK 128

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 129 EGRWDRKLYSGYE 141


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  ++++V+GRAG G DN+D+  A+R GI+V+N P  N++  AE  I L++++AR+IP
Sbjct: 57  VIAAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAELTIGLLISLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W + +F+G E
Sbjct: 117 QAHASLQSGRWARNDFVGWE 136


>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa]
 gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +  A+ S 
Sbjct: 154 KLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASM 213

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 214 KAGQWQRNKYVGV 226


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++++ RAG+G DN+D+  A++ GIVV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLDKMPRLQIIARAGVGVDNIDVAEATKRGIVVVNAPDGNTISTAEHTFAMMASLMRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +    +W + +F+G E
Sbjct: 116 QAHRTVKNLEWNRNSFIGNE 135


>gi|84498265|ref|ZP_00997062.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
 gi|84381765|gb|EAP97648.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
          Length = 528

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N  + AE A+ L+LA AR I  
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDVPAATQAGVMVVNAPTSNITSAAELAVGLLLATARNIAP 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN++   G W++  + GVE
Sbjct: 120 ANQALKAGAWKRSKYGGVE 138


>gi|256751636|ref|ZP_05492511.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256749445|gb|EEU62474.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 531

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|167040920|ref|YP_001663905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300913871|ref|ZP_07131188.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307725445|ref|YP_003905196.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166855160|gb|ABY93569.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300890556|gb|EFK85701.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307582506|gb|ADN55905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 531

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 116 QAYHAGLNGDFRRDKFKGVE 135


>gi|326381545|ref|ZP_08203239.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326199792|gb|EGD56972.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 531

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +K++ RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+++ ARQ+P
Sbjct: 62  VLDAGKNLKIIARAGVGLDNVDVPSATERGVMVVNAPTSNIHSAAEHAIALLMSTARQVP 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F GVE
Sbjct: 122 AADVTLKEHTWKRSSFSGVE 141


>gi|226529328|ref|NP_001147079.1| LOC100280688 [Zea mays]
 gi|195607108|gb|ACG25384.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 624

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ ++AR +  A+ + 
Sbjct: 143 RLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTIAAAEHGIALLASMARNVSQADAAL 202

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 203 KAGKWQRNKYVGV 215


>gi|51535610|dbj|BAD37553.1| putative D-3 [Oryza sativa Japonica Group]
 gi|51536377|dbj|BAD37570.1| putative D-3 [Oryza sativa Japonica Group]
          Length = 625

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 12/85 (14%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES- 65
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNVAQADASL 193

Query: 66  -----------THKGKWEKFNFMGV 79
                      T+ GKW++  ++GV
Sbjct: 194 KAESCFSLVLCTYSGKWQRNKYVGV 218


>gi|194704786|gb|ACF86477.1| unknown [Zea mays]
          Length = 624

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ ++AR +  A+ + 
Sbjct: 143 RLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTIAAAEHGIALLASMARNVSQADAAL 202

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 203 KAGKWQRNKYVGV 215


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH++++  A AR IP
Sbjct: 57  VLSAAPDLVIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHSVAMAFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+E    G+W K +++G E
Sbjct: 117 QAHERLTGGEWAKGDYLGTE 136


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A+ +KVVGRAG+G DNVD+  ASR GI+V+NTP  N+I   E  +  ML + R   
Sbjct: 59  LLSRAENLKVVGRAGVGVDNVDIEEASRRGILVVNTPGANTIGATELTLCHMLNVLRNAH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++  +G+W++  FMG E
Sbjct: 119 QAHKTLTEGRWDRNKFMGRE 138


>gi|308480441|ref|XP_003102427.1| hypothetical protein CRE_04013 [Caenorhabditis remanei]
 gi|308261159|gb|EFP05112.1| hypothetical protein CRE_04013 [Caenorhabditis remanei]
          Length = 322

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A K+K+VGRAG G DN+D+  A+   I+VMNTP  NS + AE   +L+L+++R +P
Sbjct: 63  LAASAGKLKLVGRAGTGVDNIDVPAATANKILVMNTPQANSRSAAELTCTLILSLSRHVP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW + +FMG E
Sbjct: 123 QAAASMKAGKWARKDFMGEE 142


>gi|18977766|ref|NP_579123.1| phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM 3638]
 gi|18893507|gb|AAL81518.1| phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM 3638]
          Length = 306

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM A+AR+I 
Sbjct: 57  VIENAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +GKW K   MG+E
Sbjct: 117 YADRKMREGKWAKKECMGIE 136


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAG G DN+D+  A++ GI+V NTP  N+I+  E  I L+LA +R I 
Sbjct: 61  LMNMAKKLKVVGRAGNGVDNIDIPEATKRGIIVANTPDSNTISACELTIGLLLAQSRNIA 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +    +G W++ +FMG E
Sbjct: 121 KTDRFLKEGNWDRDSFMGTE 140


>gi|170781815|ref|YP_001710147.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156383|emb|CAQ01531.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 529

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A+ AG++V+N P  N I+ AE AI  +L++AR IP 
Sbjct: 60  IAAAPRLQVVARAGVGLDNVDIKAATTAGVMVVNAPTSNVISAAELAIGHILSLARFIPD 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S  +G W++ +F GVE
Sbjct: 120 ASASLKQGLWKRSSFTGVE 138


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KV+GRAG+G DNVD+  AS+ GI+V NTP  N+I   E  I  M+ I R I 
Sbjct: 56  LLERAKNLKVIGRAGVGVDNVDIETASKKGILVCNTPGANTIGATELTIGHMINIIRTIH 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
             + +    +WE+ +FMG+E
Sbjct: 116 KTHNTIMDYRWERHSFMGIE 135


>gi|268532864|ref|XP_002631560.1| Hypothetical protein CBG20736 [Caenorhabditis briggsae]
 gi|187023013|emb|CAP37692.1| hypothetical protein CBG_20736 [Caenorhabditis briggsae AF16]
          Length = 322

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A K+K+VGRAG G DN+D+  A+   I+VMNTP  NS + AE   +L+L+++R +P
Sbjct: 63  LAASAGKLKLVGRAGTGVDNIDVPAATANKILVMNTPQANSRSAAELTCTLILSLSRHVP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKW + +FMG E
Sbjct: 123 QAAASMKAGKWARKDFMGEE 142


>gi|242081631|ref|XP_002445584.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
 gi|241941934|gb|EES15079.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
          Length = 619

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +  A+ + 
Sbjct: 139 RLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGIALLASMARNVSQADAAL 198

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 199 KAGKWQRNKYVGV 211


>gi|295401440|ref|ZP_06811410.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976490|gb|EFG52098.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 326

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+ AEH  +++ ++ R IP
Sbjct: 56  LLKKMTSLKIVGRAGVGVDNIDVDEATKQGVIVINAPNGNTISVAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN S    +W +  F+G E
Sbjct: 116 QANISVKSKEWNRTAFVGSE 135


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SKEWNRGAYVGAE 135


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SKEWNRGAYVGAE 135


>gi|332159609|ref|YP_004424888.1| phosphoglycerate dehydrogenase [Pyrococcus sp. NA2]
 gi|331035072|gb|AEC52884.1| phosphoglycerate dehydrogenase [Pyrococcus sp. NA2]
          Length = 304

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM A+AR+I 
Sbjct: 57  VIENAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +GKW K   MG+E
Sbjct: 117 FADRKMREGKWAKKEAMGIE 136


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG G DN+D+  A++ GI+V NTP  N+I+  E AI+ MLA AR   
Sbjct: 59  LMEKAPNLKIVGRAGNGVDNIDIEEATKRGIIVANTPDSNTISACEIAIAHMLAGARNFT 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKWE+  FMG E
Sbjct: 119 YADSYLKSGKWERDLFMGSE 138


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + +VGRAGIG DN+D+  A+ AG++V N P GN    +EH +++  A AR IP
Sbjct: 57  VLDAASDLVIVGRAGIGVDNIDIDAATDAGVIVANAPEGNVRAASEHTVAMTFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G+W K  F+G E
Sbjct: 117 QAHTRLKGGEWAKGEFLGTE 136


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (65%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +K VGRAG+G DN+D   A+  G+VVMNTP GN+I TAE   + ML  AR +P A +
Sbjct: 79  APTLKAVGRAGVGVDNIDSEAATDFGVVVMNTPGGNTIATAELTFTHMLCGARPVPQAAQ 138

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 139 SMREGRWDRKIYGGSE 154


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP AN S  
Sbjct: 63  LKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRTAYVGSE 135


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|307196749|gb|EFN78208.1| D-3-phosphoglycerate dehydrogenase [Harpegnathos saltator]
          Length = 512

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    ++V+GRAG G DN+DL  A+R GI+VMNTP GNSI+  E   +L+ A+AR + 
Sbjct: 62  VIAACPNVRVIGRAGTGVDNIDLQAATRKGIIVMNTPGGNSISACELTCALISALARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S  +G+W++  + G E
Sbjct: 122 QAAQSLKEGRWDRKLYSGHE 141


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|307177523|gb|EFN66634.1| D-3-phosphoglycerate dehydrogenase [Camponotus floridanus]
          Length = 511

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+ ++AR +  A +S  
Sbjct: 69  LRVVGRAGTGVDNIDLQAATRKGVIVLNTPGGNSISACELTCALISSLARNVAQAAQSLK 128

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 129 EGRWDRKLYSGYE 141


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|322801282|gb|EFZ21969.1| hypothetical protein SINV_07911 [Solenopsis invicta]
          Length = 557

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+ ++AR +  A +S  
Sbjct: 115 LRVVGRAGTGVDNIDLQAATRKGVIVLNTPGGNSISACELTCALISSLARNVAQAAQSLK 174

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 175 EGRWDRKLYSGYE 187


>gi|57641901|ref|YP_184379.1| D-3-phosphoglycerate dehydrogenase [Thermococcus kodakarensis KOD1]
 gi|57160225|dbj|BAD86155.1| D-3-phosphoglycerate dehydrogenase [Thermococcus kodakarensis KOD1]
          Length = 304

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE AI L+ A+AR+I 
Sbjct: 57  VIEAAPKLKVIGRAGVGLDNIDLKAAEERGIKVVNSPGASSRSVAELAIGLIFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG+E
Sbjct: 117 FADRKMREGVWAKKQCMGIE 136


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|50954968|ref|YP_062256.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951450|gb|AAT89151.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 530

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 53/76 (69%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K++V+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR IP A+ 
Sbjct: 63  APKLRVIARAGVGLDNVDIKTATSAGVMVVNAPTSNIISAAELTVGHILSLARHIPAAHS 122

Query: 65  STHKGKWEKFNFMGVE 80
           +  +G+W++  + GVE
Sbjct: 123 ALAQGQWKRSKYTGVE 138


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K++VV RAG+G DNVD+  A++AG++V+N P  N  + AEH ++L+LA AR +  
Sbjct: 60  VAAAPKLRVVARAGVGLDNVDVEAATKAGVMVVNAPTSNITSAAEHTVALILASARNVAQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 120 AHSALKGGEWKRSKYTGVE 138


>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R +  A+ S 
Sbjct: 154 RLKVVGRAGVGIDNVDLGAATEFGCLVVNAPTANTVAAAEHGIALLAAMSRNVAQADASM 213

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 214 KAGEWQRNKYVGV 226


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KVVGRAG+G DNVD+  A+R GI+V+NTP  N+I   E  +  ML I R   
Sbjct: 59  LLDRAQRLKVVGRAGVGVDNVDIEEATRRGILVVNTPGANTIGATELTMMHMLTILRNGH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ES  + +W++  FMG E
Sbjct: 119 RAHESILEHRWDRKKFMGTE 138


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|226498082|ref|NP_001147127.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195607486|gb|ACG25573.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 612

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+A  I  A+ S 
Sbjct: 133 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMAWNIAQADASL 192

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 193 KAGKWQRNKYVGV 205


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + G+E
Sbjct: 120 ASAALKDGEWKRSKYTGIE 138


>gi|163839793|ref|YP_001624198.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953269|gb|ABY22784.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 530

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KV+ RAG G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP A+ 
Sbjct: 64  AKKLKVIARAGFGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPAASA 123

Query: 65  STHKGKWEKFNFMGVE 80
           +   G+W++  + G E
Sbjct: 124 ALKAGEWKRSKYTGTE 139


>gi|149174372|ref|ZP_01852999.1| phosphoglycerate dehydrogenase (serA) [Planctomyces maris DSM 8797]
 gi|148846917|gb|EDL61253.1| phosphoglycerate dehydrogenase (serA) [Planctomyces maris DSM 8797]
          Length = 316

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG G DNVD   A   GIVV  TP  NS++ AE  I LMLA+ R+IP
Sbjct: 59  LIDAAPELKIIARAGAGLDNVDTEYAHEKGIVVCFTPDANSLSVAELTIGLMLALMRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A + T  G W +  F G E
Sbjct: 119 EARQDTLTGGWNRLKFTGTE 138


>gi|323359647|ref|YP_004226043.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
 gi|323276018|dbj|BAJ76163.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
          Length = 534

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A  +KVV RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR+IP 
Sbjct: 60  LAAAPSLKVVARAGVGLDNVDIKSATAAGVMVVNAPTSNIISAAELTVGHVLSLARRIPA 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S  +G W++ +F G E
Sbjct: 120 AHASLAQGLWKRSSFTGTE 138


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A++AG++V+N P  N I+ AE AI+L+LA AR    
Sbjct: 60  IAAASRLQVVARAGVGLDNVDVEAATKAGVLVVNAPTSNIISAAEQAINLLLASARNTAP 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 120 AHNALVNGEWKRSKYTGVE 138


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S    +W +  F G E
Sbjct: 121 QAHQSLTNKEWNRNAFKGTE 140


>gi|325261762|ref|ZP_08128500.1| D-3-phosphoglycerate dehydrogenase [Clostridium sp. D5]
 gi|324033216|gb|EGB94493.1| D-3-phosphoglycerate dehydrogenase [Clostridium sp. D5]
          Length = 316

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 46/72 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +MKV+ R G+G DN DL  A R GIVV N P  NS   AE  ++LMLA+ R++P  N+
Sbjct: 67  APRMKVLARFGVGVDNFDLEAAKRHGIVVCNCPGINSTAVAEQTVALMLALLRRVPELNK 126

Query: 65  STHKGKWEKFNF 76
           S  KG+W +  F
Sbjct: 127 SVRKGEWTRPMF 138


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + G+E
Sbjct: 120 ASAALKDGEWKRSKYTGIE 138


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+VGRAG G DN+D+  A+  G++V NTP  N+++  E AI+L+LA AR I 
Sbjct: 59  LLDKGKKLKIVGRAGNGIDNIDVKEATNHGVIVANTPDSNTVSACELAITLLLATARNIL 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW++  F+G E
Sbjct: 119 PADRYLKSGKWDREIFVGNE 138


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVD+  A+  GI+V+N P  +SI+ AE    +ML+  R IP
Sbjct: 59  IIDASENLKVIARAGVGVDNVDINAATEKGIIVLNAPDASSISVAELLFGMMLSAVRNIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++ +F G+E
Sbjct: 119 QATASLKRGEWDRKSFKGLE 138


>gi|289642877|ref|ZP_06475013.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
 gi|289507354|gb|EFD28317.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
          Length = 529

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +KVV RAGIG DNVD+V A+  G++V+N P  N ++ AEHA++L+ A+AR+IP
Sbjct: 57  VLAAARSLKVVARAGIGLDNVDVVTATTRGVMVVNAPLSNIVSAAEHAVALLAAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN +   G+W++  ++GVE
Sbjct: 117 AANAALRGGEWKRSKYVGVE 136


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + G+E
Sbjct: 120 ASAALKDGEWKRSKYTGIE 138


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A+ AGI+V+N P  N I+ AE AI  +L++AR IP 
Sbjct: 60  IAAAPRLQVVARAGVGLDNVDIKAATTAGIMVVNAPTSNVISAAELAIGHILSLARFIPD 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S  +G W++ +F GVE
Sbjct: 120 ASASLKQGLWKRSSFTGVE 138


>gi|77918032|ref|YP_355847.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77544115|gb|ABA87677.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 534

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   + +KVV RAG+G DNVDL  AS  GI+V N PFGN  +  EHA++L+LA  R++ 
Sbjct: 58  LLDAGENLKVVARAGVGLDNVDLKAASEKGIIVCNAPFGNINSVIEHAMALILAACRKLV 117

Query: 61  VANESTHKGKWEK 73
            A+ S   G+W +
Sbjct: 118 KADNSIKSGEWNR 130


>gi|119963300|ref|YP_948230.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
 gi|119950159|gb|ABM09070.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
          Length = 539

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 70  IAAAKNLKVIARAGVGLDNVDIKSATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 129

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + G+E
Sbjct: 130 ASSALKNGEWKRSKYTGIE 148


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score = 73.6 bits (179), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+GRAG+G DNVD+  AS  GI+V+NTP  N+I   E  IS ML + R   
Sbjct: 59  LIDRGEHLKVIGRAGVGVDNVDIERASLRGILVVNTPGANTIGATELTISHMLNVLRNAH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A++S  +G+W++  FMG E
Sbjct: 119 IAHQSILEGRWDRKKFMGRE 138


>gi|289597094|ref|YP_003483790.1| Phosphoglycerate dehydrogenase [Aciduliprofundum boonei T469]
 gi|289534881|gb|ADD09228.1| Phosphoglycerate dehydrogenase [Aciduliprofundum boonei T469]
          Length = 304

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A+K+K +GRAG+G DN+D+  A   GI V+NTP   SI+ AE  I L+LA+ R+I 
Sbjct: 57  MIDAAEKLKAIGRAGVGLDNIDVEYAKSKGIKVINTPGATSISVAELTIGLILAVMRKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W K    G+E
Sbjct: 117 YADREMRNGAWPKKKCKGIE 136


>gi|294056127|ref|YP_003549785.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615460|gb|ADE55615.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 528

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG+G DN+D+  A+  G++VMNTP GN+I TAE   + MLA  R I 
Sbjct: 58  VIAAAPQLKVVGRAGVGVDNIDIEAATDNGVIVMNTPTGNTIATAELTFTHMLAGTRPIV 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A     +G W++  F G E
Sbjct: 118 QACARMREGGWDRKKFGGSE 137


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVVGRAG+G DNVD+  A++ GI+V+NTP  N+I   E  +  ML I R   
Sbjct: 59  LLERAEKLKVVGRAGVGVDNVDIEEATKRGILVVNTPGANTIGATELTMMHMLTIMRNGH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ES    KW++  FMG E
Sbjct: 119 KAHESMLNYKWDRKKFMGEE 138


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 58  VLDGAADLMIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAAARSIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W K +F+G E
Sbjct: 118 QAHTRLKAGDWAKSDFLGTE 137


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DN+D+  A++ G++V+N P GN+I+TAEH  ++  A+ R IP AN S  
Sbjct: 63  LKIVARAGVGVDNIDIDEATKHGVIVVNAPNGNTISTAEHTFAMFSALMRHIPQANISVK 122

Query: 68  KGKWEKFNFMGVE 80
             +W +  ++G E
Sbjct: 123 SREWNRSAYVGSE 135


>gi|313679957|ref|YP_004057696.1| d-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
 gi|313152672|gb|ADR36523.1| D-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
          Length = 520

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 50/73 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+GR G+G DN+DL  ASR GI+V+N P  N+ + AE A  LML+ AR + 
Sbjct: 55  LLERAERLKVIGRGGVGVDNIDLDAASRRGILVINVPEANTRSAAELAFGLMLSAARLVA 114

Query: 61  VANESTHKGKWEK 73
           +++    +G+W +
Sbjct: 115 LSDRELREGRWNR 127


>gi|212224614|ref|YP_002307850.1| D-3-phosphoglycerate dehydrogenase [Thermococcus onnurineus NA1]
 gi|212009571|gb|ACJ16953.1| D-3-phosphoglycerate dehydrogenase [Thermococcus onnurineus NA1]
          Length = 307

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE  ++LM A+AR+I 
Sbjct: 60  VIEAAPKLKVIGRAGVGLDNIDLDAAKERGIKVVNSPGASSRSVAELVVALMFAVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W K   MG+E
Sbjct: 120 FADRKMRGGVWAKKQCMGIE 139


>gi|297616224|ref|YP_003701383.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144061|gb|ADI00818.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 528

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S   ++K+VGRAG G DN+D+   +R GI+V NTP  N+I+ AE  I+L+L+  R   
Sbjct: 59  LVSRGTRLKMVGRAGNGIDNIDVDACTRRGIIVANTPDSNTISAAEQTIALLLSSVRHTA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     G W++  F GVE
Sbjct: 119 EANAFLKGGNWDRKPFRGVE 138


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH++++  A AR IP
Sbjct: 57  VFAAAPDLIIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHSVAMAFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++    G+W K  F+G E
Sbjct: 117 QAHDRLKSGEWAKGEFLGTE 136


>gi|307298969|ref|ZP_07578771.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915394|gb|EFN45779.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 307

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+K++ RAG+G DNVD+  A R  I+V NTP  N+I+ AE    L+L++ R IP
Sbjct: 58  VIDAGKKLKLIARAGVGLDNVDVEAAKRHNIMVRNTPGANAISVAELTFGLLLSLVRHIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
                  +GKWEK    G E
Sbjct: 118 RGTYGIKEGKWEKKELKGTE 137


>gi|14520969|ref|NP_126444.1| phosphoglycerate dehydrogenase (serA), Nter fragment [Pyrococcus
           abyssi GE5]
 gi|5458186|emb|CAB49675.1| serA D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) [Pyrococcus
           abyssi GE5]
          Length = 307

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A++LM A+AR+I 
Sbjct: 60  VIESAPKLKVIARAGVGLDNIDVEAAKERGIEVVNAPAASSRSVAELAVALMFAVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG+E
Sbjct: 120 FADRKMREGVWAKKQAMGIE 139


>gi|328778535|ref|XP_001121753.2| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Apis mellifera]
          Length = 513

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+  +AR + 
Sbjct: 62  VFACCPNLRVVGRAGTGVDNIDLEAATRKGVIVLNTPGGNSISACELTCALISNLARNVT 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S   G+W++  + G E
Sbjct: 122 QAVQSLKDGRWDRKLYSGFE 141


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 48/76 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++ +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A+AR IP A+ 
Sbjct: 61  ASELVIVGRAGIGVDNIDIEAATDHGVIVANAPEGNVRAAAEHTVAMTFAVARSIPQAHG 120

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K  F+G E
Sbjct: 121 RLLGGEWAKGEFLGTE 136


>gi|159036772|ref|YP_001536025.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
 gi|157915607|gb|ABV97034.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
          Length = 531

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATTRGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 119 ASTALKAGEWKRSKYTGVE 137


>gi|242004086|ref|XP_002422968.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
 gi|212505884|gb|EEB10230.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
          Length = 365

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +KV+GRAG G DN+DL  A++ GI V+NTP GNSI+  E   +L+  +AR + 
Sbjct: 62  VINSVSNLKVIGRAGTGVDNIDLEAATKKGITVLNTPGGNSISACEMTCALITNLARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S  +G+W++  + G E
Sbjct: 122 QACQSLKEGRWDRKLYTGNE 141


>gi|238063230|ref|ZP_04607939.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
 gi|237885041|gb|EEP73869.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
          Length = 532

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 119 ASAALKAGEWKRSKYTGVE 137


>gi|240102377|ref|YP_002958686.1| D-3-phosphoglycerate dehydrogenase, putative (serA) [Thermococcus
           gammatolerans EJ3]
 gi|239909931|gb|ACS32822.1| D-3-phosphoglycerate dehydrogenase, putative (serA) [Thermococcus
           gammatolerans EJ3]
          Length = 304

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE    L+ A+AR++ 
Sbjct: 57  VIENAPKLKVIGRAGVGLDNIDLEAAKERGIKVVNSPGASSRSVAELVFGLLFAVARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG+E
Sbjct: 117 FADRKMREGVWAKKQCMGIE 136


>gi|284049355|ref|YP_003399694.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
 gi|283953576|gb|ADB48379.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
          Length = 529

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+ +KVVGRAG G DN+D+  A++ GI+V+NTP  N I+ AEH I LMLA  R    A +
Sbjct: 65  ARNLKVVGRAGNGVDNIDIEGATKRGIIVVNTPEANVISAAEHTIGLMLASCRNTVKAQK 124

Query: 65  STHKGKWEKFNFMGVE 80
                 W++ N  GVE
Sbjct: 125 MIESRVWDRKNLKGVE 140


>gi|302342159|ref|YP_003806688.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfarculus baarsii DSM 2075]
 gi|301638772|gb|ADK84094.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfarculus baarsii DSM 2075]
          Length = 316

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAG G DNVD+   +  G++VMNTP  NS   AE A+  + A++R I 
Sbjct: 57  LLAAADSLKVVGRAGTGLDNVDIPACTAKGVIVMNTPGQNSNAAAELAMGHIFAVSRHIG 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
             N    +GKWEK    G E
Sbjct: 117 RGNAGVKQGKWEKKQLRGRE 136


>gi|330466217|ref|YP_004403960.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328809188|gb|AEB43360.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 532

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 119 ASAALKAGEWKRSKYTGVE 137


>gi|302865806|ref|YP_003834443.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315502351|ref|YP_004081238.1| d-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
 gi|302568665|gb|ADL44867.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408970|gb|ADU07087.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
          Length = 532

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 119 ASAALKAGEWKRSKYTGVE 137


>gi|296242880|ref|YP_003650367.1| phosphoglycerate dehydrogenase [Thermosphaera aggregans DSM 11486]
 gi|296095464|gb|ADG91415.1| Phosphoglycerate dehydrogenase [Thermosphaera aggregans DSM 11486]
          Length = 305

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ RAG+G DN+D+  A + GI ++N P  ++ + AE AI LMLA+AR+I 
Sbjct: 57  VIESADRLKVIARAGVGLDNIDVKAAEQRGIALINAPESSTQSVAELAIGLMLAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ++    +G W K   MGVE
Sbjct: 117 FSDRRMREGYWAKKEAMGVE 136


>gi|315231333|ref|YP_004071769.1| D-3-phosphoglycerate dehydrogenase [Thermococcus barophilus MP]
 gi|315184361|gb|ADT84546.1| D-3-phosphoglycerate dehydrogenase [Thermococcus barophilus MP]
          Length = 307

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE   +L+LA+AR++ 
Sbjct: 57  VIEAAEKLKVIGRAGVGLDNIDLEAAKEKGIEVVNSPAASSRSVAELTWALILAVARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG+E
Sbjct: 117 FADRKMREGVWAKKQCMGIE 136


>gi|156553723|ref|XP_001600828.1| PREDICTED: similar to GA19489-PA [Nasonia vitripennis]
          Length = 511

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +  +K+VGRAG G DN+D+  A+R GI+V+NTP GNS++  E   +++ A+AR + 
Sbjct: 62  VIAASPNLKLVGRAGTGVDNIDIPAATRNGILVLNTPGGNSVSACELTCAVISALARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S  +G+W++  + G E
Sbjct: 122 QAGQSMKEGRWDRKLYAGRE 141


>gi|297622551|ref|YP_003703985.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
 gi|297163731|gb|ADI13442.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
          Length = 524

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GR G+G DN+D+  ASR GI+V+N P  N+++ AE  I+LML  AR + 
Sbjct: 56  LIRAAARLKVIGRGGVGVDNIDIAAASRRGILVLNAPESNNVSAAELTIALMLCAARGVS 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ++     GKW++  F+G E
Sbjct: 116 RSDRLIRAGKWDR-KFLGRE 134


>gi|222640652|gb|EEE68784.1| hypothetical protein OsJ_27507 [Oryza sativa Japonica Group]
          Length = 528

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 12/85 (14%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES- 65
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ ++AR +  A+ + 
Sbjct: 35  RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLASMARNVSQADAAL 94

Query: 66  -----------THKGKWEKFNFMGV 79
                      T +GKW++  ++GV
Sbjct: 95  KAVYSRTLTVFTAQGKWQRTKYVGV 119


>gi|145593787|ref|YP_001158084.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
 gi|145303124|gb|ABP53706.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
          Length = 531

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATTRGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G+W++  + GVE
Sbjct: 119 ASTALKVGEWKRSKYTGVE 137


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++ +VGRAGIG DN+D+  A+  G++V N P GN    +EH +++  A AR IP
Sbjct: 57  VLEAAEELAIVGRAGIGVDNIDIDAATDEGVIVANAPEGNVRAASEHTVAMTFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G+W K +++G E
Sbjct: 117 QAHIRLKNGEWAKGDYLGAE 136


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP A+ 
Sbjct: 63  ASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAGARSIPQAHA 122

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K  ++G E
Sbjct: 123 RLRTGEWAKSEYLGTE 138


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 57  VLEAAEDLVIVGRAGIGVDNIDIEAATDNGVIVANAPEGNVRAAAEHTVAMTFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G+W K  ++G E
Sbjct: 117 QAHIRLKDGEWAKSEYLGAE 136


>gi|94984817|ref|YP_604181.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
 gi|94555098|gb|ABF45012.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
          Length = 542

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KV+GR G+G DN+DL   SR GI+V+N P  N+++ AE AI  +LA AR +  ++  T
Sbjct: 77  RLKVIGRGGVGVDNIDLEACSRRGILVLNAPESNNVSAAELAIMHLLAAARGLTRSDRKT 136

Query: 67  HKGKWEKFNFMGVE 80
             G+W++  F+GVE
Sbjct: 137 RAGEWDR-KFLGVE 149


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP A+ 
Sbjct: 65  ASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAGARSIPQAHA 124

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K  ++G E
Sbjct: 125 RLRTGEWAKSEYLGTE 140


>gi|307266196|ref|ZP_07547739.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918800|gb|EFN49031.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 309

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K++V+GR G+G DN+D     + GIVV+NTP  N+I+ AEH   L+LA++R++   ++
Sbjct: 64  ANKLRVIGRLGVGIDNIDTEACKQKGIVVVNTPGENAISVAEHVFGLILAVSRRLTCLDK 123

Query: 65  STHKGKW-EKFNFMGVE 80
              +G+W EK  + G+E
Sbjct: 124 LIREGRWKEKIKYEGIE 140


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (61%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP A+ 
Sbjct: 61  ASDLVIVGRAGIGVDNIDIEAATENGVIVANAPEGNVRAAAEHTVAMAFAAARSIPQAHA 120

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K +++G E
Sbjct: 121 RLKGGEWAKGDYLGTE 136


>gi|226225601|ref|YP_002759707.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
 gi|226088792|dbj|BAH37237.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
          Length = 534

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K+KVVGRAG+G DN++L VA+  GI ++N P GN++  AE     ++ + RQ+ 
Sbjct: 59  LLKAGGKLKVVGRAGVGVDNIELDVATSLGIAIINAPAGNTVAVAELFFGTVIGLLRQLH 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G+W++  FMG E
Sbjct: 119 TAAAAMGDGRWDRAKFMGRE 138


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPEGNIMAAAELTIGLIFSIFRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G + +  F GVE
Sbjct: 117 QAYMACKHGDFRRNRFKGVE 136


>gi|301122067|ref|XP_002908760.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
 gi|262099522|gb|EEY57574.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
          Length = 3635

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 49/65 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+ ++GRAG G DN+D+V A++ G++VMNTPFGN+I+ AE  + L+ A++R   
Sbjct: 90  VLDAAQKLTLIGRAGTGVDNIDMVNATKQGVLVMNTPFGNTISAAELTVGLISAVSRLGH 149

Query: 61  VANES 65
            A+E+
Sbjct: 150 AASEA 154


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKRGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +  +G + +  F GVE
Sbjct: 117 QAYMACKQGDFRRNRFKGVE 136


>gi|291235592|ref|XP_002737728.1| PREDICTED: phosphoglycerate dehydrogenase-like [Saccoglossus
           kowalevskii]
          Length = 525

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 50/79 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++  AG GTD+VD   AS  GI+VMN P  N+I+TAEH  +++L + R +P
Sbjct: 62  IIQKAAEVKLIAFAGTGTDSVDNDAASDHGIIVMNAPGANTISTAEHTCAMILTVVRNLP 121

Query: 61  VANESTHKGKWEKFNFMGV 79
            A  S  +GKWE     G+
Sbjct: 122 QAYVSMKEGKWETEKLTGI 140


>gi|187780257|ref|ZP_02996730.1| hypothetical protein CLOSPO_03853 [Clostridium sporogenes ATCC
           15579]
 gi|187773882|gb|EDU37684.1| hypothetical protein CLOSPO_03853 [Clostridium sporogenes ATCC
           15579]
          Length = 317

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 48/75 (64%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           + +K+V RAG+G DNVDL  A   G++V NTP  +S++ AE  I  ML I+R I  AN +
Sbjct: 67  RNLKLVVRAGVGLDNVDLEYAKEKGVIVFNTPKASSVSVAELTIGHMLCISRFINTANVT 126

Query: 66  THKGKWEKFNFMGVE 80
             +GKWEK  + G E
Sbjct: 127 MLEGKWEKKKYKGTE 141


>gi|14591190|ref|NP_143266.1| phosphoglycerate dehydrogenase [Pyrococcus horikoshii OT3]
 gi|88191759|pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From
           Pyrococcus Horikoshii Ot3
 gi|88191760|pdb|1WWK|B Chain B, Crystal Structure Of Phosphoglycerate Dehydrogenase From
           Pyrococcus Horikoshii Ot3
 gi|3257810|dbj|BAA30493.1| 307aa long hypothetical phosphoglycerate dehydrogenase [Pyrococcus
           horikoshii OT3]
          Length = 307

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM ++AR+I 
Sbjct: 60  VIESAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFSVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG+E
Sbjct: 120 FADRKMREGVWAKKEAMGIE 139


>gi|254173361|ref|ZP_04880034.1| D-3-phosphoglycerate dehydrogenase [Thermococcus sp. AM4]
 gi|214032770|gb|EEB73599.1| D-3-phosphoglycerate dehydrogenase [Thermococcus sp. AM4]
          Length = 304

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE    L+ A+AR+I 
Sbjct: 57  VIEAAPKLKVIGRAGVGLDNIDLEAAKERGIKVVNSPGASSRSVAELVFGLLFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   +G+E
Sbjct: 117 FADRKMREGVWAKKQCLGIE 136


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|56962002|ref|YP_173724.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56908236|dbj|BAD62763.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 316

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 45/71 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K++ + G+G DN+D+  A + G+ V N P  N    A+ A SL+L++ARQIP
Sbjct: 61  VLAQLPDLKIIAKHGVGVDNIDVDAAKKHGVTVTNVPNANKHAVADFAFSLLLSLARQIP 120

Query: 61  VANESTHKGKW 71
             NE T KGKW
Sbjct: 121 TGNEKTKKGKW 131


>gi|222100164|ref|YP_002534732.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
 gi|221572554|gb|ACM23366.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
          Length = 306

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE AI LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAIGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK    G E
Sbjct: 120 KATISLKEGKWEKKILKGKE 139


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (61%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP A+ 
Sbjct: 65  ASDLVIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHTVAMAFASARSIPQAHA 124

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K +++G E
Sbjct: 125 RLKTGEWAKGDYLGTE 140


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|226502750|ref|NP_001148319.1| LOC100281928 [Zea mays]
 gi|195616328|gb|ACG29994.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195617508|gb|ACG30584.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 590

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR I  A+ S 
Sbjct: 110 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAVARNIAPADASL 169

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 170 KAGKWQRGKYVGV 182


>gi|194707240|gb|ACF87704.1| unknown [Zea mays]
          Length = 589

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 53/73 (72%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR I  A+ S 
Sbjct: 109 RLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAVARNIAPADASL 168

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 169 KAGKWQRGKYVGV 181


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 60/79 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AK++KVV RAG+G DNVD+  A++AG++V+N P  N ++ AE A++L+LA AR++P 
Sbjct: 67  LAAAKRLKVVARAGVGLDNVDVKAATQAGVMVVNAPTSNIVSAAELAVALLLAAARRVPA 126

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A++S   G+W++  + GVE
Sbjct: 127 ADQSLKNGEWKRSKYSGVE 145


>gi|260904884|ref|ZP_05913206.1| D-3-phosphoglycerate dehydrogenase [Brevibacterium linens BL2]
          Length = 530

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 52/79 (65%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++V+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  ++ +LA AR    
Sbjct: 60  IAAAKKLQVIARAGVGLDNVDVPAATSAGVMVVNAPTSNIISAAELTMAHILASARYFGA 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
            N S   G+W++  + GVE
Sbjct: 120 GNTSLKAGEWKRSKYTGVE 138


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|15644153|ref|NP_229202.1| D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
 gi|4981965|gb|AAD36472.1|AE001793_2 D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
          Length = 306

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI V+NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKVLNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK    G E
Sbjct: 120 RATVSLKEGKWEKKALKGKE 139


>gi|195434066|ref|XP_002065024.1| GK15239 [Drosophila willistoni]
 gi|194161109|gb|EDW76010.1| GK15239 [Drosophila willistoni]
          Length = 332

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A++  +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVPAATKHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGTE 142


>gi|170289217|ref|YP_001739455.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
 gi|170176720|gb|ACB09772.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
          Length = 306

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI V+NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKVLNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK    G E
Sbjct: 120 RATISLKEGKWEKKALKGKE 139


>gi|257052425|ref|YP_003130258.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691188|gb|ACV11525.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 520

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A  +K+V RAGIG DN+D+  A+  G++V N P GN    AEH I L    A+QIP
Sbjct: 56  VFENAPNLKIVSRAGIGVDNIDIPAATDHGVIVANAPRGNVYAAAEHTIGLAFNAAKQIP 115

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+     G W+  +F  +E G
Sbjct: 116 QAHMQVQAGGWDGASFDALELG 137


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 48/76 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +VGRAGIG DN+D+  A++ G++V N P GN    AEH +++  A AR IP A+ 
Sbjct: 61  APDLVIVGRAGIGVDNIDIDAATQHGVIVANAPEGNVRAAAEHTVAMGFAAARSIPQAHA 120

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K +++G E
Sbjct: 121 RLKDGEWAKSDYLGNE 136


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVESATKHGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG G DN+++  A++ GI+V NTP  N+I+  E AI+ +LA +R   
Sbjct: 59  LMEKAPNLKIVGRAGNGVDNINIEEATKRGIIVANTPDSNTISACEIAIAHILAGSRNFT 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKWE+  FMG E
Sbjct: 119 YADSYLKAGKWERDLFMGNE 138


>gi|329922429|ref|ZP_08278087.1| putative glyoxylate reductase [Paenibacillus sp. HGF5]
 gi|328942157|gb|EGG38433.1| putative glyoxylate reductase [Paenibacillus sp. HGF5]
          Length = 322

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +++ + R G+G DN+DL  A + GI V N P GN+   AE AI LM+++ R IP  + 
Sbjct: 70  APQLQGIARFGVGVDNIDLEAARKYGIQVTNVPRGNANAVAELAIGLMISVRRHIPALDR 129

Query: 65  STHKGKWEKF 74
           ST  G WE+F
Sbjct: 130 STKNGSWERF 139


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIECGKNLKVIARAGVGIDNVDVESATKHGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|257069029|ref|YP_003155284.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
 gi|256559847|gb|ACU85694.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
          Length = 535

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 51/76 (67%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++KVV RAG+G DNVD+  A+ AG++V+N P  N ++ AE AI+L+L+  R +  A+ 
Sbjct: 63  ASQLKVVARAGVGLDNVDVDAATAAGVMVINAPTSNIVSAAELAITLILSSLRNLGRADA 122

Query: 65  STHKGKWEKFNFMGVE 80
           S   G+WE+    GVE
Sbjct: 123 SVKAGRWERKQLTGVE 138


>gi|94468936|gb|ABF18317.1| phosphoglycerate dehydrogenase [Aedes aegypti]
          Length = 332

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K+K VGRAG G DN+D+V A+R  ++V+N P GNSI+  E    L+ A+AR   
Sbjct: 63  LVAGSGKLKAVGRAGAGVDNIDIVAATRNNVIVLNAPGGNSISACELTCFLIGALARPFC 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+W++  + G E
Sbjct: 123 PAASSMKEGRWDRKLYSGSE 142


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   + +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGRNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G + +  F GVE
Sbjct: 117 QAYMSCKQGDFRRNKFKGVE 136


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AKKM+ + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ MLA ARQ P 
Sbjct: 63  LARAKKMRAIVRAGVGVDNVDIPGCSKLGIVVMNVPTANTIAAVEMTMAHMLACARQFPY 122

Query: 62  ANESTHKGK-WEKFNFMGVE 80
           A+ +    + W + ++ G E
Sbjct: 123 AHNNLKLDRVWRRQDWYGTE 142


>gi|218884168|ref|YP_002428550.1| phosphoglycerate dehydrogenase [Desulfurococcus kamchatkensis
           1221n]
 gi|218765784|gb|ACL11183.1| phosphoglycerate dehydrogenase [Desulfurococcus kamchatkensis
           1221n]
          Length = 313

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KV+ RAG+G DN+D+  A   GI V+N P  +S++ AE A+ LM+A+AR+I  ++    
Sbjct: 69  LKVIARAGVGLDNIDVEAAKARGIEVINAPASSSVSVAELAVGLMIAVARKIAFSDRRMR 128

Query: 68  KGKWEKFNFMGVE 80
            G+W K   MG+E
Sbjct: 129 LGEWPKKQAMGIE 141


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA K+K + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ ML   R+ P
Sbjct: 59  LLTHATKLKAIVRAGVGVDNVDVPYCSQKGIVVMNVPTANTIAAVELTMAHMLNAVRRFP 118

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            AN+   + + W + ++ G E
Sbjct: 119 GANKQLKQDRLWRREDWYGTE 139


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAG+G DNVD+  A++AG++V+N P  N  + AE AI+L+LA AR IP 
Sbjct: 66  LAVAGQLKVVARAGVGLDNVDVGAATKAGVMVVNAPTSNITSAAELAIALLLATARHIPK 125

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN S   GKWE+  F GVE
Sbjct: 126 ANASLKSGKWERSKFTGVE 144


>gi|15806309|ref|NP_295015.1| D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
 gi|6459038|gb|AAF10861.1|AE001976_4 D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
          Length = 544

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 52/74 (70%), Gaps = 1/74 (1%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KV+GR G+G DN+DL  ASR G++V+N P  N+++ AE A+  ++A AR +  ++  T
Sbjct: 80  RLKVIGRGGVGVDNIDLEYASRRGLLVLNAPESNNVSAAELAVMHLMAAARGLTRSDRKT 139

Query: 67  HKGKWEKFNFMGVE 80
             G+W++  F+G+E
Sbjct: 140 RAGEWDR-KFLGLE 152


>gi|157109536|ref|XP_001650713.1| d-3-phosphoglycerate dehydrogenase [Aedes aegypti]
 gi|108878977|gb|EAT43202.1| d-3-phosphoglycerate dehydrogenase [Aedes aegypti]
          Length = 332

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K VGRAG G DN+D+V A+R  ++V+N P GNSI+  E    L+ A+AR    A  S 
Sbjct: 69  KLKAVGRAGAGVDNIDIVAATRNNVIVLNAPGGNSISACELTCFLIGALARPFCPAASSM 128

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  + G E
Sbjct: 129 KEGRWDRKLYSGSE 142


>gi|281412819|ref|YP_003346898.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
 gi|281373922|gb|ADA67484.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
          Length = 306

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK    G E
Sbjct: 120 RATISLKEGKWEKKALNGKE 139


>gi|195385134|ref|XP_002051263.1| GJ14930 [Drosophila virilis]
 gi|194147720|gb|EDW63418.1| GJ14930 [Drosophila virilis]
          Length = 332

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVAAATAHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGTE 142


>gi|148270512|ref|YP_001244972.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
 gi|147736056|gb|ABQ47396.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
          Length = 308

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE A+ LMLA AR I 
Sbjct: 62  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAMGLMLACARHIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +GKWEK    G E
Sbjct: 122 RATISLKEGKWEKKALNGKE 141


>gi|170758864|ref|YP_001786515.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169405853|gb|ACA54264.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 314

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|227488059|ref|ZP_03918375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227091921|gb|EEI27233.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 531

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  GI+V N P  N  +  EHA++L+LA ARQIP
Sbjct: 61  ILDAAANLQIVGRAGVGLDNVDVETATEKGIMVANAPTSNIHSACEHALALLLATARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++  F GVE
Sbjct: 121 AADKTLRDGEWKRSKFKGVE 140


>gi|296394457|ref|YP_003659341.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
 gi|296181604|gb|ADG98510.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
          Length = 531

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 59/79 (74%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+    +K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP 
Sbjct: 63  LAAGANLKIVARAGVGLDNVDVEAATANGVLVVNAPTSNIHSAAEHAVALLLAAARQIPP 122

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN++TH G+W++ +++GVE
Sbjct: 123 ANDTTHAGQWKRSSYLGVE 141


>gi|168178548|ref|ZP_02613212.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum NCTC
           2916]
 gi|182670771|gb|EDT82745.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum NCTC
           2916]
          Length = 314

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|227541455|ref|ZP_03971504.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227182737|gb|EEI63709.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 531

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  GI+V N P  N  +  EHA++L+LA ARQIP
Sbjct: 61  VLDAAANLQIVGRAGVGLDNVDVETATEKGIMVANAPTSNIHSACEHALALLLATARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+++   G+W++  F GVE
Sbjct: 121 AADKTLRDGEWKRSKFKGVE 140


>gi|226948399|ref|YP_002803490.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A2 str. Kyoto]
 gi|226842088|gb|ACO84754.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A2 str. Kyoto]
          Length = 314

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|126698579|ref|YP_001087476.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           630]
 gi|254974543|ref|ZP_05271015.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-66c26]
 gi|255091931|ref|ZP_05321409.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CIP 107932]
 gi|255100030|ref|ZP_05329007.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-63q42]
 gi|255305917|ref|ZP_05350089.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           ATCC 43255]
 gi|255313666|ref|ZP_05355249.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-76w55]
 gi|255516350|ref|ZP_05384026.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-97b34]
 gi|255649450|ref|ZP_05396352.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-37x79]
 gi|260682616|ref|YP_003213901.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CD196]
 gi|260686216|ref|YP_003217349.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           R20291]
 gi|306519527|ref|ZP_07405874.1| D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-32g58]
 gi|115250016|emb|CAJ67836.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile]
 gi|260208779|emb|CBA61655.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CD196]
 gi|260212232|emb|CBE02943.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           R20291]
          Length = 313

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
            KK+K++ R G+G DN+D+  A   GI VMNTP  +SI+ AE  I  +  +AR I  AN 
Sbjct: 64  GKKLKLIVRGGVGLDNIDVKYAQANGIKVMNTPNASSISVAELTIGQLFVLARFINTANV 123

Query: 65  STHKGKWEKFNFMGVE 80
           +   GKWEK  + G E
Sbjct: 124 TMRDGKWEKKKYKGTE 139


>gi|325290387|ref|YP_004266568.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965788|gb|ADY56567.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 527

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+GRAG+G +++DL  A+R GIVV+N P G S    E+   ++LA++R IP
Sbjct: 56  VIEAGRNLKVIGRAGVGVEHIDLQAATRGGIVVLNAPQGKSAAAIEYTFGMILALSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  +   G+W +  + G E
Sbjct: 116 QAYTAVKDGRWIQDIYTGSE 135


>gi|317050372|ref|YP_004111488.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945456|gb|ADU64932.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 520

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ ++ +++V+GRAG G+ N+D+  AS+ GIVV++TPF +S +TAE AI+L++  AR++ 
Sbjct: 57  IIENSPRLRVLGRAGSGSYNIDVEAASKRGIVVLHTPFISSTSTAELAIALLIGAARKLK 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      GKW++    G+E
Sbjct: 117 EATADMAGGKWDRGALNGLE 136


>gi|72161018|ref|YP_288675.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
 gi|71914750|gb|AAZ54652.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
          Length = 528

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVV RAG+G DNVD+  A++AG++V+N P  N I+ AE AI+L+LA AR   
Sbjct: 59  VLAAAPSLKVVARAGVGLDNVDVEAATKAGVLVVNAPTSNIISAAEQAINLLLATARNTA 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++  + GVE
Sbjct: 119 AAHAALVRGEWKRSKYTGVE 138


>gi|261407384|ref|YP_003243625.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Paenibacillus sp. Y412MC10]
 gi|261283847|gb|ACX65818.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Paenibacillus sp. Y412MC10]
          Length = 322

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A +++ + R G+G DN+DL  A + GI V N P GN+   AE AI LM+++ R IP  + 
Sbjct: 70  APRLQGIARFGVGVDNIDLGAARKYGIQVTNVPRGNANAVAELAIGLMISVRRHIPALDR 129

Query: 65  STHKGKWEKF 74
           ST  G WE+F
Sbjct: 130 STKNGGWERF 139


>gi|255654967|ref|ZP_05400376.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-23m63]
 gi|296449715|ref|ZP_06891485.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP08]
 gi|296877968|ref|ZP_06901987.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP07]
 gi|296261439|gb|EFH08264.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP08]
 gi|296431036|gb|EFH16864.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP07]
          Length = 313

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
            KK+K++ R G+G DN+D+  A   GI VMNTP  +SI+ AE  I  +  +AR I  AN 
Sbjct: 64  GKKLKLIVRGGVGLDNIDVKYAQANGIKVMNTPNASSISVAELTIGQLFVLARFINTANV 123

Query: 65  STHKGKWEKFNFMGVE 80
           +   GKWEK  + G E
Sbjct: 124 TMRDGKWEKKKYKGTE 139


>gi|194759059|ref|XP_001961767.1| GF15130 [Drosophila ananassae]
 gi|190615464|gb|EDV30988.1| GF15130 [Drosophila ananassae]
          Length = 332

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGTE 142


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAKK+K + RAG+G DNVD+   SR GI+VMN P  N+I   E   + MLA  R  P
Sbjct: 62  LLEHAKKLKAIVRAGVGVDNVDMEECSRRGIIVMNVPTANTIAAVELTFAHMLACMRAFP 121

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N+   +  W++  ++G E
Sbjct: 122 YAHNQLKLERIWKREAWIGNE 142


>gi|187735211|ref|YP_001877323.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Akkermansia muciniphila ATCC BAA-835]
 gi|187425263|gb|ACD04542.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Akkermansia muciniphila ATCC BAA-835]
          Length = 523

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG G DN+D+V A +  + VMNTP  NS   AE  ++++LA  R I  A+ +T 
Sbjct: 64  LKLVVRAGAGYDNIDIVYARKKNVDVMNTPGANSNAVAEEVMAMILAYYRHIVQADATTR 123

Query: 68  KGKWEKFNFMGVE 80
           +G WEK  +MG E
Sbjct: 124 EGLWEKKKYMGSE 136


>gi|154248802|ref|YP_001409627.1| phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
 gi|154152738|gb|ABS59970.1| Phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
          Length = 303

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++GRAG G DN+D+ VA   GI V+NTP  NSI+ AE  I LM+A +R I       
Sbjct: 63  KLKIIGRAGTGLDNIDVKVAEAKGIKVINTPGANSISVAELTIGLMIACSRHIARGTIDL 122

Query: 67  HKGKWEKFNFMGVE 80
             GKW K    G E
Sbjct: 123 KNGKWTKKELEGHE 136


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 58/73 (79%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R IP A+ ST 
Sbjct: 64  LKIIGRAGVGVDNVDVPAATKRGVIVVNSPGGNTIAAAEHALALLLSLSRNIPQAHLSTI 123

Query: 68  KGKWEKFNFMGVE 80
            GKW++  F+G E
Sbjct: 124 SGKWDRKKFVGNE 136


>gi|289578762|ref|YP_003477389.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter italicus Ab9]
 gi|289528475|gb|ADD02827.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter italicus Ab9]
          Length = 325

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 50/75 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+K++ R G G DN+D+  A+  GI+V N P  NS++ AEH I+++L +A+Q+ 
Sbjct: 58  IIENAPKLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNSLSVAEHTIAMILHLAKQLS 117

Query: 61  VANESTHKGKWEKFN 75
           + +++   G WE  N
Sbjct: 118 LMDQAVRNGNWEMRN 132


>gi|15893313|ref|NP_346662.1| D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum ATCC
           824]
 gi|15022834|gb|AAK78002.1|AE007515_2 D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum ATCC
           824]
 gi|325507422|gb|ADZ19058.1| D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum EA
           2018]
          Length = 305

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ RAG+G DN+D+  A   G+ V NTP  +S + AE AI  M A++R I  AN + 
Sbjct: 67  KLKLIIRAGVGVDNIDVTYARDKGLTVNNTPNASSASVAELAIGHMFAVSRFINTANVTM 126

Query: 67  HKGKWEKFNFMGVE 80
            +GKWEK  + G E
Sbjct: 127 RQGKWEKKAYTGTE 140


>gi|88856753|ref|ZP_01131408.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
 gi|88814050|gb|EAR23917.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
          Length = 530

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 49/72 (68%)

Query: 9   KVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHK 68
           KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR IP A+ +  +
Sbjct: 67  KVIARAGVGLDNVDIKAATAAGVMVVNAPTSNIISAAELTVGHILSLARHIPAAHGALAQ 126

Query: 69  GKWEKFNFMGVE 80
           G+W++  + G E
Sbjct: 127 GQWKRSQYSGTE 138


>gi|242398998|ref|YP_002994422.1| SerA D-3-phosphoglycerate dehydrogenase [Thermococcus sibiricus MM
           739]
 gi|242265391|gb|ACS90073.1| SerA D-3-phosphoglycerate dehydrogenase [Thermococcus sibiricus MM
           739]
          Length = 304

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DNVD+  A   GI V+N P  +S + AE A++LM  IAR++ 
Sbjct: 57  IIDAAPSLKVIARAGVGLDNVDVEYAKSKGIEVVNAPTASSRSVAELAVALMFNIARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   MG E
Sbjct: 117 FADRKIREGAWPKKQCMGFE 136


>gi|195472108|ref|XP_002088344.1| GE12961 [Drosophila yakuba]
 gi|194174445|gb|EDW88056.1| GE12961 [Drosophila yakuba]
          Length = 332

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +  A +S 
Sbjct: 69  RLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSM 128

Query: 67  HKGKWEKFNFMGVE 80
            +G+W++  + G E
Sbjct: 129 KEGRWDRKLYAGTE 142


>gi|253681089|ref|ZP_04861892.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum D str.
           1873]
 gi|253562938|gb|EES92384.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum D str.
           1873]
          Length = 315

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAG G DN+++  A++ GI+V NTP  N+I+  E  I+ +LA +R   
Sbjct: 59  LMERAINLKVVGRAGNGVDNINIEEATKRGIIVANTPDSNAISACEITIAHILAGSRNFT 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKWE+  FMG E
Sbjct: 119 YADSYLKSGKWERDLFMGNE 138


>gi|195578477|ref|XP_002079092.1| GD22186 [Drosophila simulans]
 gi|194191101|gb|EDX04677.1| GD22186 [Drosophila simulans]
          Length = 332

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +  A +S  
Sbjct: 70  LKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYAGTE 142


>gi|195340089|ref|XP_002036649.1| GM11122 [Drosophila sechellia]
 gi|66803829|gb|AAY56642.1| unknown [Drosophila simulans]
 gi|194130529|gb|EDW52572.1| GM11122 [Drosophila sechellia]
          Length = 332

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +  A +S  
Sbjct: 70  LKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYAGTE 142


>gi|19921140|ref|NP_609496.1| CG6287 [Drosophila melanogaster]
 gi|7297831|gb|AAF53080.1| CG6287 [Drosophila melanogaster]
 gi|16182520|gb|AAL13511.1| GH03305p [Drosophila melanogaster]
 gi|66803815|gb|AAY56641.1| unknown [Drosophila melanogaster]
 gi|220947538|gb|ACL86312.1| CG6287-PA [synthetic construct]
 gi|220956928|gb|ACL91007.1| CG6287-PA [synthetic construct]
          Length = 332

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +  A +S  
Sbjct: 70  LKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYAGTE 142


>gi|116624217|ref|YP_826373.1| D-isomer specific 2-hydroxyacid dehydrogenase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116227379|gb|ABJ86088.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 312

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 46/67 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+++V   G GTD+VDL  A+R G+ V NTP   + + AEH ++L+ A+ARQIP  + +T
Sbjct: 71  KLRMVSIWGTGTDHVDLAAAARHGVTVANTPGVAARSIAEHTLALLFAVARQIPHMDAAT 130

Query: 67  HKGKWEK 73
            +G WE+
Sbjct: 131 RRGAWER 137


>gi|206900326|ref|YP_002251477.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206739429|gb|ACI18487.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 316

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 51/74 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+ + G+G DN+D++ A +  IVV NTP  NS   AE  + L++ + R+I 
Sbjct: 64  VLKNANKLKVISKYGVGVDNIDILEAKKRNIVVTNTPGANSNAVAELTVGLIINVLRKIN 123

Query: 61  VANESTHKGKWEKF 74
           ++++ T +G+W++F
Sbjct: 124 LSDKKTREGRWDRF 137


>gi|311898491|dbj|BAJ30899.1| putative D-3-phosphoglycerate dehydrogenase [Kitasatospora setae
           KM-6054]
          Length = 528

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 47/68 (69%)

Query: 13  RAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHKGKWE 72
           RAG+G DNVD+  +++AG++V+N P  N +T AE A  L++++AR I  AN +   G+W+
Sbjct: 73  RAGVGLDNVDVAASTKAGVMVVNAPTSNIVTAAELACGLLISVARNIAPANAALKGGEWK 132

Query: 73  KFNFMGVE 80
           +  + GVE
Sbjct: 133 RNKYTGVE 140


>gi|160901744|ref|YP_001567325.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Petrotoga mobilis SJ95]
 gi|160359388|gb|ABX31002.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Petrotoga mobilis SJ95]
          Length = 310

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 46/80 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+K+V RAG+G DN+D+  A   GI V+NTP  NS++ AE  I ++L I R I 
Sbjct: 58  ILEHADKLKIVARAGMGLDNIDVDTAKLKGITVLNTPGQNSLSVAELVIGMVLDIYRHIT 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
                    +WEK    G E
Sbjct: 118 RGTIGLKNEQWEKKQLEGFE 137


>gi|224033165|gb|ACN35658.1| unknown [Zea mays]
          Length = 218

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 133 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 192

Query: 67  HKGKWEKFNFMGVEA 81
             G +   + +  E+
Sbjct: 193 KAGLFPSVHRLHSES 207


>gi|168182980|ref|ZP_02617644.1| phosphoglycerate dehydrogenase [Clostridium botulinum Bf]
 gi|237794419|ref|YP_002861971.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum Ba4 str. 657]
 gi|182673831|gb|EDT85792.1| phosphoglycerate dehydrogenase [Clostridium botulinum Bf]
 gi|229263963|gb|ACQ54996.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum Ba4 str. 657]
          Length = 314

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  M  I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMFCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|254520812|ref|ZP_05132868.1| D-isomer specific 2-hydroxyacid dehydrogenase [Clostridium sp.
           7_2_43FAA]
 gi|226914561|gb|EEH99762.1| D-isomer specific 2-hydroxyacid dehydrogenase [Clostridium sp.
           7_2_43FAA]
          Length = 308

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ RAG+G DN+D+  A   GI V NTP  +S + AE A++ M A+AR +  +N + 
Sbjct: 72  KLKLIIRAGVGIDNIDIYTAHEKGITVKNTPNASSDSVAELALAHMFAVARFVGTSNYTM 131

Query: 67  HKGKWEKFNFMGVEAG 82
             G+W K  + G+E G
Sbjct: 132 RNGEWNKKKYEGIELG 147


>gi|300853317|ref|YP_003778301.1| D-3-phosphoglycerate dehydrogenase [Clostridium ljungdahlii DSM
           13528]
 gi|300433432|gb|ADK13199.1| D-3-phosphoglycerate dehydrogenase [Clostridium ljungdahlii DSM
           13528]
          Length = 308

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 53/82 (64%), Gaps = 2/82 (2%)

Query: 1   MLSHAKK--MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++  AKK  ++++ R G+G DN+D+  A++ GI V NTP  ++++ AE  +  + A++R 
Sbjct: 57  LIDEAKKGNLRLIIRGGVGVDNIDVKYATQNGITVRNTPNASTVSVAELTMGHIFAVSRY 116

Query: 59  IPVANESTHKGKWEKFNFMGVE 80
           I +AN +   GKWEK  + GVE
Sbjct: 117 INIANVTMRDGKWEKKKYKGVE 138


>gi|153939399|ref|YP_001390479.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|152935295|gb|ABS40793.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|295318562|gb|ADF98939.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           230613]
          Length = 314

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 62/80 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+++VGRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADKLRIVGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G W++  ++G E
Sbjct: 117 QAHASMREGAWDRKKYVGNE 136


>gi|322805452|emb|CBZ03016.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum H04402
           065]
          Length = 314

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|170756982|ref|YP_001780756.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum B1 str.
           Okra]
 gi|169122194|gb|ACA46030.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum B1 str. Okra]
          Length = 314

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|119872080|ref|YP_930087.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pyrobaculum islandicum DSM 4184]
 gi|119673488|gb|ABL87744.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum islandicum DSM
           4184]
          Length = 307

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ R G+G DNVD+  A + GI V++ P   + + AE  I LMLA+AR+IP
Sbjct: 57  IIDAGTNLKILARYGVGLDNVDVEYAVKRGIAVVSAPRAPTQSVAELTIGLMLAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + N    +G+W K  ++G+E
Sbjct: 117 LLNAKVKEGEWPKGKYIGIE 136


>gi|221633825|ref|YP_002523051.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
 gi|221156639|gb|ACM05766.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
          Length = 333

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 51/80 (63%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA ++KV+  +G+G DN+D+  A+R GIVV N    N  + AE A  LMLA+AR I 
Sbjct: 74  VLAHANRLKVISTSGVGFDNIDVAEATRRGIVVANCHGANEHSVAELAFGLMLALARGIH 133

Query: 61  VANESTHKGKWEKFNFMGVE 80
            ++    +G+WE   + GVE
Sbjct: 134 RSDRLMREGRWEP--YFGVE 151


>gi|156740626|ref|YP_001430755.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Roseiflexus castenholzii DSM 13941]
 gi|156231954|gb|ABU56737.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Roseiflexus castenholzii DSM 13941]
          Length = 345

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +  + R GIG DN+DL  A+  GI+V+NTP G + +TAEHA++L+LA+A+Q+  A+    
Sbjct: 70  LMAIARPGIGVDNIDLAAATERGILVINTPDGPTESTAEHAVALVLALAKQVVAADHRFR 129

Query: 68  KGKWEKFNFMGVE 80
              W      GVE
Sbjct: 130 TAGWSAARLRGVE 142


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 59/76 (77%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           + +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+LA++R IP A+ 
Sbjct: 61  SDRLRIIGRAGVGVDNVDVPAATKRGVLVVNSPGGNTIAAAEHALALLLALSRNIPQAHS 120

Query: 65  STHKGKWEKFNFMGVE 80
           ST  G WE+  ++G E
Sbjct: 121 STFGGLWERKKYVGNE 136


>gi|294634869|ref|ZP_06713391.1| D-3-phosphoglycerate dehydrogenase [Edwardsiella tarda ATCC 23685]
 gi|291091742|gb|EFE24303.1| D-3-phosphoglycerate dehydrogenase [Edwardsiella tarda ATCC 23685]
          Length = 412

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M + A+K+  VG   IGT+ VDL  A R GI V N PF N+ + AE  +  +L + R IP
Sbjct: 69  MFAAAEKLVAVGCFCIGTNQVDLAAAQRRGIPVFNAPFSNTRSVAEMVLGEILLLLRNIP 128

Query: 61  VANESTHKGKWEKF 74
            AN   H+G+W K 
Sbjct: 129 EANARAHRGEWNKL 142


>gi|255528364|ref|ZP_05395168.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium carboxidivorans P7]
 gi|296187909|ref|ZP_06856302.1| 4-phosphoerythronate dehydrogenase [Clostridium carboxidivorans P7]
 gi|255507940|gb|EET84376.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium carboxidivorans P7]
 gi|296047530|gb|EFG86971.1| 4-phosphoerythronate dehydrogenase [Clostridium carboxidivorans P7]
          Length = 309

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++  AK  ++K++ R G+G DN+D+  A   GI V NTP  +S + AE AI  M A+ R 
Sbjct: 57  LIDEAKNGELKLIIRGGVGVDNIDVEYARENGIEVRNTPNASSASVAELAIGHMFALTRY 116

Query: 59  IPVANESTHKGKWEKFNFMGVE 80
           I ++N +   GKWEK  + GVE
Sbjct: 117 INISNITMRDGKWEKKKYKGVE 138


>gi|240949734|ref|ZP_04754066.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus minor NM305]
 gi|240295766|gb|EER46453.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus minor NM305]
          Length = 409

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA K+  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 69  VLAHANKLIAIGCFCIGTNQVDLQEAKRRGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 KANAEVHRGVWNK 141


>gi|289743179|gb|ADD20337.1| D-3-phosphoglycerate dehydrogenase [Glossina morsitans morsitans]
          Length = 332

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG G DN+D+  A++  ++V+NTP GNSI+  E    L+ A+AR +  A +S  
Sbjct: 70  LKVVGRAGAGVDNIDVPAATKNNVIVLNTPGGNSISACELTCVLIGALARPVCPAAQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYTGTE 142


>gi|257465215|ref|ZP_05629586.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus minor 202]
 gi|257450875|gb|EEV24918.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus minor 202]
          Length = 409

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA K+  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 69  VLAHANKLIAIGCFCIGTNQVDLQEAKRRGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 KANAEVHRGVWNK 141


>gi|281356516|ref|ZP_06243008.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Victivallis vadensis ATCC BAA-548]
 gi|281317208|gb|EFB01230.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Victivallis vadensis ATCC BAA-548]
          Length = 524

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++ RAG G + +D+  A +  I VMNTP  NS   AE  +++MLA +R +  A+ ST
Sbjct: 63  QLKLIVRAGAGFNTIDIKYARKHDIDVMNTPGANSNAVAEEVVAMMLAASRHLIPADIST 122

Query: 67  HKGKWEKFNFMGVE 80
            KG WEK  FMG E
Sbjct: 123 RKGDWEKSKFMGRE 136


>gi|269839091|ref|YP_003323783.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790821|gb|ACZ42961.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 314

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++V+GR G+G DN+DL  A   G+ V+ TP  N+ + AEHA+ +MLA+A+++ 
Sbjct: 59  VLEAADSLRVIGRHGVGLDNIDLEAARELGVAVVYTPLANAESVAEHAVGMMLALAKRLR 118

Query: 61  VANESTHKGKW-EKFNFMGVE 80
             + +  +G+W  +++  G E
Sbjct: 119 EGDAALRRGEWGARYSLTGRE 139


>gi|297526254|ref|YP_003668278.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Staphylothermus hellenicus DSM 12710]
 gi|297255170|gb|ADI31379.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Staphylothermus hellenicus DSM 12710]
          Length = 311

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+KV+ RAG+G DN+DL  A+  GI V N P   + + AE AI LM+ + R+I  A+ 
Sbjct: 62  AEKLKVIARAGVGLDNIDLDAANEKGIQVFNAPSAPTQSVAELAIGLMIDVLRKIAFADR 121

Query: 65  STHKGKWEKFNFMGVE 80
              +G W K   +G E
Sbjct: 122 KMREGAWAKKQCLGRE 137


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 45/76 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +V RAGIG DN+D+  A+  G++V N P GN    AEH ++L  A AR IP A+ 
Sbjct: 61  APDLVIVARAGIGVDNIDIDAATDHGVMVANAPAGNVRAAAEHTVALAFAAARSIPQAHA 120

Query: 65  STHKGKWEKFNFMGVE 80
               G W K +++G E
Sbjct: 121 RLDAGSWAKDDYLGTE 136


>gi|118576136|ref|YP_875879.1| phosphoglycerate dehydrogenase [Cenarchaeum symbiosum A]
 gi|118194657|gb|ABK77575.1| phosphoglycerate dehydrogenase [Cenarchaeum symbiosum A]
          Length = 310

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK  K++ R G+G DN+DL  A  AG+ V+N   G +   +E  + +ML +ARQIP
Sbjct: 61  IIRSAKDCKIIARVGVGLDNIDLAAAESAGVRVINAVEGATTAVSELVLGMMLCMARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW K    G E
Sbjct: 121 RADRGIRGGKWLKGELGGTE 140


>gi|157364619|ref|YP_001471386.1| phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
 gi|157315223|gb|ABV34322.1| Phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
          Length = 303

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  +K+KV+GRAG+G DN+D+  A + GI V+NTP  +SI+ AE    L+L+ +R I 
Sbjct: 58  LINKGEKLKVIGRAGVGLDNIDVTAAKQKGIKVLNTPGASSISVAELTFGLILSASRHIA 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
                  KG W K    G E
Sbjct: 118 RGTCDLKKGLWTKKELEGHE 137


>gi|313902560|ref|ZP_07835960.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467126|gb|EFR62640.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 579

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++V+GRAG+G DN+DL  A+  GIVV+N   GN++  AEH  +L+LA+ R++ 
Sbjct: 61  LIAAAPRLRVIGRAGVGVDNIDLEAATERGIVVVNVADGNTVAVAEHVFALLLALVRRLV 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S  +G+WE+  F+G E
Sbjct: 121 PAAASLRQGRWERNRFVGEE 140


>gi|34557674|ref|NP_907489.1| D-3-phosphoglycerate dehydrogenase [Wolinella succinogenes DSM
           1740]
 gi|34483391|emb|CAE10389.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Wolinella succinogenes]
          Length = 528

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L   KK++ V RAG+G DNVD+   SR GIVVMN P  N+I   E  ++ ML+  R  P
Sbjct: 61  FLEATKKIRAVVRAGVGVDNVDIDGCSRKGIVVMNVPTANTIAAVELTLAHMLSACRNFP 120

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            AN+     + W++ ++ G E
Sbjct: 121 GANDQLKNARLWKREDWYGTE 141


>gi|300853586|ref|YP_003778570.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
 gi|300433701|gb|ADK13468.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
          Length = 316

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +K+V + G+G DN+DL    +  + V N P  N    A+ A  L+LA ARQIP
Sbjct: 61  VLKNAPNLKIVCKHGVGVDNIDLEATKKRNVYVTNVPNANKHAVADFAFGLILASARQIP 120

Query: 61  VANESTHKGKWEK 73
            AN+ T KG+W +
Sbjct: 121 QANDLTKKGEWPR 133


>gi|195050492|ref|XP_001992905.1| GH13534 [Drosophila grimshawi]
 gi|193899964|gb|EDV98830.1| GH13534 [Drosophila grimshawi]
          Length = 332

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVAAATTHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGSE 142


>gi|312375947|gb|EFR23183.1| hypothetical protein AND_13366 [Anopheles darlingi]
          Length = 1061

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++K VGRAG G DN+++  A++  ++V+NTP GNSI+  E    L+ A+AR I  A  
Sbjct: 67  AGRVKAVGRAGAGVDNINIEAATKNNVLVLNTPGGNSISACELTCFLIGALARPICPAAT 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGTE 142


>gi|150391336|ref|YP_001321385.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Alkaliphilus metalliredigens QYMF]
 gi|149951198|gb|ABR49726.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Alkaliphilus metalliredigens QYMF]
          Length = 304

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++++ RAG+G DN+D   A + GI V NTP  + ++ AE  I+ ML IAR++  +N + 
Sbjct: 66  KLRLIIRAGVGLDNIDGAYAMKNGITVRNTPDASKVSVAELTIAHMLMIARKLQQSNVTM 125

Query: 67  HKGKWEKFNFMGVE 80
            +GKW K  + GVE
Sbjct: 126 RQGKWLKKEYRGVE 139


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L HAK++K + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ ML+  R+ P 
Sbjct: 63  LEHAKELKAIVRAGVGVDNVDIDGCSKRGIVVMNVPTANTIAAVELTMAHMLSCVRKFPY 122

Query: 62  ANESTHKGK-WEKFNFMGVE 80
           A+ +  + + W + ++ G E
Sbjct: 123 AHNNLKQDRIWRRQDWYGTE 142


>gi|150020020|ref|YP_001305374.1| phosphoglycerate dehydrogenase [Thermosipho melanesiensis BI429]
 gi|149792541|gb|ABR29989.1| Phosphoglycerate dehydrogenase [Thermosipho melanesiensis BI429]
          Length = 303

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           K++K++ RAG G DNVD+  A   GI V+NTP  N I+ AE AI LM+A AR I      
Sbjct: 61  KRLKIIARAGTGLDNVDVEKAKEKGIKVLNTPGANGISVAELAIGLMIACARHIAKGTLD 120

Query: 66  THKGKWEKFNFMGVE 80
              G+W K    G E
Sbjct: 121 LKSGEWTKKQLKGHE 135


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L+ AR   
Sbjct: 60  FLNHAKKLKALIRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLSSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N   ++ KWE+  + GVE
Sbjct: 120 NAHNFLKNERKWEREKWYGVE 140


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L+ AR   
Sbjct: 60  FLNHAKKLKALIRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLSSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N   ++ KWE+  + GVE
Sbjct: 120 NAHNFLKNERKWEREKWYGVE 140


>gi|114762720|ref|ZP_01442154.1| phosphoglycerate dehydrogenase [Pelagibaca bermudensis HTCC2601]
 gi|114544630|gb|EAU47636.1| phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 335

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+DL  A+  GI V+     N+++ AEHAI+LMLA  +++ 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDLTAAAERGIPVLVATGANAVSVAEHAIALMLAAVKRVL 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G+WEK  F G E
Sbjct: 122 PLDAGLRAGRWEKPGFAGRE 141


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A  +KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHA++L+LA AR IP 
Sbjct: 62  LAAAPNLKVVARAGIGLDNVDVPAATERGVLVVNAPTSNIVSAAEHAVALLLAAARHIPA 121

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S  +G W++  F GVE
Sbjct: 122 ADASLREGTWKRSKFTGVE 140


>gi|295656030|ref|YP_003257116.2| putative phosphoglycerate dehydrogenase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|292806713|gb|ACX83973.2| putative phosphoglycerate dehydrogenase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 321

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK++ + R G G +N+D   A +  I +++TP GN  + AEHAI+++L+I   + 
Sbjct: 59  LLKEAKKLRFIARIGSGVENIDKDYAYKNKITLISTPEGNRDSVAEHAIAMLLSIMNHLF 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           ++N+   KGKW + +  G E
Sbjct: 119 ISNQEIRKGKWNRESNRGRE 138


>gi|54310220|ref|YP_131240.1| putative phosphoglycerate dehydrogenase [Photobacterium profundum
           SS9]
 gi|46914661|emb|CAG21438.1| putative phosphoglycerate dehydrogenase [Photobacterium profundum
           SS9]
          Length = 198

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+  VG   IGT+ VDL  AS+ GI V N PF N+ + AE  +  +L + R IP  N 
Sbjct: 73  AKKLTAVGCFCIGTNQVDLTAASKRGIPVFNAPFSNTRSVAELVLGEILLLVRGIPEKNA 132

Query: 65  STHKGKWEK 73
             H+G+W+K
Sbjct: 133 KAHRGEWQK 141


>gi|195118714|ref|XP_002003881.1| GI18148 [Drosophila mojavensis]
 gi|193914456|gb|EDW13323.1| GI18148 [Drosophila mojavensis]
          Length = 332

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVAAATTHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGNE 142


>gi|126465460|ref|YP_001040569.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Staphylothermus marinus F1]
 gi|126014283|gb|ABN69661.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Staphylothermus marinus F1]
          Length = 311

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+ RAG+G DN+DL  A+  GI V N P   + + AE AI LM+ + R+I 
Sbjct: 58  VIEAAEKLKVIARAGVGLDNIDLDAANEKGIQVFNAPAAPTQSVAELAIGLMIDVLRKIA 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    +G W K   +G E
Sbjct: 118 FADRKMREGVWAKKQCLGHE 137


>gi|125986067|ref|XP_001356797.1| GA19489 [Drosophila pseudoobscura pseudoobscura]
 gi|195148340|ref|XP_002015132.1| GL18582 [Drosophila persimilis]
 gi|54645123|gb|EAL33863.1| GA19489 [Drosophila pseudoobscura pseudoobscura]
 gi|194107085|gb|EDW29128.1| GL18582 [Drosophila persimilis]
          Length = 332

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +  A +
Sbjct: 67  AGSLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGALARPVVPAGQ 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGTE 142


>gi|325116300|emb|CBZ51853.1| hypothetical protein NCLIV_016450 [Neospora caninum Liverpool]
          Length = 398

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 49/69 (71%), Gaps = 2/69 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ H K++K++GRAG+G DNV +  A+  GI V+N+P GN++  AE  + LM+A+AR+I 
Sbjct: 74  IIKHGKRLKIIGRAGVGVDNVCVEAATAQGIFVVNSPNGNTMAAAELTLGLMMALARKIA 133

Query: 61  VANES--TH 67
            A+ S  TH
Sbjct: 134 QADASVGTH 142


>gi|238921218|ref|YP_002934733.1| phosphoglycerate dehydrogenase [Edwardsiella ictaluri 93-146]
 gi|238870786|gb|ACR70497.1| phosphoglycerate dehydrogenase [Edwardsiella ictaluri 93-146]
          Length = 412

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M S A+K+  VG   IGT+ VDL  A R G+ V N PF N+ + AE  +  +L + R IP
Sbjct: 69  MFSAAEKLVAVGCFCIGTNQVDLAAAQRRGVPVFNAPFSNTRSVAEMVLGEILLLLRNIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 129 QANACAHRGEWSK 141


>gi|171186007|ref|YP_001794926.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoproteus neutrophilus V24Sta]
 gi|170935219|gb|ACB40480.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoproteus neutrophilus V24Sta]
          Length = 311

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++ R G+G DNVD+  A + G+VV++ P   + + AE  I LMLA+AR+IP+ +    
Sbjct: 68  LKILARYGVGLDNVDVEYAVKRGLVVVSAPNAPTQSVAELTIGLMLAVARRIPLLSGKVK 127

Query: 68  KGKWEKFNFMGVEAG 82
            G+W K  ++GVE G
Sbjct: 128 GGEWPKGRYVGVELG 142


>gi|242309368|ref|ZP_04808523.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523939|gb|EEQ63805.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 406

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  AKK++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLEAAKKLRAVVRAGVGVDNVDIEASSKKGVVVMNVPTANTIAAVELTCAHILSAIRTFP 120

Query: 61  VAN-ESTHKGKWEKFNFMGVE 80
            AN +  ++ KW++ ++ G E
Sbjct: 121 SANAQLKNERKWKREDWYGTE 141


>gi|311894354|dbj|BAJ26762.1| putative oxidoreductase [Kitasatospora setae KM-6054]
          Length = 381

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 46/64 (71%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++V+GRAG GTD+VDL  A+R G+ V +TP  N+   AE A++  LA++R++P  N + H
Sbjct: 133 LRVIGRAGAGTDHVDLPAAARLGVAVTHTPGSNADAVAEFALAQALALSRRLPELNTACH 192

Query: 68  KGKW 71
           +G+W
Sbjct: 193 EGRW 196


>gi|165976877|ref|YP_001652470.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165876978|gb|ABY70026.1| phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 409

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 68  VLSHAKNLVSIGCFCIGTNQVDLKEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 127

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 128 KANAEVHRGVWNK 140


>gi|307261931|ref|ZP_07543589.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868342|gb|EFN00161.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 409

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 68  VLSHAKNLVSIGCFCIGTNQVDLKEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 127

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 128 KANAEVHRGVWNK 140


>gi|307257519|ref|ZP_07539283.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306863955|gb|EFM95874.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 409

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 68  VLSHAKNLVSIGCFCIGTNQVDLKEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 127

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 128 KANAEVHRGVWNK 140


>gi|46143684|ref|ZP_00204551.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208916|ref|YP_001054141.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           L20]
 gi|190150726|ref|YP_001969251.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250952|ref|ZP_07337141.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307246364|ref|ZP_07528440.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307250722|ref|ZP_07532656.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253099|ref|ZP_07534980.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255350|ref|ZP_07537160.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259800|ref|ZP_07541518.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307264127|ref|ZP_07545721.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126097708|gb|ABN74536.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915857|gb|ACE62109.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302650169|gb|EFL80336.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306852697|gb|EFM84926.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306857226|gb|EFM89348.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859393|gb|EFM91425.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861659|gb|EFM93643.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866098|gb|EFM97968.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306870501|gb|EFN02251.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 409

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 68  VLSHAKNLVSIGCFCIGTNQVDLKEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 127

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 128 KANAEVHRGVWNK 140


>gi|18313986|ref|NP_560653.1| D-3-phosphoglycerate dehydrogenase (serA) [Pyrobaculum aerophilum
           str. IM2]
 gi|18161561|gb|AAL64835.1| D-3-phosphoglycerate dehydrogenase (serA) [Pyrobaculum aerophilum
           str. IM2]
          Length = 307

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +K++ R G+G DNVD+  A + GI V++ P   S + AE  I L+ ++AR+IP
Sbjct: 57  IMDAGQNLKILARYGVGLDNVDVEYAVKKGIAVVSAPNAPSQSVAELTIGLLFSVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + N     G+W K  ++G+E
Sbjct: 117 LLNAKVKAGEWPKGKYIGIE 136


>gi|303252456|ref|ZP_07338620.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248491|ref|ZP_07530509.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648657|gb|EFL78849.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854967|gb|EFM87152.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 409

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 68  VLSHAKNLVSIGCFCIGTNQVDLKEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 127

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 128 KANAEVHRGVWNK 140


>gi|164687429|ref|ZP_02211457.1| hypothetical protein CLOBAR_01070 [Clostridium bartlettii DSM
           16795]
 gi|164603203|gb|EDQ96668.1| hypothetical protein CLOBAR_01070 [Clostridium bartlettii DSM
           16795]
          Length = 313

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 49/74 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++ R+G+G DN+D+  A++ GI VMNTP  ++ + AE  I  ++ IAR + +AN + 
Sbjct: 69  RLKIIIRSGVGLDNIDVKYATKKGIKVMNTPCASTRSVAELTIGQIITIARFVNIANVTM 128

Query: 67  HKGKWEKFNFMGVE 80
             G+W K  ++G E
Sbjct: 129 RDGEWNKKKYIGTE 142


>gi|320101099|ref|YP_004176691.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfurococcus mucosus DSM 2162]
 gi|319753451|gb|ADV65209.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfurococcus mucosus DSM 2162]
          Length = 316

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 50/76 (65%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  ++++ RAG+G DN+D+  A   GI V+N P  ++++ AE A+ LM+++AR+I  ++ 
Sbjct: 67  ADSLRIIARAGVGLDNIDVEAARERGIEVINAPASSTMSVAELAVGLMISVARKIAFSDR 126

Query: 65  STHKGKWEKFNFMGVE 80
               G+W K + +GVE
Sbjct: 127 RMRMGEWPKKHAVGVE 142


>gi|148546608|ref|YP_001266710.1| D-isomer specific 2-hydroxyacid dehydrogenase [Pseudomonas putida
           F1]
 gi|148510666|gb|ABQ77526.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pseudomonas putida F1]
          Length = 324

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ + K+++V R G G DNVD   A+  G+ V NTP  N  +  EH  +L+L++ R++P
Sbjct: 56  MIAASPKLRIVARHGAGYDNVDYKAAADHGVWVTNTPGANQRSVIEHVFALLLSLCRKLP 115

Query: 61  VANESTHKGKW--EKFNFMGVE 80
           +A+E T    W  ++ +  G+E
Sbjct: 116 LASEQTRNRVWAEDRLSLTGIE 137


>gi|298345760|ref|YP_003718447.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 43063]
 gi|304390540|ref|ZP_07372493.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           subsp. curtisii ATCC 35241]
 gi|298235821|gb|ADI66953.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 43063]
 gi|304326296|gb|EFL93541.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           subsp. curtisii ATCC 35241]
          Length = 324

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++V+ R G+G D VDL  A   G++V NTP  NS   AE A+S M  +AR + 
Sbjct: 69  VLNQLPDLRVISRYGVGVDRVDLRTAGDNGVIVTNTPGANSTAVAEMALSSMFTLARHVS 128

Query: 61  VANESTHKGKW 71
             NE+T +G+W
Sbjct: 129 QLNETTRRGQW 139


>gi|317508269|ref|ZP_07965949.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
 gi|316253444|gb|EFV12834.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
          Length = 523

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 57/79 (72%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+    +K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP 
Sbjct: 55  LAAGSNLKIVARAGVGLDNVDVQAATANGVLVVNAPTSNIHSAAEHAIALLLAAARQIPP 114

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN +T  G+W++ +++GVE
Sbjct: 115 ANATTQAGEWKRSSYLGVE 133


>gi|91083881|ref|XP_967558.1| PREDICTED: similar to AGAP008849-PA isoform 1 [Tribolium castaneum]
 gi|270006715|gb|EFA03163.1| hypothetical protein TcasGA2_TC013082 [Tribolium castaneum]
          Length = 329

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KV+GRAG G DN+DL  A+   I+V+NTP GN+I+  E   +L+  +AR + 
Sbjct: 60  VIAAGKNLKVIGRAGAGVDNIDLNAATAKNILVLNTPGGNAISACELTCALITNLARNVT 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G+W++  + G E
Sbjct: 120 PAAASLKAGRWDRKLYAGHE 139


>gi|254362642|ref|ZP_04978731.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica PHL213]
 gi|261492884|ref|ZP_05989430.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496766|ref|ZP_05993141.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153094256|gb|EDN75127.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica PHL213]
 gi|261307605|gb|EEY08933.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311425|gb|EEY12582.1| phosphoglycerate dehydrogenase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 409

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ M+ + R++P
Sbjct: 69  VLAQAPKLIAIGCFCIGTNQVDLNAAKRRGIPVFNAPFSNTRSVAELVLAEMILLMRKVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 TANAEVHRGVWNK 141


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G W++  ++G E
Sbjct: 117 QAHGSMRSGAWDRKKYVGNE 136


>gi|326389295|ref|ZP_08210863.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994658|gb|EGD53082.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus JW
           200]
          Length = 320

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G W++   MG E
Sbjct: 126 AVDRIVKSGGWKR--IMGTE 143


>gi|167038801|ref|YP_001661786.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|256752326|ref|ZP_05493188.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913614|ref|ZP_07130931.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307723371|ref|YP_003903122.1| phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166853041|gb|ABY91450.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|256748813|gb|EEU61855.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890299|gb|EFK85444.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307580432|gb|ADN53831.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 320

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G W++   MG E
Sbjct: 126 AVDRIVKSGGWKR--IMGTE 143


>gi|289577424|ref|YP_003476051.1| phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
 gi|289527137|gb|ADD01489.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
          Length = 320

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G W++   MG E
Sbjct: 126 AVDRIVKSGGWKR--IMGTE 143


>gi|182418703|ref|ZP_02949976.1| D-3-phosphoglycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237669451|ref|ZP_04529432.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377397|gb|EDT74953.1| D-3-phosphoglycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237655034|gb|EEP52593.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 302

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+  RAG+G DN+D+   + AG+ V NTP  +S + AE A++ M A+AR + +AN +  
Sbjct: 66  LKLAIRAGVGIDNIDIPAGNEAGVTVKNTPAASSDSVAELALAHMFALARFVGIANVTMR 125

Query: 68  KGKWEKFNFMGVEAG 82
            G+W K  + G E G
Sbjct: 126 NGEWNKKKYQGTEIG 140


>gi|167038456|ref|YP_001666034.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116850|ref|YP_004187009.1| phosphoglycerate dehydrogenase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166857290|gb|ABY95698.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929941|gb|ADV80626.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 320

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G W++   MG E
Sbjct: 126 AVDRIVKSGGWKR--IMGTE 143


>gi|297543711|ref|YP_003676013.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841486|gb|ADH60002.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 320

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G W++   MG E
Sbjct: 126 AVDRIVKSGGWKR--IMGTE 143


>gi|152992147|ref|YP_001357868.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
 gi|151424008|dbj|BAF71511.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
          Length = 529

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  AKK+  + RAG+G DNVD+  +S+ GIVVMN P  N+I   E  ++ ML+  RQ P
Sbjct: 62  FLESAKKITAIVRAGVGVDNVDIPGSSKQGIVVMNVPTANTIAAVELTLAHMLSCVRQFP 121

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            A+ +    + W + ++ G E
Sbjct: 122 YAHNNLKLDRVWRRQDWYGTE 142


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD++  S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 62  FLNHAKKLKALVRAGVGVDNVDILECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 121

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 122 NAHNFLKIERKWEREKWYGIE 142


>gi|224372944|ref|YP_002607316.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
 gi|223588899|gb|ACM92635.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
          Length = 522

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LSHAKK+K V RAG+G DNVD+  AS+ G+++MN P  N++   E  ++ +L  AR   
Sbjct: 58  FLSHAKKLKAVVRAGVGVDNVDMEAASKKGVIIMNVPTANTLAAVELTMAHLLTAARSFT 117

Query: 61  VANESTHKG-KWEKFNFMGVE 80
            A  +  K  +W +  ++G+E
Sbjct: 118 NAVWNLKKEHEWNREKWLGIE 138


>gi|149180910|ref|ZP_01859412.1| hypothetical protein BSG1_00725 [Bacillus sp. SG-1]
 gi|148851429|gb|EDL65577.1| hypothetical protein BSG1_00725 [Bacillus sp. SG-1]
          Length = 322

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ R GIG DN+DL  AS  GI+V N PF N    AEH ++L+L+ +RQ+ 
Sbjct: 58  VIEKASKLKVIARHGIGVDNIDLEAASDRGILVTNAPFANVNAVAEHVLTLILSGSRQLI 117

Query: 61  VANESTHKGKWEKFN 75
             + +   G +E  N
Sbjct: 118 QVDSALRNGDFEVRN 132


>gi|170046341|ref|XP_001850727.1| d-3-phosphoglycerate dehydrogenase [Culex quinquefasciatus]
 gi|167869148|gb|EDS32531.1| d-3-phosphoglycerate dehydrogenase [Culex quinquefasciatus]
          Length = 332

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 48/76 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +K VGRAG G DN+D+  A+R  ++V+NTP GNSI+  E    L+ A+AR I  A  
Sbjct: 67  AGSLKAVGRAGAGVDNIDIQAATRNNVLVLNTPGGNSISACELTCFLIGALARPICPAAG 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGSE 142


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G W++  ++G E
Sbjct: 117 QAHGSMRAGAWDRKKYVGNE 136


>gi|322513331|ref|ZP_08066451.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus ureae ATCC
           25976]
 gi|322120885|gb|EFX92739.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus ureae ATCC
           25976]
          Length = 429

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK +  +G   IGT+ VDL  A R GI V N PF N+ + AE  ++ ++ + RQ+P
Sbjct: 88  VLAHAKNLVSIGCFCIGTNQVDLNEAKRLGIPVFNAPFSNTRSVAELVLAEIILLMRQVP 147

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 148 KANAEVHRGVWNK 160


>gi|126460346|ref|YP_001056624.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum calidifontis JCM
           11548]
 gi|126250067|gb|ABO09158.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum calidifontis JCM
           11548]
          Length = 306

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +K++ R G+G DNVD+  A + GI V+N P   + + AE  I LM A+AR+IP
Sbjct: 57  VIDAGRNLKILARYGVGLDNVDVEYAVKRGISVVNAPNAPARSVAELTIGLMFAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + +     G+W K  ++G+E
Sbjct: 117 LLSTKVKAGEWPKGKYVGIE 136


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 61/80 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAGDRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G W++  ++G E
Sbjct: 117 QAHASMRQGAWDRKKYVGNE 136


>gi|253690043|ref|YP_003019233.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756621|gb|ACT14697.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 410

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  ML + R IP AN 
Sbjct: 73  AEKLIAVGCFCIGTNQVDLSAATKRGIPVFNAPFSNTRSVAEMVIGEMLLMLRGIPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGIWHKLAVGSFEA 149


>gi|226355874|ref|YP_002785614.1| D-3-phosphoglycerate dehydrogenase [Deinococcus deserti VCD115]
 gi|226317864|gb|ACO45860.1| putative Phosphoglycerate dehydrogenase [Deinococcus deserti
           VCD115]
          Length = 544

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KV+GR G+G DN+DL  AS  G++V+N P  N+++ AE A+  ++A AR +  ++  T
Sbjct: 79  RLKVIGRGGVGVDNIDLEYASLRGLLVLNAPESNNVSAAELAVMHLMASARGLTRSDRKT 138

Query: 67  HKGKWEKFNFMGVE 80
             G+W++  ++G+E
Sbjct: 139 RAGEWDR-KYLGME 151


>gi|307265934|ref|ZP_07547482.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918998|gb|EFN49224.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 324

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+K++ R G G DNVD+  A+  GI+V N P  N+I+  EH I+L++ +A+Q+ 
Sbjct: 57  VIENAPKLKIISRTGAGVDNVDVEAATERGILVCNLPAVNNISVCEHTIALIMHLAKQLS 116

Query: 61  VANESTHKGKWEKFN 75
             +++   G W+  N
Sbjct: 117 FMDKAVRTGNWKARN 131


>gi|194861776|ref|XP_001969855.1| GG10320 [Drosophila erecta]
 gi|190661722|gb|EDV58914.1| GG10320 [Drosophila erecta]
          Length = 332

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +  A +S  
Sbjct: 70  LKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYAGTE 142


>gi|148379114|ref|YP_001253655.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           ATCC 3502]
 gi|148288598|emb|CAL82679.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           A str. ATCC 3502]
          Length = 314

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A    + V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKEVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYKGTE 138


>gi|315657746|ref|ZP_07910626.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
 gi|315491543|gb|EFU81154.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           subsp. holmesii ATCC 35242]
          Length = 324

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++V+ R G+G D VDL  A   G++V NTP  NS   AE A+S M  +AR + 
Sbjct: 69  VLNQLPDLRVISRYGVGVDRVDLRTAGDNGVIVTNTPGANSTAVAEMALSSMFILARHVS 128

Query: 61  VANESTHKGKW 71
             NE+T +G+W
Sbjct: 129 QLNETTRQGQW 139


>gi|254515795|ref|ZP_05127855.1| chain A, D-3-Phosphoglycerate Dehydrogenase [gamma proteobacterium
           NOR5-3]
 gi|219675517|gb|EED31883.1| chain A, D-3-Phosphoglycerate Dehydrogenase [gamma proteobacterium
           NOR5-3]
          Length = 409

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+  +G   IGT+ VDL  A+R GIVV N PF N+ + AE  I+  + + R +P
Sbjct: 69  ILAAAPKLIAIGCFCIGTNQVDLDAATRRGIVVFNAPFSNTRSVAELVIAEAILLLRGLP 128

Query: 61  VANESTHKGKWEK 73
             N + H+G+W+K
Sbjct: 129 AKNAAAHRGEWQK 141


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++V+GRAG+G DN+DL  A+  GIVV+N   GN++  AEH  +L+LA+ R++ 
Sbjct: 67  LIAAAPRLRVIGRAGVGVDNIDLDAATERGIVVVNVADGNTVAVAEHVFALLLALVRRLL 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+WE+  ++G E
Sbjct: 127 PASASLREGRWERSRWVGEE 146


>gi|332191510|gb|AEE29631.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 651

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +  A+ S 
Sbjct: 145 RLKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASI 204

Query: 67  HKG 69
             G
Sbjct: 205 KAG 207


>gi|88706366|ref|ZP_01104071.1| D-3-phosphoglycerate dehydrogenase [Congregibacter litoralis KT71]
 gi|88699302|gb|EAQ96416.1| D-3-phosphoglycerate dehydrogenase [Congregibacter litoralis KT71]
          Length = 409

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+  +G   IGT+ VDL  A+R GIVV N PF N+ + AE  I+  + + R +P
Sbjct: 69  ILDAAPKLIAIGCFCIGTNQVDLEAATRRGIVVFNAPFSNTRSVAELVIAEAILLLRGLP 128

Query: 61  VANESTHKGKWEK 73
             N + H+G+W+K
Sbjct: 129 AKNAAAHRGEWQK 141


>gi|322834199|ref|YP_004214226.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Rahnella sp. Y9602]
 gi|321169400|gb|ADW75099.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Rahnella sp. Y9602]
          Length = 412

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+R GI V N PF N+ + AE  +  ML + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATRRGIPVFNAPFSNTRSVAEMVLGEMLLMMRGIPEANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGVWNKLAVGSFEA 149


>gi|317121881|ref|YP_004101884.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermaerobacter marianensis DSM 12885]
 gi|315591861|gb|ADU51157.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermaerobacter marianensis DSM 12885]
          Length = 371

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VVGR G G DNVD   ASR G+ V+  P GN+   AE  ++ MLA+AR++P
Sbjct: 99  LLAAAPRLRVVGRLGAGLDNVDGEAASRRGVTVVYAPGGNARAVAEFVLAQMLALARRLP 158

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A      G W +   +G E
Sbjct: 159 EAAAMGASGTWLRQALLGDE 178


>gi|270264940|ref|ZP_06193204.1| hypothetical protein SOD_j01560 [Serratia odorifera 4Rx13]
 gi|270041238|gb|EFA14338.1| hypothetical protein SOD_j01560 [Serratia odorifera 4Rx13]
          Length = 412

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGIPVFNAPFSNTRSVAEMVLGELLLMLRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W+K      EA
Sbjct: 133 KAHRGEWQKLAVGSFEA 149


>gi|328769391|gb|EGF79435.1| hypothetical protein BATDEDRAFT_89518 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 433

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+  +G   IGT+ VDL  A+  GI V N+PF NS + AE AI+ ++A++RQ+ 
Sbjct: 89  VLKEAKKLMAIGCFCIGTNQVDLEYAASHGITVFNSPFSNSRSVAEMAIAEIIALSRQLG 148

Query: 61  VANESTHKGKWEK 73
             N   H G W K
Sbjct: 149 DRNTELHNGVWNK 161


>gi|149193714|ref|ZP_01870812.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
 gi|149135667|gb|EDM24145.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
          Length = 522

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LSHAKK+K + RAG+G DNVD+   S+ GIVVMN P  N++   E  ++ +L  AR   
Sbjct: 58  FLSHAKKLKAIVRAGVGVDNVDIEACSKRGIVVMNIPTANTLAAVELTMAHLLTAARSFT 117

Query: 61  VANESTHKG-KWEKFNFMGVE 80
            A  +  K  +W +  ++G+E
Sbjct: 118 NAVWNLKKEHEWNREKWLGIE 138


>gi|301165854|emb|CBW25427.1| putative D-3-phosphoglycerate dehydrogenase [Bacteriovorax marinus
           SJ]
          Length = 315

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A  +K V RAG GTDN+D       G+ V NTP  N+ + AEHA++LM+ + R+   
Sbjct: 61  LDLAPNLKYVIRAGAGTDNIDKASCQEVGVRVSNTPGANNNSAAEHAVALMMTVLRKTAW 120

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ +   G W+K  F G E
Sbjct: 121 AHSTMKSGGWDKSKFTGNE 139


>gi|153932143|ref|YP_001383494.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           ATCC 19397]
 gi|153935586|ref|YP_001387043.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           Hall]
 gi|152928187|gb|ABS33687.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A str. ATCC 19397]
 gi|152931500|gb|ABS36999.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A str. Hall]
          Length = 314

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 45/73 (61%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+V RAG+G DNVDL  A    + V NTP  +S++ AE  +  ML I+R I  AN +  
Sbjct: 66  LKLVVRAGVGLDNVDLEYAKEKEVKVFNTPKASSVSVAELTLGHMLCISRFINTANVTML 125

Query: 68  KGKWEKFNFMGVE 80
           +GKWEK  + G E
Sbjct: 126 QGKWEKKKYNGTE 138


>gi|121533554|ref|ZP_01665382.1| Phosphoglycerate dehydrogenase [Thermosinus carboxydivorans Nor1]
 gi|121308113|gb|EAX49027.1| Phosphoglycerate dehydrogenase [Thermosinus carboxydivorans Nor1]
          Length = 326

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++ + G+G DN+DL  A   GI V NTP GN+ + AE  + +++ + R+I 
Sbjct: 60  LIQKAPKLKMIQKTGVGVDNIDLAAAKTLGIPVANTPGGNATSVAELTLGMIINLYRKIN 119

Query: 61  VANESTHKGKWEKFNF 76
           + +  T KG W  + F
Sbjct: 120 ILDRETKKGNWMSWEF 135


>gi|160879610|ref|YP_001558578.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium phytofermentans ISDg]
 gi|160428276|gb|ABX41839.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium phytofermentans ISDg]
          Length = 316

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 46/73 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  +KV+GR G+G DN+D+  A+  GI V  TP  N+ + AEH I L+LA A+ I +A++
Sbjct: 62  APHLKVIGRHGVGYDNIDIAEATAQGIKVCYTPLANANSVAEHTIMLLLACAKNIVIADK 121

Query: 65  STHKGKWEKFNFM 77
              +G +E  N M
Sbjct: 122 ELRQGNYEIRNQM 134


>gi|330432255|gb|AEC17314.1| D-3-phosphoglycerate dehydrogenase [Gallibacterium anatis UMN179]
          Length = 412

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  +G   IGT+ VDL  A + GI V N PF N+ + AE  +  ML + R +P
Sbjct: 70  VLQHAHKLIAIGCFCIGTNQVDLEAAKQRGIPVFNAPFSNTRSVAELVLGEMLLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 KANFEVHRGVWNK 142


>gi|302338646|ref|YP_003803852.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
 gi|301635831|gb|ADK81258.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
          Length = 295

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  AKK+K++ R G+G DN+D   A   GI+V NTP  +SI  AE A +LM+ I  +I  
Sbjct: 49  IDQAKKLKLIIRGGVGIDNIDKTYAESKGIIVRNTPKASSIAVAELAFALMIQIPNRIIE 108

Query: 62  ANESTHKGKWEK 73
           A+    +GKW K
Sbjct: 109 AHNGMQEGKWLK 120


>gi|91217850|ref|ZP_01254805.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
 gi|91184051|gb|EAS70439.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
          Length = 388

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 47/73 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+  +G   IGT+ VDL  A++AG+ V N PF N+ + AE  I+  + + R+IP
Sbjct: 71  VITKAKKLVAIGCFCIGTNQVDLEAANKAGVCVFNAPFSNTRSVAELVIASAIMLIRKIP 130

Query: 61  VANESTHKGKWEK 73
             N + H G+W+K
Sbjct: 131 DKNRAAHAGEWDK 143


>gi|283833163|ref|ZP_06352904.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291070794|gb|EFE08903.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 316

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+V + G+G DN+DL      GI V N P  N    A+ A SL+L  ARQ+P
Sbjct: 61  LLAAAPNLKIVCKHGVGVDNIDLNATREKGIYVTNVPDANKHAVADFAFSLILNCARQLP 120

Query: 61  VANESTHKGKWEK 73
            A E T  G+W +
Sbjct: 121 QAIEQTRAGRWPR 133


>gi|56199498|gb|AAV84238.1| phosphoglycerate dehydrogenase [Culicoides sonorensis]
          Length = 331

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 48/76 (63%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A K+K VGRAG G DN+++  A++  +VV+N P GNSI+  E    L+ ++AR +  A E
Sbjct: 66  AGKLKAVGRAGAGVDNINVDAATKNNVVVLNAPGGNSISACELTCLLIASLARPVCPAAE 125

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G W++  + G E
Sbjct: 126 SMKRGAWDRKLYAGSE 141


>gi|256372302|ref|YP_003110126.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008886|gb|ACU54453.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 527

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + VVGRAGIG DNVD+  A++ G++V+N P  N ++ AEH ++L+LA+AR +P
Sbjct: 58  VLEAAHHLVVVGRAGIGLDNVDVETATKRGVMVVNAPQSNIVSAAEHTLALLLALARHVP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +G+W +  F GVE
Sbjct: 118 QAHASVQRGEWRRSAFQGVE 137


>gi|217968155|ref|YP_002353661.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dictyoglomus turgidum DSM 6724]
 gi|217337254|gb|ACK43047.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dictyoglomus turgidum DSM 6724]
          Length = 318

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 47/74 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+ + G+G DN+DL  + R  IVV NTP  NS   AE  + L++ + R+I 
Sbjct: 66  VLKNANKLKVISKYGVGVDNIDLEESKRRNIVVTNTPGVNSNAVAELTVGLIINVLRKIN 125

Query: 61  VANESTHKGKWEKF 74
           ++++ T  G W +F
Sbjct: 126 LSDKKTRGGNWNRF 139


>gi|189190002|ref|XP_001931340.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972946|gb|EDU40445.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 483

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 131 VLDEAKNLHVIGCFCIGTNQVDLQTAASKGIAVFNSPFSNSRSVAELVISEIIALARQLA 190

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 191 DRSMELHNGTWNK 203


>gi|310766517|gb|ADP11467.1| D-3-phosphoglycerate dehydrogenase [Erwinia sp. Ejp617]
          Length = 412

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLMLRGVPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGQWHKLAVGSYEA 149


>gi|292487120|ref|YP_003529990.1| D-3-phosphoglycerate dehydrogenase [Erwinia amylovora CFBP1430]
 gi|292900496|ref|YP_003539865.1| D-3-phosphoglycerate dehydrogenase [Erwinia amylovora ATCC 49946]
 gi|291200344|emb|CBJ47472.1| D-3-phosphoglycerate dehydrogenase [Erwinia amylovora ATCC 49946]
 gi|291552537|emb|CBA19582.1| D-3-phosphoglycerate dehydrogenase [Erwinia amylovora CFBP1430]
 gi|312171225|emb|CBX79484.1| D-3-phosphoglycerate dehydrogenase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 412

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLMLRGVPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGQWHKLAVGSYEA 149


>gi|259909575|ref|YP_002649931.1| D-3-phosphoglycerate dehydrogenase [Erwinia pyrifoliae Ep1/96]
 gi|224965197|emb|CAX56729.1| D-3-phosphoglycerate dehydrogenase [Erwinia pyrifoliae Ep1/96]
 gi|283479654|emb|CAY75570.1| D-3-phosphoglycerate dehydrogenase [Erwinia pyrifoliae DSM 12163]
          Length = 412

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLMLRGVPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGQWHKLAVGSYEA 149


>gi|269140292|ref|YP_003296993.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Edwardsiella tarda EIB202]
 gi|267985953|gb|ACY85782.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Edwardsiella tarda EIB202]
 gi|304560118|gb|ADM42782.1| D-3-phosphoglycerate dehydrogenase [Edwardsiella tarda FL6-60]
          Length = 412

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M + A+K+  VG   IGT+ VDL  A R G+ V N PF N+ + AE  +   L + R IP
Sbjct: 69  MFAAAEKLVAVGCFCIGTNQVDLAAAQRRGVPVFNAPFSNTRSVAEMVLGETLLLLRNIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 129 QANACAHRGEWSK 141


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMTHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|295111247|emb|CBL27997.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Synergistetes bacterium SGP1]
          Length = 318

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 45/71 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + H+ ++KV+GR G+G D VD+  AS  GI V+ TP  N+ + AEHA+++M A+++ +  
Sbjct: 44  IEHSPRLKVIGRTGVGYDTVDVKKASERGIPVVLTPGANNRSVAEHAVAMMFALSKNLVE 103

Query: 62  ANESTHKGKWE 72
           A      G WE
Sbjct: 104 AQNEMCAGNWE 114


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKTLVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 54  FLNHAKKLKALVRAGVGVDNVDISECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 113

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 114 NAHNFLKIERKWEREKWYGIE 134


>gi|9955396|dbj|BAB12215.1| d-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa]
          Length = 337

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 48/67 (71%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK++KV+  +G GTD++D++ A+  G++V+N P  ++ + AEH +S++LA+A+++P  + 
Sbjct: 76  AKQLKVISTSGFGTDSIDIMAATEQGVIVVNNPGMSTTSVAEHTLSMILALAKKLPFLDH 135

Query: 65  STHKGKW 71
              KG +
Sbjct: 136 CVKKGNY 142


>gi|90412059|ref|ZP_01220066.1| phosphoglycerate dehydrogenase [Photobacterium profundum 3TCK]
 gi|90327037|gb|EAS43416.1| phosphoglycerate dehydrogenase [Photobacterium profundum 3TCK]
          Length = 409

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + AKK+  VG   IGT+ VDL  AS+ GI V N PF N+ + AE  +  +L + R IP
Sbjct: 69  VFNAAKKLNAVGCFCIGTNQVDLTAASKRGIPVFNAPFSNTRSVAELVLGEILLLVRGIP 128

Query: 61  VANESTHKGKWEK 73
             N   H+G+W+K
Sbjct: 129 EKNAKAHRGEWQK 141


>gi|157372157|ref|YP_001480146.1| D-3-phosphoglycerate dehydrogenase [Serratia proteamaculans 568]
 gi|157323921|gb|ABV43018.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Serratia
           proteamaculans 568]
          Length = 412

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMLRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W+K      EA
Sbjct: 133 KAHRGEWQKLAVGSFEA 149


>gi|58392734|ref|XP_319591.2| AGAP008849-PA [Anopheles gambiae str. PEST]
 gi|55235140|gb|EAA14798.3| AGAP008849-PA [Anopheles gambiae str. PEST]
          Length = 332

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 49/76 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++K VGRAG G DN+++  A+R  ++V+NTP GNSI+  E    L+ A+AR I  A  
Sbjct: 67  AGRVKAVGRAGAGVDNINIEAATRNNVLVLNTPGGNSISACELTCFLIGALARPICPAAT 126

Query: 65  STHKGKWEKFNFMGVE 80
           S  +G+W++  + G E
Sbjct: 127 SMKEGRWDRKLYSGSE 142


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 22  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 81

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 82  NAHNFLKIERKWEREKWYGIE 102


>gi|312221081|emb|CBY01022.1| similar to D-3-phosphoglycerate dehydrogenase [Leptosphaeria
           maculans]
          Length = 486

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 134 VLEEAKNLIVIGCFCIGTNQVDLQTAAQMGIAVFNSPFSNSRSVAELVISEVIALARQLT 193

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 194 DRSMELHNGTWNK 206


>gi|260913238|ref|ZP_05919720.1| D-3-phosphoglycerate dehydrogenase [Pasteurella dagmatis ATCC
           43325]
 gi|260632825|gb|EEX50994.1| D-3-phosphoglycerate dehydrogenase [Pasteurella dagmatis ATCC
           43325]
          Length = 410

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA+K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  VLAHAQKLIAVGCFCIGTNQVDLNAAKLLGIPVFNAPFSNTRSVAELVLGEILVLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGIWNK 142


>gi|237748642|ref|ZP_04579122.1| dehydrogenase [Oxalobacter formigenes OXCC13]
 gi|229380004|gb|EEO30095.1| dehydrogenase [Oxalobacter formigenes OXCC13]
          Length = 322

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K+V R G G DNVDL  A+R G+ V N P   +   A HA+++MLAI R+I  ANE  
Sbjct: 68  ELKMVVRYGDGVDNVDLEAATRHGVQVCNVPDYGTSEVANHALAMMLAITRKICQANEQV 127

Query: 67  HKGKW 71
            +G+W
Sbjct: 128 REGRW 132


>gi|300854348|ref|YP_003779332.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
 gi|300434463|gb|ADK14230.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
          Length = 307

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAKK+KV+ + G+GTDN+DL  A    I +  T   NS   A++A +LM+++AR+I 
Sbjct: 64  VLKHAKKLKVISKYGVGTDNIDLNYAKNNNITITITKGANSDAVADYAFALMISVARKIV 123

Query: 61  VANESTHKGKWEKFNFMGV 79
             +    K  W K   +G+
Sbjct: 124 TIDRGCRKLDWSKVTSIGM 142


>gi|167855374|ref|ZP_02478141.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parasuis 29755]
 gi|167853522|gb|EDS24769.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parasuis 29755]
          Length = 410

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+  +G   IGT+ VDL  A R GI V N PF N+ + AE  +  ++ + RQ+P
Sbjct: 70  VLQQAQKLVAIGCYCIGTNQVDLDAAKRRGIPVFNAPFSNTRSVAELVLGEIIVLMRQVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 KANAEVHRGIWNK 142


>gi|32265634|ref|NP_859666.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
 gi|32261682|gb|AAP76732.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
          Length = 526

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ + +++ V RAG+G DNVD+   SR GIVVMN P  N+I   E  ++ ++   R  P
Sbjct: 60  FLASSGQIRAVVRAGVGVDNVDIEGCSRKGIVVMNVPTANTIAAVELTMAHLINAVRNFP 119

Query: 61  VAN-ESTHKGKWEKFNFMGVE 80
            AN +  H+ KW++ ++ G+E
Sbjct: 120 GANTQLKHERKWKREDWYGIE 140


>gi|323704543|ref|ZP_08116121.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536005|gb|EGB25778.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 320

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DNVDL  A R G+VV NTP  N  + A+  I LML +AR +   +   
Sbjct: 72  KLKIISRYGVGYDNVDLDAAKRKGVVVTNTPNTNDNSVADLTIGLMLVLARNLLAVDRIV 131

Query: 67  HKGKWEKFNFMGVE 80
             G+W++   MG E
Sbjct: 132 KGGEWKR--IMGTE 143


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            ++HAK MK + RAG+G DNVD+   S+ GI+VMN P  N+I   E  ++ ML+  R  P
Sbjct: 61  FIAHAKNMKAIVRAGVGVDNVDIAGCSKEGIIVMNVPTANTIAAVELTMAHMLSCMRMFP 120

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            ++      + W++  + G E
Sbjct: 121 YSHNHLKLDRVWKREKWYGYE 141


>gi|330944251|ref|XP_003306339.1| hypothetical protein PTT_19469 [Pyrenophora teres f. teres 0-1]
 gi|311316189|gb|EFQ85572.1| hypothetical protein PTT_19469 [Pyrenophora teres f. teres 0-1]
          Length = 520

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 131 VLEEAKNLIVIGCFCIGTNQVDLQTAASQGIAVFNSPFSNSRSVAELVISEIIALARQLA 190

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 191 DRSMELHNGTWNK 203


>gi|295109434|emb|CBL23387.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Ruminococcus obeum A2-162]
          Length = 330

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 6/88 (6%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GR G+G D+VD+  A+  GI V+ TP  N+   AEH+++LMLA+++ + 
Sbjct: 58  VMEAAPQLKVIGRTGVGYDSVDVDAATELGIPVVITPGANNRAVAEHSLTLMLALSKNLV 117

Query: 61  VANESTHKGKW------EKFNFMGVEAG 82
            A     KG W      ++F   G +AG
Sbjct: 118 EAQVEASKGNWAIRDAHKQFELYGKKAG 145


>gi|219871235|ref|YP_002475610.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parasuis SH0165]
 gi|219691439|gb|ACL32662.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parasuis SH0165]
          Length = 410

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+  +G   IGT+ VDL  A R GI V N PF N+ + AE  +  ++ + RQ+P
Sbjct: 70  VLQQAQKLVAIGCYCIGTNQVDLDAAKRRGIPVFNAPFSNTRSVAELVLGEIIVLMRQVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 KANAEVHRGIWNK 142


>gi|217076470|ref|YP_002334186.1| D-3-phosphoglycerate dehydrogenase [Thermosipho africanus TCF52B]
 gi|217036323|gb|ACJ74845.1| D-3-phosphoglycerate dehydrogenase [Thermosipho africanus TCF52B]
          Length = 303

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAG G DNVD+  A   GI V+NTP  N I+ AE AI LM++ AR I 
Sbjct: 56  IIEAGKNLKIIARAGTGLDNVDVEKAKEKGIKVINTPGANGISVAELAIGLMISCARHIA 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
                   G+W K    G E
Sbjct: 116 KGTIDLKNGEWTKKQLKGHE 135


>gi|302186083|ref|ZP_07262756.1| putative hydroxyacid dehydrogenase [Pseudomonas syringae pv.
           syringae 642]
          Length = 325

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPKLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 122 WLDARTRQGHWDKATANGIE 141


>gi|317484972|ref|ZP_07943856.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
 gi|316923777|gb|EFV44979.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
          Length = 323

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++ + G G D +D+    R GI++ NTP  NS+  AEH  +L+L   R +P
Sbjct: 67  LLEKLPNLKLIAKLGTGLDMIDIPSVLRRGILLCNTPGANSVAVAEHTFALLLGYLRNVP 126

Query: 61  VANESTHKGKWEKFNFMGVE 80
             + +   G+WEK   MG E
Sbjct: 127 QCDNAVRTGQWEKARTMGGE 146


>gi|171692767|ref|XP_001911308.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946332|emb|CAP73133.1| unnamed protein product [Podospora anserina S mat+]
          Length = 468

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 116 VLQEAKNLLVIGCFCIGTNQVDLDYAAKQGIAVFNSPFANSRSVAELVIAEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 176 DRSNELHRGTWNK 188


>gi|27413666|gb|AAO11839.1| phosphoglycerate dehydrogenase [Bacillus coagulans]
          Length = 314

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K + + G G DN+D   A   GI V NTP  N+   A+ AI LMLA AR IP
Sbjct: 63  IIDAAPNLKYIMKFGAGYDNIDFKYAREKGIPVTNTPGQNADAVADLAIGLMLATARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
             NE    G WE    MG+E
Sbjct: 123 AKNEELRNGNWEL--SMGIE 140


>gi|23099741|ref|NP_693207.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22777971|dbj|BAC14242.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 314

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K + + G G DN+D   A   GI V NTP  N+   A+ AI LMLA AR IP
Sbjct: 63  IIDAAPNLKYIMKFGAGYDNIDFKYAREKGIPVTNTPGQNADAVADLAIGLMLATARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
             NE    G WE    MG+E
Sbjct: 123 AKNEELRNGNWEL--SMGIE 140


>gi|303319347|ref|XP_003069673.1| D-3-phosphoglycerate dehydrogenase 1 , putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240109359|gb|EER27528.1| D-3-phosphoglycerate dehydrogenase 1 , putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320040888|gb|EFW22821.1| D-3-phosphoglycerate dehydrogenase [Coccidioides posadasii str.
           Silveira]
          Length = 480

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++A+ARQ+ 
Sbjct: 128 VLSEAKNLIVIGCFCIGTNQVDLQFAADHGIAVFNSPFSNSRSVAELVIGEIIALARQLC 187

Query: 61  VANESTHKGKWEK 73
             +   H G W+K
Sbjct: 188 DRSAEMHSGMWQK 200


>gi|238899106|ref|YP_002924788.1| D-3-phosphoglycerate dehydrogenase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466866|gb|ACQ68640.1| D-3-phosphoglycerate dehydrogenase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 413

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT++VDL  A++ GI + N PF N+ + AE A+  +  I R IP
Sbjct: 69  IFASAEKLISVGCFCIGTNHVDLNAAAKKGIPIFNAPFSNTRSVAEMALGELFIILRGIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 129 AANAKAHRGEWYK 141


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LS AK +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ MLA AR  P
Sbjct: 59  FLSAAKNLKALVRAGVGVDNVDMDGCSKRGIIAMNVPTANTIAAVELTMAHMLAAARSFP 118

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            A+      + W++  + GVE
Sbjct: 119 YAHNDLKIDRIWKREKWYGVE 139


>gi|315654350|ref|ZP_07907258.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           ATCC 51333]
 gi|315491385|gb|EFU81002.1| D-isomer specific 2-hydroxyacid dehydrogenase [Mobiluncus curtisii
           ATCC 51333]
          Length = 324

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 42/71 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++V+ R G+G D VDL  A    ++V NTP  NS   AE A+S M  +AR + 
Sbjct: 69  VLNQLPDLRVISRYGVGVDRVDLRTAGENRVIVTNTPGANSTAVAEMALSCMFTLARHVS 128

Query: 61  VANESTHKGKW 71
             NE+T +G+W
Sbjct: 129 QLNETTRQGQW 139


>gi|238787343|ref|ZP_04631142.1| D-3-phosphoglycerate dehydrogenase [Yersinia frederiksenii ATCC
           33641]
 gi|238724605|gb|EEQ16246.1| D-3-phosphoglycerate dehydrogenase [Yersinia frederiksenii ATCC
           33641]
          Length = 413

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLAAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|296413016|ref|XP_002836214.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630023|emb|CAZ80405.1| unnamed protein product [Tuber melanosporum]
          Length = 472

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGTD VDL  A++ GI V N+PF NS + AE  I+ ++ +AR+I 
Sbjct: 111 VLDHAKNLLAIGCFCIGTDQVDLEYAAKRGIAVFNSPFSNSRSVAELVIAEVIMLARRIG 170

Query: 61  VANESTHKGKWEK 73
             +   H G W+K
Sbjct: 171 DKSMEMHLGTWQK 183


>gi|166366606|ref|YP_001658879.1| McyI protein [Microcystis aeruginosa NIES-843]
 gi|166088979|dbj|BAG03687.1| McyI protein [Microcystis aeruginosa NIES-843]
          Length = 337

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 47/67 (70%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK++KV+  +G GTD++D++ A+  G++V+N P  ++   AEH +S++LA+A+++P  + 
Sbjct: 76  AKQLKVISTSGFGTDSIDIMAATEQGVIVVNNPGMSTTAVAEHTLSMILALAKKLPFLDH 135

Query: 65  STHKGKW 71
              KG +
Sbjct: 136 CVKKGNY 142


>gi|146420175|ref|XP_001486045.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 464

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 111 VLQHAKNLVVIGCFCIGTNQVDLEFAAKSGIAVFNSPFSNSRSVAELVIAEIITLARQLG 170

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 171 DRSIELHTGTWNK 183


>gi|320588939|gb|EFX01407.1| d-3-phosphoglycerate dehydrogenase [Grosmannia clavigera kw1407]
          Length = 482

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + VVG   IGT+ VDL  A+R GI V N+PF NS + AE  I  ++ +ARQ+ 
Sbjct: 129 VLREAKHLLVVGCFCIGTNQVDLDYAARNGIAVFNSPFANSRSVAELMIGWIIILARQLS 188

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 189 DRSSEMHRGTWNK 201


>gi|325918208|ref|ZP_08180356.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535581|gb|EGD07429.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 417

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 75  VLAHAKRLMAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 134

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 135 QKNAECHRGGWSK 147


>gi|254568944|ref|XP_002491582.1| 3-phosphoglycerate dehydrogenase, catalyzes the first step in
           serine and glycine biosynthesis [Pichia pastoris GS115]
 gi|238031379|emb|CAY69302.1| 3-phosphoglycerate dehydrogenase, catalyzes the first step in
           serine and glycine biosynthesis [Pichia pastoris GS115]
 gi|328351912|emb|CCA38311.1| D-3-phosphoglycerate dehydrogenase [Pichia pastoris CBS 7435]
          Length = 469

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + ++G   IGT+ VDL  A+++G+ V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 117 VLKHAKNLIIIGCFCIGTNQVDLEYAAKSGVAVFNSPFSNSRSVAELVIAEIITLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSLEMHTGTWNK 189


>gi|295394378|ref|ZP_06804602.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972730|gb|EFG48581.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 527

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNV++  A+RAG++V+N P  N I+ AE  ++ +L  AR    
Sbjct: 59  IAAAPELKVIARAGVGLDNVEIPAATRAGVMVVNAPTSNIISAAELTMAHILGSARNYGA 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
            + S   G+W +    GVE
Sbjct: 119 GHASLKAGEWNRSKLSGVE 137


>gi|290985750|ref|XP_002675588.1| D-3-phosphoglycerate dehydrogenase [Naegleria gruberi]
 gi|284089185|gb|EFC42844.1| D-3-phosphoglycerate dehydrogenase [Naegleria gruberi]
          Length = 405

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS+AKK+K VG   IGTD VDL    + GI V N+P+ N+ + AE A+S ++ ++R++ 
Sbjct: 66  VLSNAKKLKAVGCYCIGTDQVDLECCEKKGIPVFNSPYANTRSVAELAMSEIVMLSRKVS 125

Query: 61  VANESTHKGKWEK 73
              +S H+G W K
Sbjct: 126 EHVKSLHQGHWYK 138


>gi|190345691|gb|EDK37618.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 464

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 111 VLQHAKNLVVIGCFCIGTNQVDLEFAAKSGIAVFNSPFSNSRSVAELVIAEIITLARQLG 170

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 171 DRSIELHTGTWNK 183


>gi|307244429|ref|ZP_07526539.1| 4-phosphoerythronate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
 gi|306492186|gb|EFM64229.1| 4-phosphoerythronate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
          Length = 305

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++ R G+G DN+D+  A   GI+V NTP  ++   AE  +  ML +AR + +AN   
Sbjct: 66  RLKLIIRGGVGLDNIDVDYAETKGIMVRNTPGASTNAVAELVLCEMLVLARNVKIANIKL 125

Query: 67  HKGKWEKFNFMGVE 80
           + GKW+K N  G E
Sbjct: 126 NNGKWDKKNLKGSE 139


>gi|21231273|ref|NP_637190.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|188991507|ref|YP_001903517.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112925|gb|AAM41114.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|167733267|emb|CAP51465.1| phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris]
          Length = 413

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLEAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|66768675|ref|YP_243437.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|66574007|gb|AAY49417.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 413

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLEAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|52425798|ref|YP_088935.1| D-3-phosphoglycerate dehydrogenase [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307850|gb|AAU38350.1| SerA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 410

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  +G   IGT+ V L  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  ILEHANKLIAIGCFCIGTNQVALEAAEEKGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 130 AANAQVHRGEWNK 142


>gi|237745829|ref|ZP_04576309.1| dehydrogenase [Oxalobacter formigenes HOxBLS]
 gi|229377180|gb|EEO27271.1| dehydrogenase [Oxalobacter formigenes HOxBLS]
          Length = 322

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K++ R G G DNVDL  A+R G+ V N P   +   A HA++LMLAI R+I  AN+  
Sbjct: 68  RLKMIVRYGDGVDNVDLEAATRHGVQVCNVPDYGTSEVANHALALMLAITRKICQANDQV 127

Query: 67  HKGKW 71
             G+W
Sbjct: 128 RAGRW 132


>gi|227114285|ref|ZP_03827941.1| D-3-phosphoglycerate dehydrogenase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 410

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  ML + R IP AN 
Sbjct: 73  AEKLIAVGCFCIGTNQVELSAATKRGIPVFNAPFSNTRSVAEMVIGEMLLMLRGIPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGIWHKLAVGSFEA 149


>gi|289663405|ref|ZP_06484986.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 413

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|50122826|ref|YP_051993.1| D-3-phosphoglycerate dehydrogenase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49613352|emb|CAG76803.1| D-3-phosphoglycerate dehydrogenase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 410

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  ML + R IP AN 
Sbjct: 73  AEKLIAVGCFCIGTNQVELSAATKRGIPVFNAPFSNTRSVAEMVIGEMLLMLRGIPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGIWHKLAVGSFEA 149


>gi|325925157|ref|ZP_08186570.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas perforans 91-118]
 gi|325544411|gb|EGD15781.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas perforans 91-118]
          Length = 413

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|294624574|ref|ZP_06703249.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601109|gb|EFF45171.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 413

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|291165895|gb|EFE27942.1| D-3-phosphoglycerate dehydrogenase [Filifactor alocis ATCC 35896]
          Length = 303

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+    K+K +G AGIG +++D   A   GI V N   G+  + AE A++LML + R++ 
Sbjct: 56  MIDAGVKLKAIGMAGIGLNHIDTKYAEEKGIKVFNVKDGSIDSVAELALTLMLTVMRKVN 115

Query: 61  VANESTHKGKWEKFNFMG 78
            AN +  +GKW+K  F G
Sbjct: 116 PANNAVKQGKWDKMGFTG 133


>gi|150019735|ref|YP_001311989.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Clostridium beijerinckii NCIMB 8052]
 gi|149906200|gb|ABR37033.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Clostridium beijerinckii NCIMB 8052]
          Length = 302

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K+  RAG+G DN+D+  A   G+ V NTP  +S + AE AI  M A+AR I ++N +  
Sbjct: 66  LKLAIRAGVGIDNIDIPAAQGKGVTVRNTPSASSDSVAELAIGHMFALARFIAISNYTMR 125

Query: 68  KGKWEKFNFMGVE 80
            G+W K  + G E
Sbjct: 126 NGEWNKKKYEGTE 138


>gi|330836006|ref|YP_004410647.1| Phosphoglycerate dehydrogenase [Spirochaeta coccoides DSM 17374]
 gi|329747909|gb|AEC01265.1| Phosphoglycerate dehydrogenase [Spirochaeta coccoides DSM 17374]
          Length = 319

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KV+ R G+G D VDL    +  I V  TP  NS + A+ A+SLML++AR IP
Sbjct: 68  LLAKATKLKVLSRYGVGYDAVDLEATRKQNIAVTITPGANSDSVADMAVSLMLSVARNIP 127

Query: 61  VANESTHKG 69
           + + +T  G
Sbjct: 128 IMDSTTRNG 136


>gi|320583160|gb|EFW97376.1| 3-phosphoglycerate dehydrogenase [Pichia angusta DL-1]
          Length = 469

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A+ AGI V N+PF NS + AE  I  ++A++RQ+ 
Sbjct: 117 VLKHAKNLLVIGCFCIGTNQVDLEYAAEAGIAVFNSPFSNSRSVAELVICEIIALSRQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSMELHNGVWNK 189


>gi|145605701|ref|XP_001406386.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
 gi|145013505|gb|EDJ98146.1| conserved hypothetical protein [Magnaporthe oryzae 70-15]
          Length = 421

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + VVG   IGT+ VDL  A+R GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 120 VLREAKNLLVVGCFCIGTNQVDLEYAARHGIAVFNSPFANSRSVAELVIAEIITLARQLG 179

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 180 DRSNEMHRGTWNK 192


>gi|330901374|gb|EGH32793.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 325

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 122 WLDARTRQGHWDKATANGIE 141


>gi|284047458|ref|YP_003397797.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acidaminococcus fermentans DSM 20731]
 gi|283951679|gb|ADB46482.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acidaminococcus fermentans DSM 20731]
          Length = 319

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 39/68 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
            K +K++ R GIG +N+DL       + V      N+ + AEHAISLMLA  RQIP  N+
Sbjct: 61  GKNLKIIARYGIGYENIDLAACDAKNVTVTLARGCNTYSVAEHAISLMLACFRQIPQLNQ 120

Query: 65  STHKGKWE 72
              KG W+
Sbjct: 121 EVRKGNWK 128


>gi|16119626|ref|NP_396332.1| putative phosphoglycerate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
 gi|15162196|gb|AAK90773.1| putative phosphoglycerate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
          Length = 317

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 43/70 (61%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++K + R G+G DN+D+  A R GI V N P GN+   AE  + L+L+  R+IP  ++
Sbjct: 69  APRLKAIARFGVGVDNIDIDAAHRHGIAVTNAPGGNANAVAELTLGLILSAMRRIPYLHD 128

Query: 65  STHKGKWEKF 74
           +   G W++F
Sbjct: 129 ALRGGAWDRF 138


>gi|167470320|ref|ZP_02335024.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis FV-1]
          Length = 266

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSFEA 149


>gi|22127177|ref|NP_670600.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis KIM 10]
 gi|45443345|ref|NP_994884.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|21960241|gb|AAM86851.1|AE013931_4 D-3-phosphoglycerate dehydrogenase [Yersinia pestis KIM 10]
 gi|45438214|gb|AAS63761.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 447

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 107 AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 166

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 167 KAHRGEWNKLAVGSFEA 183


>gi|6007548|gb|AAF00955.1|AF183408_3 McyI [Microcystis aeruginosa PCC 7806]
 gi|159029574|emb|CAO90233.1| mcyI [Microcystis aeruginosa PCC 7806]
          Length = 337

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 46/67 (68%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK +KV+  +G GTD++D++ A+  G++V+N P  ++   AEH +S++LA+A+++P  + 
Sbjct: 76  AKHLKVISTSGFGTDSIDIMAATEQGVIVVNNPGMSTTAVAEHTLSMILALAKKLPFLDH 135

Query: 65  STHKGKW 71
              KG +
Sbjct: 136 CVKKGNY 142


>gi|319787403|ref|YP_004146878.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465915|gb|ADV27647.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  ++  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLEAAELAGIPVFNAPYSNTRSVAELVVAQAVMLMRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|238754582|ref|ZP_04615936.1| D-3-phosphoglycerate dehydrogenase [Yersinia ruckeri ATCC 29473]
 gi|238707213|gb|EEP99576.1| D-3-phosphoglycerate dehydrogenase [Yersinia ruckeri ATCC 29473]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  +  +L + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLKAAAKRGIPVFNAPFSNTRSVAEMVLGELLLMFRGIP 128

Query: 61  VANESTHKGKWEKF 74
            AN   H+G+W K 
Sbjct: 129 SANAKAHRGEWNKL 142


>gi|238763236|ref|ZP_04624201.1| D-3-phosphoglycerate dehydrogenase [Yersinia kristensenii ATCC
           33638]
 gi|238698509|gb|EEP91261.1| D-3-phosphoglycerate dehydrogenase [Yersinia kristensenii ATCC
           33638]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|319778776|ref|YP_004129689.1| D-3-phosphoglycerate dehydrogenase [Taylorella equigenitalis MCE9]
 gi|317108800|gb|ADU91546.1| D-3-phosphoglycerate dehydrogenase [Taylorella equigenitalis MCE9]
          Length = 409

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 48/73 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A+K+  +G   IGT+ V+L  A++ GI V N PF N+ + AE  ++ M+ + R++P
Sbjct: 69  VLSKAQKLIGIGCFCIGTNQVNLEAATKRGIAVFNAPFSNTRSVAELVLAEMILLMRKVP 128

Query: 61  VANESTHKGKWEK 73
            A+   H+G+W+K
Sbjct: 129 QASTQVHRGEWKK 141


>gi|119182670|ref|XP_001242457.1| hypothetical protein CIMG_06353 [Coccidioides immitis RS]
          Length = 470

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++A+ARQ+ 
Sbjct: 118 VLSEARNLIVIGCFCIGTNQVDLQFAADHGIAVFNSPFSNSRSVAELVIGEIIALARQLC 177

Query: 61  VANESTHKGKWEK 73
             +   H G W+K
Sbjct: 178 DRSAEMHSGMWQK 190


>gi|238798642|ref|ZP_04642117.1| D-3-phosphoglycerate dehydrogenase [Yersinia mollaretii ATCC 43969]
 gi|238717528|gb|EEQ09369.1| D-3-phosphoglycerate dehydrogenase [Yersinia mollaretii ATCC 43969]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|332160385|ref|YP_004296962.1| D-3-phosphoglycerate dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664615|gb|ADZ41259.1| D-3-phosphoglycerate dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|122879159|ref|YP_200782.6| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|166711919|ref|ZP_02243126.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188576681|ref|YP_001913610.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576872|ref|YP_001913801.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521133|gb|ACD59078.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521324|gb|ACD59269.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAEVAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|238752294|ref|ZP_04613773.1| D-3-phosphoglycerate dehydrogenase [Yersinia rohdei ATCC 43380]
 gi|238709455|gb|EEQ01694.1| D-3-phosphoglycerate dehydrogenase [Yersinia rohdei ATCC 43380]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|153956400|ref|YP_001397165.1| phosphoglycerate dehydrogenase [Clostridium kluyveri DSM 555]
 gi|219856713|ref|YP_002473835.1| hypothetical protein CKR_3370 [Clostridium kluyveri NBRC 12016]
 gi|146349258|gb|EDK35794.1| Predicted phosphoglycerate dehydrogenase [Clostridium kluyveri DSM
           555]
 gi|219570437|dbj|BAH08421.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 310

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 47/74 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GIVV NTP  ++ + AE  ++ M AI+R + ++N + 
Sbjct: 65  KLKLIIRGGVGVDNIDVDYALQNGIVVKNTPNASAASVAELTLAHMFAISRYVNISNVTM 124

Query: 67  HKGKWEKFNFMGVE 80
              +W K  + GVE
Sbjct: 125 RNNEWHKSQYKGVE 138


>gi|123443596|ref|YP_001007569.1| D-3-phosphoglycerate dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090557|emb|CAL13426.1| D-3-phosphoglycerate dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604380|emb|CBY25878.1| D-3-phosphoglycerate dehydrogenase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|322699752|gb|EFY91511.1| D-3-phosphoglycerate dehydrogenase 1 [Metarhizium acridum CQMa 102]
          Length = 433

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+R GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 117 VLREAKNLLVIGCFCIGTNQVDLEYAARHGIAVFNSPFANSRSVAELVIAEIITLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 177 DRSSEMHRGTWNK 189


>gi|317493811|ref|ZP_07952228.1| D-isomer specific 2-hydroxyacid dehydrogenase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316918138|gb|EFV39480.1| D-isomer specific 2-hydroxyacid dehydrogenase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 412

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDLV A++ GI V N PF N+ + AE  +  +L + R IP
Sbjct: 69  IFAAAEKLIAVGCFCIGTNQVDLVAAAKRGIPVFNAPFSNTRSVAEMVLGELLLLLRGIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 129 TANACAHRGEWNK 141


>gi|84623669|ref|YP_451041.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84367609|dbj|BAE68767.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 386

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 44  VLAHAKRLIAVGCFCIGTNQVDLDAAEVAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 103

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 104 QKNAECHRGGWSK 116


>gi|326391225|ref|ZP_08212768.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992729|gb|EGD51178.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 324

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A  +K++ R G G DN+D+  A+  GI+V N P  N+++ AEH I+++L +A+Q+ 
Sbjct: 57  VIENAPHLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNNLSVAEHTIAMILNLAKQLS 116

Query: 61  VANESTHKGKWEKFN 75
           + +++   G W   N
Sbjct: 117 LMDKAVRSGNWGARN 131


>gi|239636548|ref|ZP_04677550.1| glyoxylate reductase [Staphylococcus warneri L37603]
 gi|239597903|gb|EEQ80398.1| glyoxylate reductase [Staphylococcus warneri L37603]
          Length = 320

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L++A  +KV+    +G DN+D+ +A + GI+V NTP   + TTAE A +LMLA AR+I  
Sbjct: 62  LANAPHLKVIANMAVGYDNIDVNIAKQKGIIVTNTPEVLTETTAELAFTLMLATARRIVE 121

Query: 62  ANESTHKGKWEKF 74
           A +    G+W+ +
Sbjct: 122 AEKYVQDGQWKSW 134


>gi|156837641|ref|XP_001642841.1| hypothetical protein Kpol_387p9 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113415|gb|EDO14983.1| hypothetical protein Kpol_387p9 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 470

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + VVG   IGT+ VDL  A+  G+ V N+PF NS + AE  I+ ++ +ARQI 
Sbjct: 117 ILKHAKNLVVVGCFCIGTNQVDLKYAASMGVSVFNSPFSNSRSVAELVIAEIIVLARQIG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSIELHTGTWNK 189


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ ++  AR   
Sbjct: 60  FLKHAKKLKALVRAGVGVDNVDIPNCSKQGVIVMNVPTANTIAAVELTMAHLITSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ ++  AR   
Sbjct: 60  FLKHAKKLKALVRAGVGVDNVDIPNCSKQGVIVMNVPTANTIAAVELTMAHLITSARSFV 119

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N    + KWE+  + G+E
Sbjct: 120 NAHNFLKIERKWEREKWYGIE 140


>gi|261823109|ref|YP_003261215.1| D-3-phosphoglycerate dehydrogenase [Pectobacterium wasabiae WPP163]
 gi|261607122|gb|ACX89608.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pectobacterium wasabiae WPP163]
          Length = 410

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  ML + R IP AN 
Sbjct: 73  AEKLIAVGCFCIGTNQVELSAATKRGIPVFNAPFSNTRSVAEMVIGEMLLMLRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGIWHKLAVGSFEA 149


>gi|51597499|ref|YP_071690.1| D-3-phosphoglycerate dehydrogenase [Yersinia pseudotuberculosis IP
           32953]
 gi|108806350|ref|YP_650266.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Antiqua]
 gi|108813273|ref|YP_649040.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Nepal516]
 gi|145597906|ref|YP_001161982.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Pestoides F]
 gi|149367076|ref|ZP_01889109.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis CA88-4125]
 gi|153949738|ref|YP_001399840.1| D-3-phosphoglycerate dehydrogenase [Yersinia pseudotuberculosis IP
           31758]
 gi|162418470|ref|YP_001608132.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Angola]
 gi|165925145|ref|ZP_02220977.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937338|ref|ZP_02225902.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010298|ref|ZP_02231196.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212868|ref|ZP_02238903.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399894|ref|ZP_02305412.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419033|ref|ZP_02310786.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425272|ref|ZP_02317025.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|170023108|ref|YP_001719613.1| D-3-phosphoglycerate dehydrogenase [Yersinia pseudotuberculosis
           YPIII]
 gi|186896621|ref|YP_001873733.1| D-3-phosphoglycerate dehydrogenase [Yersinia pseudotuberculosis
           PB1/+]
 gi|218928087|ref|YP_002345962.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis CO92]
 gi|229837603|ref|ZP_04457765.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Pestoides A]
 gi|229840827|ref|ZP_04460986.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842613|ref|ZP_04462768.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903731|ref|ZP_04518844.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Nepal516]
 gi|270487513|ref|ZP_06204587.1| phosphoglycerate dehydrogenase [Yersinia pestis KIM D27]
 gi|294502920|ref|YP_003566982.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Z176003]
 gi|51590781|emb|CAH22427.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776921|gb|ABG19440.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Nepal516]
 gi|108778263|gb|ABG12321.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Antiqua]
 gi|115346698|emb|CAL19581.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis CO92]
 gi|145209602|gb|ABP39009.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Pestoides F]
 gi|149290690|gb|EDM40766.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis CA88-4125]
 gi|152961233|gb|ABS48694.1| phosphoglycerate dehydrogenase [Yersinia pseudotuberculosis IP
           31758]
 gi|162351285|gb|ABX85233.1| phosphoglycerate dehydrogenase [Yersinia pestis Angola]
 gi|165914812|gb|EDR33425.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923345|gb|EDR40496.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990784|gb|EDR43085.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206160|gb|EDR50640.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963027|gb|EDR59048.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167050602|gb|EDR62010.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055672|gb|EDR65456.1| phosphoglycerate dehydrogenase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169749642|gb|ACA67160.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Yersinia
           pseudotuberculosis YPIII]
 gi|186699647|gb|ACC90276.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679501|gb|EEO75604.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Nepal516]
 gi|229690923|gb|EEO82977.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697193|gb|EEO87240.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704291|gb|EEO91302.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Pestoides A]
 gi|262360955|gb|ACY57676.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis D106004]
 gi|262364895|gb|ACY61452.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis D182038]
 gi|270336017|gb|EFA46794.1| phosphoglycerate dehydrogenase [Yersinia pestis KIM D27]
 gi|294353379|gb|ADE63720.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis Z176003]
 gi|320014006|gb|ADV97577.1| D-3-phosphoglycerate dehydrogenase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSFEA 149


>gi|329297003|ref|ZP_08254339.1| D-3-phosphoglycerate dehydrogenase [Plautia stali symbiont]
          Length = 412

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  I  ML + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLSAAAKRGVPVFNAPFSNTRSVAELVIGEMLLMLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGIWNKIATGSYEA 149


>gi|322706036|gb|EFY97618.1| D-3-phosphoglycerate dehydrogenase 1 [Metarhizium anisopliae ARSEF
           23]
          Length = 429

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+R GI V N+PF NS + AE  ++ ++ +ARQ+ 
Sbjct: 76  VLREAKNLLVIGCFCIGTNQVDLEYAARHGIAVFNSPFANSRSVAELVVAEIITLARQLG 135

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 136 DRSSEMHRGTWNK 148


>gi|289741575|gb|ADD19535.1| D-3-phosphoglycerate dehydrogenase [Glossina morsitans morsitans]
          Length = 332

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 47/73 (64%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K +GRAG G DN+D+  A++  ++V+NTP GNSI+  E    L+  +AR +  A +S  
Sbjct: 70  LKAIGRAGAGVDNIDVAAATKNNVIVLNTPGGNSISACELTCILIGNLARPVVHAAQSMK 129

Query: 68  KGKWEKFNFMGVE 80
           +G+W++  + G E
Sbjct: 130 EGRWDRKLYTGNE 142


>gi|302910587|ref|XP_003050320.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731257|gb|EEU44607.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 470

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+R GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 118 VLREAKNLLVIGCFCIGTNQVDLDYAARNGIAVFNSPFANSRSVAELVIAEIITLARQLG 177

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 178 DRSNEMHRGTWNK 190


>gi|238759302|ref|ZP_04620468.1| D-3-phosphoglycerate dehydrogenase [Yersinia aldovae ATCC 35236]
 gi|238702463|gb|EEP95014.1| D-3-phosphoglycerate dehydrogenase [Yersinia aldovae ATCC 35236]
          Length = 413

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLNAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|311106433|ref|YP_003979286.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain-containing protein 5 [Achromobacter xylosoxidans
           A8]
 gi|310761122|gb|ADP16571.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
           protein 5 [Achromobacter xylosoxidans A8]
          Length = 319

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 45/68 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+++    G+G +N+DL  A+  GIVV N P  N+++ A+HA++L+L  AR++P A+ S 
Sbjct: 73  KLEIACSLGVGHENIDLAAAAARGIVVTNGPGANAVSVADHAMALLLGAARRLPQADASV 132

Query: 67  HKGKWEKF 74
            +G W  F
Sbjct: 133 RQGHWSGF 140


>gi|238795127|ref|ZP_04638717.1| D-3-phosphoglycerate dehydrogenase [Yersinia intermedia ATCC 29909]
 gi|238725526|gb|EEQ17090.1| D-3-phosphoglycerate dehydrogenase [Yersinia intermedia ATCC 29909]
          Length = 413

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLNAATKRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|330981806|gb|EGH79909.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 272

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 122 WLDARTRQGHWDKATANGIE 141


>gi|330955157|gb|EGH55417.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae Cit 7]
          Length = 325

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 122 WLDARTRQGHWDKATANGIE 141


>gi|256832290|ref|YP_003161017.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Jonesia
           denitrificans DSM 20603]
 gi|256685821|gb|ACV08714.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Jonesia
           denitrificans DSM 20603]
          Length = 416

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ HA  +  +G   IGT+ +DL  A+  G+ V N PF N+ +  E AIS M+++ R++P
Sbjct: 71  VIDHAPDLIAIGAFCIGTNQIDLGAAAERGVGVFNAPFSNTRSVVEMAISEMISLTRRLP 130

Query: 61  VANESTHKGKWEK 73
             N++ H G W+K
Sbjct: 131 ERNKAMHDGVWDK 143


>gi|77459210|ref|YP_348717.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pseudomonas fluorescens Pf0-1]
 gi|77383213|gb|ABA74726.1| putative hydroxyacid dehydrogenase [Pseudomonas fluorescens Pf0-1]
          Length = 324

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ + K+++V R G G DNVD   A+  G+ V NTP  N  +  EH  +L+L I+R++ 
Sbjct: 56  MIAASPKLRIVARHGAGYDNVDYKAAAELGVWVTNTPGANRRSVVEHVFALLLGISRKVQ 115

Query: 61  VANESTHKGKW--EKFNFMGVE 80
           +A + T    W  ++ +  G+E
Sbjct: 116 LATDQTRNNIWAQDRLSLTGIE 137


>gi|304570495|ref|YP_001931.2| D-3-phosphoglycerate dehydrogenase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 407

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++  +G   IGT+ VDLV A + GI V N P+ N+ + AE  IS ++ +AR++P
Sbjct: 66  VLEKAKRLLTIGCFCIGTNQVDLVGAEKKGIPVFNAPYSNTRSVAELVISEIIMLARRVP 125

Query: 61  VANESTHKGKWEK 73
               +TH G W K
Sbjct: 126 DHIRNTHSGIWNK 138


>gi|119510507|ref|ZP_01629639.1| Predicted dehydrogenase [Nodularia spumigena CCY9414]
 gi|28976144|gb|AAO64409.1| NdaH [Nodularia spumigena]
 gi|119464850|gb|EAW45755.1| Predicted dehydrogenase [Nodularia spumigena CCY9414]
          Length = 341

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 45/67 (67%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KV+  +G GTD +D+ VA++ G+VV+N P  ++   AEH I ++LA+A+++   N+
Sbjct: 76  AKKLKVISTSGFGTDAIDISVATKHGVVVVNNPGLSTTAVAEHTICMILALAKKLTFLNQ 135

Query: 65  STHKGKW 71
               G +
Sbjct: 136 CVKTGNY 142


>gi|28199141|ref|NP_779455.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa Temecula1]
 gi|182681872|ref|YP_001830032.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa M23]
 gi|28057239|gb|AAO29104.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa Temecula1]
 gi|182631982|gb|ACB92758.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Xylella
           fastidiosa M23]
 gi|307578126|gb|ADN62095.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 413

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  +G   IGT+ VDL  A  +GI V N P+ N+ + AE  I+  + + R+IP
Sbjct: 71  VLGHAKRLMAIGCFCIGTNQVDLDTAELSGIPVFNAPYSNTRSVAELIIAEAILLLRRIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|71898445|ref|ZP_00680617.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Ann-1]
 gi|71731758|gb|EAO33817.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Ann-1]
          Length = 413

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  +G   IGT+ VDL  A  +GI V N P+ N+ + AE  I+  + + R+IP
Sbjct: 71  VLGHAKRLMAIGCFCIGTNQVDLDTAELSGIPVFNAPYSNTRSVAELIIAEAILLLRRIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|307595453|ref|YP_003901770.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
 gi|307550654|gb|ADN50719.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
          Length = 311

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++V+ RAG+G DN+D+  A   GI V+N P G++ + AE  I LM+A AR + 
Sbjct: 58  VIDAAGRLRVIARAGVGLDNIDVDYARLRGIEVINAPEGSTQSVAELTIGLMIAAARLVA 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + +     G+W K  ++G E
Sbjct: 118 LQDRLVKGGEWPKGKYVGSE 137


>gi|293394577|ref|ZP_06638871.1| D-3-phosphoglycerate dehydrogenase [Serratia odorifera DSM 4582]
 gi|291422886|gb|EFE96121.1| D-3-phosphoglycerate dehydrogenase [Serratia odorifera DSM 4582]
          Length = 412

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLQAATKRGIPVFNAPFSNTRSVAEMVLGELLLMLRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGVWNKLAVGSFEA 149


>gi|71274428|ref|ZP_00650716.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Dixon]
 gi|71900424|ref|ZP_00682556.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Ann-1]
 gi|71164160|gb|EAO13874.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Dixon]
 gi|71729789|gb|EAO31888.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Xylella
           fastidiosa Ann-1]
          Length = 413

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  +G   IGT+ VDL  A  +GI V N P+ N+ + AE  I+  + + R+IP
Sbjct: 71  VLGHAKRLMAIGCFCIGTNQVDLDTAELSGIPVFNAPYSNTRSVAELIIAEAILLLRKIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|149919344|ref|ZP_01907826.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Plesiocystis pacifica SIR-1]
 gi|149819844|gb|EDM79268.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Plesiocystis pacifica SIR-1]
          Length = 399

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+ + +V RAG G + +DL  ASR GI V N P  N+I  AE  + LMLA+ R+IP AN 
Sbjct: 59  AEGLALVIRAGAGVNTIDLEAASRLGIFVANCPGKNAIAVAELTMGLMLALDRRIPDANA 118

Query: 65  STHKGKWEKFNF 76
               G W K  +
Sbjct: 119 DLRAGVWNKKKY 130


>gi|45601085|gb|AAS70568.1| D-3-phosphoglycerate dehydrogenase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 384

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++  +G   IGT+ VDLV A + GI V N P+ N+ + AE  IS ++ +AR++P
Sbjct: 43  VLEKAKRLLTIGCFCIGTNQVDLVGAEKKGIPVFNAPYSNTRSVAELVISEIIMLARRVP 102

Query: 61  VANESTHKGKWEK 73
               +TH G W K
Sbjct: 103 DHIRNTHSGIWNK 115


>gi|24214611|ref|NP_712092.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Leptospira interrogans serovar Lai str. 56601]
 gi|24195584|gb|AAN49110.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Leptospira interrogans serovar Lai str. 56601]
          Length = 411

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++  +G   IGT+ VDLV A + GI V N P+ N+ + AE  IS ++ +AR++P
Sbjct: 70  VLEKAKRLLTIGCFCIGTNQVDLVGAEKKGIPVFNAPYSNTRSVAELVISEIIMLARRVP 129

Query: 61  VANESTHKGKWEK 73
               +TH G W K
Sbjct: 130 DHIRNTHSGIWNK 142


>gi|289759122|ref|ZP_06518500.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T85]
 gi|289714686|gb|EFD78698.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T85]
          Length = 193

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 40  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 99

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 100 AADASLREHTWKRSSFSGTE 119


>gi|300775321|ref|ZP_07085183.1| D-3-phosphoglycerate dehydrogenase [Chryseobacterium gleum ATCC
           35910]
 gi|300506061|gb|EFK37197.1| D-3-phosphoglycerate dehydrogenase [Chryseobacterium gleum ATCC
           35910]
          Length = 309

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L   K +K + R G G +N+D+ VA R GI ++N+P GN  + AEH + ++L I  ++ +
Sbjct: 58  LEKGKNLKFIARVGAGMENIDIPVAERLGIQLINSPEGNRDSVAEHVVGMLLVIMNRLFI 117

Query: 62  ANESTHKGKWEK 73
           A++    G W++
Sbjct: 118 ASQEVKNGIWKR 129


>gi|85059987|ref|YP_455689.1| D-3-phosphoglycerate dehydrogenase [Sodalis glossinidius str.
           'morsitans']
 gi|84780507|dbj|BAE75284.1| D-3-phosphoglycerate dehydrogenase [Sodalis glossinidius str.
           'morsitans']
          Length = 410

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A + G+ V N PF N+ + AE  +  ML + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLPAAMKRGVPVFNAPFSNTRSVAEMVLGEMLLMMRGIPEANA 132

Query: 65  STHKGKWEK 73
             H+G+W K
Sbjct: 133 RAHRGQWNK 141


>gi|329847730|ref|ZP_08262758.1| D-3-phosphoglycerate dehydrogenase [Asticcacaulis biprosthecum C19]
 gi|328842793|gb|EGF92362.1| D-3-phosphoglycerate dehydrogenase [Asticcacaulis biprosthecum C19]
          Length = 645

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  VG   IGT+ +DL   S+ GI V N P+ N+ +  E  + L++ + R IP
Sbjct: 305 VLEHADKLLAVGAFCIGTNQIDLKACSQKGIAVFNAPYSNTRSVVEMVLGLLVVLTRDIP 364

Query: 61  VANESTHKGKWEK 73
             + + H+G W K
Sbjct: 365 DKSAAMHQGVWNK 377


>gi|289674179|ref|ZP_06495069.1| putative hydroxyacid dehydrogenase [Pseudomonas syringae pv.
           syringae FF5]
          Length = 267

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 122 WLDARTRQGHWDKATANGIE 141


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 1/77 (1%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           +KK+K + RAG+G DNVD+   S  G+VVMN P  N+I   E  ++ +L+  R+ P A+ 
Sbjct: 68  SKKLKAIVRAGVGVDNVDIDACSYRGVVVMNVPTANTIAAVELTMTHLLSAIRRFPSAHT 127

Query: 65  STH-KGKWEKFNFMGVE 80
               + KW++ ++ G+E
Sbjct: 128 QLKVERKWKREDWYGIE 144


>gi|225575330|ref|ZP_03783940.1| hypothetical protein RUMHYD_03420 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037467|gb|EEG47713.1| hypothetical protein RUMHYD_03420 [Blautia hydrogenotrophica DSM
           10507]
          Length = 321

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ +KV+ R G G D +D+  AS+ G+ V NTP  N+    E A  L+L++ARQI 
Sbjct: 66  VLREAEDLKVISRYGTGYDRIDMAAASQYGVTVTNTPGVNAQAVGELAFGLLLSVARQIS 125

Query: 61  VANESTHKGKW 71
             + +T  G+W
Sbjct: 126 YLDRTTRSGEW 136


>gi|242242220|ref|ZP_04796665.1| glyoxylate reductase [Staphylococcus epidermidis W23144]
 gi|242234315|gb|EES36627.1| glyoxylate reductase [Staphylococcus epidermidis W23144]
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDITLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|170730527|ref|YP_001775960.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa M12]
 gi|167965320|gb|ACA12330.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa M12]
          Length = 413

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  +G   IGT+ VDL  A  +GI V N P+ N+ + AE  I+  + + R+IP
Sbjct: 71  VLGHAKRLMAIGCFCIGTNQVDLDTAELSGIPVFNAPYSNTRSVAELIIAEAIFLLRKIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|254437257|ref|ZP_05050751.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Octadecabacter antarcticus 307]
 gi|198252703|gb|EDY77017.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Octadecabacter antarcticus 307]
          Length = 343

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
           KK +V+ R G+G D VD+  A++ GI+V N     +   A+HAISL L +AR++P  + +
Sbjct: 77  KKCEVIARYGVGVDIVDVKTATQKGILVTNVQDYCTEEVADHAISLWLTLARKLPDYDRA 136

Query: 66  THKGKWE 72
           THKG W+
Sbjct: 137 THKGIWK 143


>gi|319401791|gb|EFV89999.1| glyoxylate reductase [Staphylococcus epidermidis FRI909]
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDITLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|116199269|ref|XP_001225446.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88179069|gb|EAQ86537.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 472

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + VVG   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 120 VLQEAKNLLVVGCFCIGTNQVDLDYAAKHGIAVFNSPFANSRSVAELVIAEIITLARQLG 179

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 180 DRSLEMHRGTWNK 192


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ AK +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ MLA AR  P
Sbjct: 59  FLNAAKNLKALVRAGVGVDNVDIDGCSKRGIIAMNVPTANTIAAVELTMAHMLAAARSFP 118

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            A+      + W++  + GVE
Sbjct: 119 YAHNDLKIDRIWKREKWYGVE 139


>gi|169612583|ref|XP_001799709.1| hypothetical protein SNOG_09415 [Phaeosphaeria nodorum SN15]
 gi|111062487|gb|EAT83607.1| hypothetical protein SNOG_09415 [Phaeosphaeria nodorum SN15]
          Length = 489

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 130 VLEEAKNLIVIGCFCIGTNQVDLQTAAQKGIAVFNSPFSNSRSVAELVIAEIIALARQLG 189

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 190 DRSNELHNGTWNK 202


>gi|57866453|ref|YP_188108.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus epidermidis RP62A]
 gi|57637111|gb|AAW53899.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus epidermidis RP62A]
          Length = 323

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDITLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|295657631|ref|XP_002789382.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
 gi|226283866|gb|EEH39432.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
          Length = 474

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 119 VLKEARNLIVIGCFCIGTNQVDLQYAATHGIAVFNSPFSNSRSVAELVISEIIALARQLC 178

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 179 DRSSEMHNGMWNK 191


>gi|254819120|ref|ZP_05224121.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium intracellulare
           ATCC 13950]
          Length = 528

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|50414769|ref|XP_457432.1| DEHA2B11000p [Debaryomyces hansenii CBS767]
 gi|49653097|emb|CAG85436.1| DEHA2B11000p [Debaryomyces hansenii]
          Length = 465

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 112 ILQHARNLVVIGCFCIGTNQVDLEYAAKSGISVFNSPFSNSRSVAELVIAEIITLARQLG 171

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 172 DRSIEMHTGTWNK 184


>gi|156838425|ref|XP_001642918.1| hypothetical protein Kpol_411p5 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113498|gb|EDO15060.1| hypothetical protein Kpol_411p5 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 469

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ + V+G   IGT+ VDL  A+  G+ V N+PF NS + AE  I  ++++ARQI 
Sbjct: 116 ILKHAENLSVIGCFCIGTNQVDLDYAANMGVAVFNSPFSNSRSVAELVIGEIISLARQIG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|311031760|ref|ZP_07709850.1| 2-hydroxyacid dehydrogenase [Bacillus sp. m3-13]
          Length = 321

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 46/75 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN+D++ AS  G+ V NTP   + TTA+   +LMLA AR+I 
Sbjct: 63  LLESAPNLKVVANLAVGYDNIDVMAASERGVTVCNTPDVLTETTADLTFALMLATARRIT 122

Query: 61  VANESTHKGKWEKFN 75
            + E   +G+W+ ++
Sbjct: 123 ESQEFVKEGRWQSWS 137


>gi|289613287|emb|CBI59881.1| unnamed protein product [Sordaria macrospora]
          Length = 466

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 114 VLREAKNLLVIGCFCIGTNQVDLDYAAQHGIAVFNSPFANSRSVAELVIAEIITLARQLG 173

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 174 DRSNEMHRGTWNK 186


>gi|126728443|ref|ZP_01744259.1| phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126711408|gb|EBA10458.1| phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 336

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+D+  A+  GI V+     N+++ AEHAI+L+L+ A++I 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDIQAAADRGIPVLVATGANAVSVAEHAIALLLSCAKRIL 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G+WEK  F G E
Sbjct: 122 PLDAGLRDGRWEKPGFAGRE 141


>gi|152998305|ref|YP_001343140.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           subunit [Marinomonas sp. MWYL1]
 gi|150839229|gb|ABR73205.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Marinomonas sp. MWYL1]
          Length = 409

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  +G   IGT+ VDL  AS  GIVV N P+ N+ + AE  +  ++ + R IP
Sbjct: 69  VLEHANKLAAIGCFCIGTNQVDLDAASEKGIVVFNAPYSNTRSVAELVLGQLILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N + H+G W K
Sbjct: 129 AKNAACHRGGWIK 141


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+  KK+K + RAG+G DNVD+   SR GI+ MN P  N+I   E  ++ MLA AR + 
Sbjct: 59  FLNAGKKLKAIVRAGVGVDNVDIDGCSRRGIIAMNVPTANTIAAVELTMAHMLAAARSLE 118

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            A+      + W++  + GVE
Sbjct: 119 YAHNDLKLNRIWKREKWYGVE 139


>gi|269837544|ref|YP_003319772.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
 gi|269786807|gb|ACZ38950.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
          Length = 316

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++ + R G   DN+D+  A+  GIVV+++P   +   AE  I L+LA+ R IP
Sbjct: 62  VIEAATALRGIARVGFAVDNIDIDAATERGIVVVHSPGARTYAVAEMTIGLILAVLRHIP 121

Query: 61  VANESTHKGKWEKFNFMG 78
            A+ S   G+WE+  F G
Sbjct: 122 AADRSVKAGRWERRAFRG 139


>gi|226294397|gb|EEH49817.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb18]
          Length = 486

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 119 VLKEARNLIVIGCFCIGTNQVDLQYAATHGIAVFNSPFSNSRSVAELVISEIIALARQLC 178

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 179 DRSSEMHNGMWNK 191


>gi|227115489|ref|ZP_03829145.1| glyoxylate reductase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 316

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA ++K+V + G+G DN+DL       I V N P  N    A+ A SL+L  ARQI 
Sbjct: 61  LLKHAPQLKIVCKHGVGVDNIDLDATKNRNIFVTNVPNANKHAVADFAFSLLLNCARQIS 120

Query: 61  VANESTHKGKWEK 73
            A + T  G W +
Sbjct: 121 QAEKQTRAGNWPR 133


>gi|317484262|ref|ZP_07943188.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
 gi|316924491|gb|EFV45651.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
          Length = 394

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     ++ V + G+G D +D+  A    I+V NTP  N +  AEH  +L+L + RQ+P
Sbjct: 139 LLDALPNLRCVAKLGVGLDMIDIPAAVARDIIVCNTPGANDVAVAEHTFALLLGLLRQVP 198

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     GKWE+   +G E
Sbjct: 199 RCDAGMRGGKWEQGAILGRE 218


>gi|85077261|ref|XP_955999.1| D-3-phosphoglycerate dehydrogenase 1 [Neurospora crassa OR74A]
 gi|28917038|gb|EAA26763.1| D-3-phosphoglycerate dehydrogenase 1 [Neurospora crassa OR74A]
          Length = 466

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 114 VLREAKNLLVIGCFCIGTNQVDLDYAAQHGIAVFNSPFANSRSVAELVIAEIITLARQLG 173

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 174 DRSNEMHRGTWNK 186


>gi|282875575|ref|ZP_06284446.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Staphylococcus epidermidis SK135]
 gi|281295602|gb|EFA88125.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Staphylococcus epidermidis SK135]
          Length = 198

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDISLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A K++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLDSASKLRAVVRAGVGVDNVDIEGSSKKGVVVMNVPTANTIAAVELTCAHILSAIRNFP 120

Query: 61  VANESTH-KGKWEKFNFMGVE 80
            AN     + KW++ ++ G E
Sbjct: 121 DANAQLKVERKWKREDWYGTE 141


>gi|188534927|ref|YP_001908724.1| D-3-phosphoglycerate dehydrogenase [Erwinia tasmaniensis Et1/99]
 gi|188029969|emb|CAO97853.1| D-3-phosphoglycerate dehydrogenase [Erwinia tasmaniensis Et1/99]
          Length = 412

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+  GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLGAAAIRGIPVFNAPFSNTRSVAELVIGELLLMLRGVPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGQWHKLAVGSYEA 149


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L   KK+K + RAG+G DNVD+   SR GI+ MN P  N+I   E  ++ MLA AR + 
Sbjct: 59  FLEAGKKLKAIVRAGVGVDNVDIDGCSRRGIIAMNVPTANTIAAVELTMAHMLAAARSLE 118

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            A+      + W++  + GVE
Sbjct: 119 YAHNDLKLDRIWKREKWYGVE 139


>gi|70733196|ref|YP_262969.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf-5]
 gi|68347495|gb|AAY95101.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf-5]
          Length = 409

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  IFDHAKKLVAVGCFCIGTNQVDLSAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|296171277|ref|ZP_06852681.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894245|gb|EFG74002.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 528

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHAWKRSSFNGTE 138


>gi|291618749|ref|YP_003521491.1| SerA [Pantoea ananatis LMG 20103]
 gi|291153779|gb|ADD78363.1| SerA [Pantoea ananatis LMG 20103]
 gi|327395082|dbj|BAK12504.1| D-3-phosphoglycerate dehydrogenase SerA [Pantoea ananatis AJ13355]
          Length = 412

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  ML + R +P
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGEMLLMLRGVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGIWNK 141


>gi|251788160|ref|YP_003002881.1| D-3-phosphoglycerate dehydrogenase [Dickeya zeae Ech1591]
 gi|247536781|gb|ACT05402.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Dickeya
           zeae Ech1591]
          Length = 410

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  +L + R IP+AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVELSAATKRGIPVFNAPFSNTRSVAEMVIGELLLLMRGIPMANA 132

Query: 65  STHKGKWEK 73
             H+G W K
Sbjct: 133 KAHRGIWHK 141


>gi|313672171|ref|YP_004050282.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938927|gb|ADR18119.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 316

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 3/83 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +AKK+K++    +G +N+D+V A   GIVV NTP   + TTAE A +LM+++AR++ 
Sbjct: 59  LIDNAKKLKIIVNYAVGFNNIDVVYAKEKGIVVCNTPHILTETTAELAFALMISVARRVV 118

Query: 61  VANESTHKGK---WEKFNFMGVE 80
            A+  T  G+   W    F+G +
Sbjct: 119 EADRFTRGGRFKGWTPNLFLGTD 141


>gi|317049396|ref|YP_004117044.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pantoea sp. At-9b]
 gi|316951013|gb|ADU70488.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pantoea sp. At-9b]
          Length = 412

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ G+ V N PF N+ + AE  I  ML + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLNAAAKRGVPVFNAPFSNTRSVAELVIGEMLLMLRGIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGIWNK 141


>gi|304396733|ref|ZP_07378613.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Pantoea
           sp. aB]
 gi|304355529|gb|EFM19896.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Pantoea
           sp. aB]
          Length = 412

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A+  GI V N PF N+ + AE  I  ML + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLQAAASRGIPVFNAPFSNTRSVAELVIGEMLLMLRGIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGIWNK 141


>gi|322379690|ref|ZP_08054003.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS5]
 gi|321147839|gb|EFX42426.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS5]
          Length = 228

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML  A  +K V RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ +L   R  P
Sbjct: 58  MLKEAHTLKAVVRAGVGVDNVDIQYCSQRGIVVMNVPTANTIAAVELTMAHLLNAVRCFP 117

Query: 61  VANESTH-KGKWEKFNFMGVE 80
            AN     K  W++ ++ G E
Sbjct: 118 GANAQLKLKRLWKREDWYGTE 138


>gi|291528221|emb|CBK93807.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Eubacterium rectale M104/1]
          Length = 329

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + ++ K+KV+GR G+G D+VD+  A+  GI V+ TP  N+ + AEHA++++ A+++ +  
Sbjct: 56  IENSPKLKVIGRTGVGYDSVDVKKATELGIPVVITPGANNRSVAEHAVAMIFALSKNLIE 115

Query: 62  ANESTHKGKWE 72
           A     KG WE
Sbjct: 116 AQNEMCKGNWE 126


>gi|238923585|ref|YP_002937101.1| phosphoglycerate dehydrogenase, putative [Eubacterium rectale ATCC
           33656]
 gi|238875260|gb|ACR74967.1| phosphoglycerate dehydrogenase, putative [Eubacterium rectale ATCC
           33656]
          Length = 329

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + ++ K+KV+GR G+G D+VD+  A+  GI V+ TP  N+ + AEHA++++ A+++ +  
Sbjct: 56  IENSPKLKVIGRTGVGYDSVDVKKATELGIPVVITPGANNRSVAEHAVAMIFALSKNLIE 115

Query: 62  ANESTHKGKWE 72
           A     KG WE
Sbjct: 116 AQNEMCKGNWE 126


>gi|308188016|ref|YP_003932147.1| D-3-phosphoglycerate dehydrogenase [Pantoea vagans C9-1]
 gi|308058526|gb|ADO10698.1| D-3-phosphoglycerate dehydrogenase [Pantoea vagans C9-1]
          Length = 412

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A+  GI V N PF N+ + AE  I  ML + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLQAAASRGIPVFNAPFSNTRSVAELVIGEMLLMLRGIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGIWNK 141


>gi|322379237|ref|ZP_08053628.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
 gi|321148377|gb|EFX42886.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
          Length = 524

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML  A  +K V RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ +L   R  P
Sbjct: 58  MLKEAHTLKAVVRAGVGVDNVDIQYCSQRGIVVMNVPTANTIAAVELTMAHLLNAVRCFP 117

Query: 61  VANESTH-KGKWEKFNFMGVE 80
            AN     K  W++ ++ G E
Sbjct: 118 GANAQLKLKRLWKREDWYGTE 138


>gi|271502126|ref|YP_003335152.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Dickeya dadantii Ech586]
 gi|270345681|gb|ACZ78446.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Dickeya dadantii Ech586]
          Length = 410

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVELSAATKRGIPVFNAPFSNTRSVAEMVIGELLLLLRGIPTANA 132

Query: 65  STHKGKWEK 73
             H+G W K
Sbjct: 133 KAHRGIWHK 141


>gi|145224813|ref|YP_001135491.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315445143|ref|YP_004078022.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
 gi|145217299|gb|ABP46703.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315263446|gb|ADU00188.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
          Length = 528

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++  F G E
Sbjct: 119 AADATLREHTWKRSAFSGTE 138


>gi|313113802|ref|ZP_07799372.1| 4-phosphoerythronate dehydrogenase [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623876|gb|EFQ07261.1| 4-phosphoerythronate dehydrogenase [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 328

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + ++  +KV+GR G+G D+VD+  A+  GI V+ TP  N+ + AEHA+++M A+++ +  
Sbjct: 60  IENSPNLKVIGRTGVGYDSVDVKKATELGIPVVITPGANNRSVAEHAVAMMFALSKNLYE 119

Query: 62  ANESTHKGKWE 72
               T KG WE
Sbjct: 120 GQVETKKGNWE 130


>gi|311695445|gb|ADP98318.1| D-3-phosphoglycerate dehydrogenase-like protein [marine bacterium
           HP15]
          Length = 409

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+  VG   IGT+ VDL  A+R GI V N PF N+ + AE  ++  + + R +P  N 
Sbjct: 73  AKKLVAVGCFCIGTNQVDLQAATRRGIAVFNAPFSNTRSVAELVLAQAILLLRGVPEKNA 132

Query: 65  STHKGKWEK 73
             H+G+W K
Sbjct: 133 KAHRGEWLK 141


>gi|300718224|ref|YP_003743027.1| D-3-phosphoglycerate dehydrogenase [Erwinia billingiae Eb661]
 gi|299064060|emb|CAX61180.1| D-3-phosphoglycerate dehydrogenase [Erwinia billingiae Eb661]
          Length = 411

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  I  +L + R +P
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLTAAGSRGIPVFNAPFSNTRSVAELVIGELLLMLRGVP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 AANAKAHRGIWNKLAVGSFEA 149


>gi|254580095|ref|XP_002496033.1| ZYRO0C08932p [Zygosaccharomyces rouxii]
 gi|238938924|emb|CAR27100.1| ZYRO0C08932p [Zygosaccharomyces rouxii]
          Length = 469

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGT+ VDL  A+ AGI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 116 VLKHAKNLVSIGCFCIGTNQVDLKYATHAGIAVFNSPFSNSRSVAELIIGEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGAWNK 188


>gi|332142377|ref|YP_004428115.1| D-3-phosphoglycerate dehydrogenase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552399|gb|AEA99117.1| D-3-phosphoglycerate dehydrogenase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 409

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  +G   IGT+ VDL    R GI V N PF N+ + AE  +  ++ + RQ+P  N 
Sbjct: 73  AQKLVAIGCFCIGTNQVDLEATQRRGIPVFNAPFSNTRSVAELVLGQIILLLRQVPSKNA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+WEK      EA
Sbjct: 133 KAHRGEWEKTAVGSYEA 149


>gi|77461608|ref|YP_351115.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf0-1]
 gi|77385611|gb|ABA77124.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf0-1]
          Length = 409

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  IFDHAKKLVAVGCFCIGTNQVDLEAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|327311266|ref|YP_004338163.1| D-3-phosphoglycerate dehydrogenase [Thermoproteus uzoniensis
           768-20]
 gi|326947745|gb|AEA12851.1| D-3-phosphoglycerate dehydrogenase (serA) [Thermoproteus uzoniensis
           768-20]
          Length = 305

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K+V R G+G DN+ +  A + GI V+N P   + + AE  + LM+A+AR+IP
Sbjct: 57  VIDRGARLKIVARYGVGLDNIAVDYAIKRGIAVINAPNAPTRSAAELTLGLMIALARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + +     G W K  ++G E
Sbjct: 117 ILDREVKAGGWPKGKYVGRE 136


>gi|329726806|gb|EGG63266.1| glyoxylate reductase [Staphylococcus epidermidis VCU144]
          Length = 323

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDISLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|293368306|ref|ZP_06614934.1| 2-ketogluconate 6-phosphate reductase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291317553|gb|EFE57971.1| 2-ketogluconate 6-phosphate reductase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737569|gb|EGG73815.1| glyoxylate reductase [Staphylococcus epidermidis VCU045]
          Length = 323

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDISLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|239995914|ref|ZP_04716438.1| D-3-phosphoglycerate dehydrogenase [Alteromonas macleodii ATCC
           27126]
          Length = 409

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  +G   IGT+ VDL    R GI V N PF N+ + AE  +  ++ + RQ+P  N 
Sbjct: 73  AQKLVAIGCFCIGTNQVDLEATQRRGIPVFNAPFSNTRSVAELVLGQIILLLRQVPSKNA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+WEK      EA
Sbjct: 133 KAHRGEWEKTAVGSYEA 149


>gi|238503392|ref|XP_002382929.1| D-3-phosphoglycerate dehydrogenase [Aspergillus flavus NRRL3357]
 gi|220690400|gb|EED46749.1| D-3-phosphoglycerate dehydrogenase [Aspergillus flavus NRRL3357]
          Length = 493

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + VVG   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 112 ILKEARNLIVVGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 171

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 172 DRSNEMHNGTWNK 184


>gi|114561744|ref|YP_749257.1| D-3-phosphoglycerate dehydrogenase [Shewanella frigidimarina NCIMB
           400]
 gi|114333037|gb|ABI70419.1| D-3-phosphoglycerate dehydrogenase [Shewanella frigidimarina NCIMB
           400]
          Length = 409

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+K+  +G   IGT+ VDL  A + GI V N PF N+ + AE  I  ++ + R IP
Sbjct: 69  VLHHAEKLVAIGCFCIGTNQVDLASAEKLGIPVFNAPFSNTRSVAELVIGEIIMLMRGIP 128

Query: 61  VANESTHKGKWEK 73
             N  +H+G W K
Sbjct: 129 QRNAMSHRGGWLK 141


>gi|325108946|ref|YP_004270014.1| phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM 5305]
 gi|324969214|gb|ADY59992.1| Phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM 5305]
          Length = 326

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++V+ R G+G D +DL   +   +VV  TP  N    AEHAI+L++ +AR  P
Sbjct: 62  VLDALPQLRVIARTGVGFDAIDLAACAERNVVVTTTPGVNHHAVAEHAIALLMGVARGFP 121

Query: 61  VANESTHKGKWEKFN 75
             +    +G W++FN
Sbjct: 122 DRDRLVREGNWQRFN 136


>gi|27467540|ref|NP_764177.1| glycerate dehydrogenase [Staphylococcus epidermidis ATCC 12228]
 gi|27315084|gb|AAO04219.1|AE016746_9 glycerate dehydrogenase [Staphylococcus epidermidis ATCC 12228]
 gi|329736759|gb|EGG73024.1| glyoxylate reductase [Staphylococcus epidermidis VCU028]
          Length = 323

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDISLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|254784624|ref|YP_003072052.1| D-3-phosphoglycerate dehydrogenase [Teredinibacter turnerae T7901]
 gi|237686760|gb|ACR14024.1| D-3-phosphoglycerate dehydrogenase [Teredinibacter turnerae T7901]
          Length = 411

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ HA K+   G   IGT+ VDL  A   G+ V N PF N+ + AE  I+  + + R IP
Sbjct: 71  VIEHAPKLVAAGCFCIGTNQVDLDAAQEHGVAVFNAPFSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G+W+K
Sbjct: 131 AKNAGCHRGEWDK 143


>gi|260944620|ref|XP_002616608.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238850257|gb|EEQ39721.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 464

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 111 ILRHARNLVAIGCFCIGTNQVDLEFAAKSGISVFNSPFSNSRSVAELVIAEIITLARQLG 170

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 171 DRSIEMHTGTWNK 183


>gi|251810303|ref|ZP_04824776.1| glyoxylate reductase [Staphylococcus epidermidis BCM-HMP0060]
 gi|251806185|gb|EES58842.1| glyoxylate reductase [Staphylococcus epidermidis BCM-HMP0060]
          Length = 323

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+++KV+    +G DN+D+ +A + G+VV NTP   + TTAE   +LML +AR+I  A  
Sbjct: 65  AQQLKVIANMAVGFDNIDISLAKKHGVVVTNTPHVLTETTAELGFTLMLTVARRIIEATS 124

Query: 65  STHKGKWEKF 74
              +GKW+ +
Sbjct: 125 YIQEGKWKSW 134


>gi|291299076|ref|YP_003510354.1| phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290568296|gb|ADD41261.1| Phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 324

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV GR G+G DN+D+  A+  GI V  TP  N  + AEH  +L+L++AR +P
Sbjct: 66  VIAAADRLKVFGRTGVGYDNIDVAAATERGIAVCPTPGVNRQSVAEHTFALLLSVARGVP 125

Query: 61  VANESTHKGKWEKFN 75
               +   G W + +
Sbjct: 126 GNVTAVAAGDWPQVS 140


>gi|134084040|emb|CAL00578.1| unnamed protein product [Aspergillus niger]
          Length = 480

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 122 VLKEARNLIVIGCFCIGTNQVDLQFAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 181

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 182 DRSNEMHNGTWNK 194


>gi|50305309|ref|XP_452614.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641747|emb|CAH01465.1| KLLA0C09306p [Kluyveromyces lactis]
          Length = 470

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 117 ILKHAKNLVVIGCFCIGTNQVDLDFAAKHGIAVFNSPFSNSRSVAELVIAEIITLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSIELHTGTWNK 189


>gi|238785665|ref|ZP_04629642.1| D-3-phosphoglycerate dehydrogenase [Yersinia bercovieri ATCC 43970]
 gi|238713444|gb|EEQ05479.1| D-3-phosphoglycerate dehydrogenase [Yersinia bercovieri ATCC 43970]
          Length = 413

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+  G+ V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLKAATTRGVPVFNAPFSNTRSVAEMVLGELLLMFRGIPSANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W K      EA
Sbjct: 133 KAHRGEWNKLAVGSYEA 149


>gi|317037003|ref|XP_001398464.2| D-3-phosphoglycerate dehydrogenase 1 [Aspergillus niger CBS 513.88]
          Length = 474

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 122 VLKEARNLIVIGCFCIGTNQVDLQFAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 181

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 182 DRSNEMHNGTWNK 194


>gi|167040546|ref|YP_001663531.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300914590|ref|ZP_07131906.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter sp. X561]
 gi|307724176|ref|YP_003903927.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter sp. X513]
 gi|166854786|gb|ABY93195.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300889525|gb|EFK84671.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter sp. X561]
 gi|307581237|gb|ADN54636.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter sp. X513]
          Length = 324

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 47/71 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A  +K++ R G G DN+D+  A+  GI+V N P  N+++ AEH I+++L +++Q+ 
Sbjct: 57  VIENAPHLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNNLSVAEHTIAMILNLSKQLS 116

Query: 61  VANESTHKGKW 71
           + +++   G W
Sbjct: 117 LMDKAVRSGNW 127


>gi|114761151|ref|ZP_01441066.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Pelagibaca bermudensis HTCC2601]
 gi|114545399|gb|EAU48401.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Roseovarius sp. HTCC2601]
          Length = 326

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+   K++ V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM ++AR IP 
Sbjct: 67  LTQGGKLRAVIKHGVGVDNIDIPACTEAGLPVCNTPAANADAVAELAVGLMFSMARWIPQ 126

Query: 62  ANESTHKGKWEK 73
            + S   G W++
Sbjct: 127 GHASVTAGGWDR 138


>gi|189347380|ref|YP_001943909.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chlorobium limicola DSM 245]
 gi|189341527|gb|ACD90930.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chlorobium limicola DSM 245]
          Length = 305

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 47/73 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +   ++ + R G+G D+VDL  A + GIVV NTP G + + AE  I++ LA+ R++P
Sbjct: 64  VMDNLPNLRCISRVGVGMDSVDLDYAKQKGIVVTNTPDGPTRSVAELTIAMTLALLRKVP 123

Query: 61  VANESTHKGKWEK 73
            A+ +  +G W+K
Sbjct: 124 QAHMNIKQGVWKK 136


>gi|150864337|ref|XP_001383109.2| 3-phosphoglycerate dehydrogenase, serine biosynthesis
           [Scheffersomyces stipitis CBS 6054]
 gi|149385593|gb|ABN65080.2| 3-phosphoglycerate dehydrogenase, serine biosynthesis
           [Scheffersomyces stipitis CBS 6054]
          Length = 468

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 115 VLQHARNLVTIGCFCIGTNQVDLEFAAKSGIAVFNSPFSNSRSVAELVIAEIITLARQLG 174

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 175 DRSIEMHTGTWNK 187


>gi|330806932|ref|YP_004351394.1| Phosphoglycerate dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375040|gb|AEA66390.1| Phosphoglycerate dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 409

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  IFDHAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|157370692|ref|YP_001478681.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase [Serratia
           proteamaculans 568]
 gi|157322456|gb|ABV41553.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Serratia
           proteamaculans 568]
          Length = 321

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 45/66 (68%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           ++++   G G +NVD+V A   GI+V + P  N  + A+HAI+L++AIAR IP A+ +  
Sbjct: 68  LEIICAQGAGYENVDIVAAQARGIIVTHGPGTNDASVADHAIALLMAIARGIPQADTAVR 127

Query: 68  KGKWEK 73
           +G+W++
Sbjct: 128 RGEWQQ 133


>gi|310792633|gb|EFQ28160.1| D-isomer specific 2-hydroxyacid dehydrogenase [Glomerella
           graminicola M1.001]
          Length = 471

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + VVG   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 119 VLREAKNLLVVGCFCIGTNQVDLEYAAAHGIAVFNSPFANSRSVAELVIAEIITLARQLG 178

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 179 DRSNEMHRGTWNK 191


>gi|259482914|tpe|CBF77844.1| TPA: 3-phosphoglycerate dehydrogenase, hypothetical (Eurofung)
           [Aspergillus nidulans FGSC A4]
          Length = 475

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++A+ARQ+ 
Sbjct: 123 VLKEARNLIVIGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVICEIIALARQLG 182

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 183 DRSNEMHNGTWNK 195


>gi|269925471|ref|YP_003322094.1| Glyoxylate reductase [Thermobaculum terrenum ATCC BAA-798]
 gi|269789131|gb|ACZ41272.1| Glyoxylate reductase [Thermobaculum terrenum ATCC BAA-798]
          Length = 319

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 48/74 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S+A+ +KV+    +G DN+DL  A++AGIVV NTP   + TTA+ A +LML++AR++ 
Sbjct: 61  VISNARNLKVIANYAVGYDNIDLEAATKAGIVVTNTPDVLTETTADLAWALMLSVARRLI 120

Query: 61  VANESTHKGKWEKF 74
                   GKW  +
Sbjct: 121 EGVSHVKDGKWRTW 134


>gi|167747758|ref|ZP_02419885.1| hypothetical protein ANACAC_02479 [Anaerostipes caccae DSM 14662]
 gi|167653120|gb|EDR97249.1| hypothetical protein ANACAC_02479 [Anaerostipes caccae DSM 14662]
          Length = 329

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + ++  +KV+GR G+G D+VD+  A+  GI V+ TP  N+ + AEHA+++M A+++ +  
Sbjct: 56  IENSPNLKVIGRTGVGYDSVDVKTATAHGIPVVITPGANNRSVAEHAVAMMFALSKNLVE 115

Query: 62  ANESTHKGKWE 72
           A     KG WE
Sbjct: 116 AQTEMCKGNWE 126


>gi|113460268|ref|YP_718326.1| D-3-phosphoglycerate dehydrogenase [Haemophilus somnus 129PT]
 gi|112822311|gb|ABI24400.1| D-3-phosphoglycerate dehydrogenase [Haemophilus somnus 129PT]
          Length = 410

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  ILAEATKLIAIGCFCIGTNQVDLEAAKARGIPVFNAPFANTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANADVHRGLWNK 142


>gi|78047446|ref|YP_363621.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035876|emb|CAJ23567.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 440

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 98  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 157

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 158 QKNAQCHRGGWSK 170


>gi|70727024|ref|YP_253938.1| hypothetical protein SH2023 [Staphylococcus haemolyticus JCSC1435]
 gi|68447748|dbj|BAE05332.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 321

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L HAK +KV+    +G DN+D+ +A    IVV NTP   + TTAE   +LML +AR+I  
Sbjct: 62  LEHAKHVKVIANMAVGFDNIDVKLAEDKEIVVTNTPQVLTETTAELGFTLMLTVARRIVE 121

Query: 62  ANESTHKGKWEKF 74
           A +    G+W+ +
Sbjct: 122 AEKYVQDGQWKSW 134


>gi|170718308|ref|YP_001785321.1| D-3-phosphoglycerate dehydrogenase [Haemophilus somnus 2336]
 gi|168826437|gb|ACA31808.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Haemophilus somnus 2336]
          Length = 410

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  ILAEATKLIAIGCFCIGTNQVDLEAAKARGIPVFNAPFANTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANADVHRGLWNK 142


>gi|302781158|ref|XP_002972353.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
 gi|300159820|gb|EFJ26439.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
          Length = 627

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNV+L  A+  G +V+N P  N++  AEHAI+L+ A+AR +  AN S 
Sbjct: 144 RLKVVGRAGVGIDNVNLQAATEKGCLVVNAPTANTVAAAEHAIALLAALARNVAQANASV 203

Query: 67  HKGKWEKFNFMGV 79
             GKW++  + GV
Sbjct: 204 KSGKWQRSKYTGV 216


>gi|15838797|ref|NP_299485.1| D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa 9a5c]
 gi|9107351|gb|AAF85005.1|AE004033_9 D-3-phosphoglycerate dehydrogenase [Xylella fastidiosa 9a5c]
          Length = 413

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  +G   IGT+ VDL  A  +GI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLGHAKRLMAIGCFCIGTNQVDLDTAELSGIPVFNAPYSNTRSVAELIIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|229593199|ref|YP_002875318.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|312963707|ref|ZP_07778178.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens WH6]
 gi|229365065|emb|CAY53254.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|311281742|gb|EFQ60352.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens WH6]
          Length = 409

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  IFDHAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|152979526|ref|YP_001345155.1| D-3-phosphoglycerate dehydrogenase [Actinobacillus succinogenes
           130Z]
 gi|150841249|gb|ABR75220.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Actinobacillus succinogenes 130Z]
          Length = 412

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  +G   IGT+ V L  A   GI V N PF N+ + AE  ++ ++ + R IP
Sbjct: 70  ILEHAPKLIAIGCFCIGTNQVALDAAKEKGIPVFNAPFSNTRSVAELVLAEIILLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G+W K
Sbjct: 130 KANMEVHRGEWNK 142


>gi|320540104|ref|ZP_08039759.1| putative D-3-phosphoglycerate dehydrogenase [Serratia symbiotica
           str. Tucson]
 gi|320029770|gb|EFW11794.1| putative D-3-phosphoglycerate dehydrogenase [Serratia symbiotica
           str. Tucson]
          Length = 412

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (55%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  +  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVELKAATKRGIPVFNAPFSNTRSVAEMVLGELLLMLRGIPAANA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G W K      EA
Sbjct: 133 KAHRGVWHKLAVGAYEA 149


>gi|260428767|ref|ZP_05782744.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
 gi|260419390|gb|EEX12643.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
          Length = 336

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+D+  A+  GI V+     N+++ AEHAI+L+LA  ++I 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDIQAAAERGIPVLVATGANAVSVAEHAIALLLAAVKRIL 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G+WEK  F G E
Sbjct: 122 PLDAGLRAGRWEKPGFSGHE 141


>gi|323144898|ref|ZP_08079461.1| 4-phosphoerythronate dehydrogenase [Succinatimonas hippei YIT
           12066]
 gi|322415296|gb|EFY06067.1| 4-phosphoerythronate dehydrogenase [Succinatimonas hippei YIT
           12066]
          Length = 322

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 44/72 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S    +K V R G+G DNVDLV A++ G+ V N P   +   A+ A++LM+A+ R++ 
Sbjct: 62  VFSAIPTLKTVVRYGVGVDNVDLVAATKHGVQVCNVPDYGTFEVADQALALMMAVTRKVC 121

Query: 61  VANESTHKGKWE 72
            AN    +G+W+
Sbjct: 122 QANSQVKEGRWD 133


>gi|317138768|ref|XP_001817125.2| D-3-phosphoglycerate dehydrogenase 1 [Aspergillus oryzae RIB40]
          Length = 464

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + VVG   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 112 ILKEARNLIVVGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 171

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 172 DRSNEMHNGTWNK 184


>gi|307326898|ref|ZP_07606089.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Streptomyces violaceusniger Tu 4113]
 gi|306887434|gb|EFN18429.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Streptomyces violaceusniger Tu 4113]
          Length = 326

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 46/74 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + VV + G+GTDN+DL  A+  G+ V+N P  N+   A+  ++L+LA  R+I 
Sbjct: 75  VLDAAPGLNVVAKHGVGTDNIDLAAAAAHGVRVVNAPGSNTTAVADMTMALLLAAVRRIV 134

Query: 61  VANESTHKGKWEKF 74
            A+ S   G+W++F
Sbjct: 135 PAHASVTGGRWDRF 148


>gi|331219046|ref|XP_003322200.1| D-3-phosphoglycerate dehydrogenase [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309301190|gb|EFP77781.1| D-3-phosphoglycerate dehydrogenase [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 474

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           + V+G   IGT+ VDL VA+ AGI V N+PF NS + AE  I  ++A+ARQ+   +   H
Sbjct: 124 LLVIGCFCIGTNQVDLDVAASAGICVFNSPFSNSRSVAELVIGELIALARQLTDRSSEIH 183

Query: 68  KGKWEK 73
            G W K
Sbjct: 184 NGVWNK 189


>gi|115438570|ref|XP_001218100.1| D-3-phosphoglycerate dehydrogenase 2 [Aspergillus terreus NIH2624]
 gi|114188915|gb|EAU30615.1| D-3-phosphoglycerate dehydrogenase 2 [Aspergillus terreus NIH2624]
          Length = 466

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + VVG   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 114 VLKEARNLIVVGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVIAEIISLARQLG 173

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 174 DRSNEMHNGTWNK 186


>gi|269839039|ref|YP_003323731.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790769|gb|ACZ42909.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 319

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 2/80 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++ + + G+G DN+DL  A R GIVV  TP     + A+  + L++A+ARQI 
Sbjct: 69  VIEAAGRLRTIAKHGVGLDNIDLEAARRRGIVVTATPGAIHDSVADLTMGLIIAVARQIV 128

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ ST  G+W   NF+G+E
Sbjct: 129 PAHNSTVAGEWR--NFVGLE 146


>gi|294666689|ref|ZP_06731925.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603514|gb|EFF46929.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 413

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|118463523|ref|YP_883011.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
 gi|254776268|ref|ZP_05217784.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|118164810|gb|ABK65707.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
          Length = 528

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA AR+IP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAAREIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|21242588|ref|NP_642170.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21108048|gb|AAM36706.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 413

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAHAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAQCHRGGWSK 143


>gi|312129978|ref|YP_003997318.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Leadbetterella byssophila DSM 17132]
 gi|311906524|gb|ADQ16965.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Leadbetterella byssophila DSM 17132]
          Length = 636

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+K+  +G   IGT+ +DL  A + GI V N P+ N+ +  E  I  M+ + R++ 
Sbjct: 296 VLEHAEKLLAIGAFCIGTNQIDLKEAEKRGICVFNAPYSNTRSVVELVIGEMIMLIRKVF 355

Query: 61  VANESTHKGKWEK 73
           V +   H+GKW+K
Sbjct: 356 VKSTGMHQGKWDK 368


>gi|242238013|ref|YP_002986194.1| D-3-phosphoglycerate dehydrogenase [Dickeya dadantii Ech703]
 gi|242130070|gb|ACS84372.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Dickeya
           dadantii Ech703]
          Length = 410

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ V+L  A++ GI V N PF N+ + AE  I  +L + R IP AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVELPAATKRGIPVFNAPFSNTRSVAEMVIGELLLMLRGIPSANA 132

Query: 65  STHKGKWEK 73
           + H+G W K
Sbjct: 133 NAHRGIWHK 141


>gi|218295353|ref|ZP_03496166.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
 gi|218243985|gb|EED10511.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
          Length = 521

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K++KVVGR G+G DNVDL  ASR GI+V+N P  N+ + AE A  L+L+ AR I 
Sbjct: 55  LLKRGKRLKVVGRGGVGVDNVDLEAASRLGILVVNVPEANTRSAAELAFGLLLSAARGIA 114

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +++     G+W++  F+G+E
Sbjct: 115 LSDRKIRSGEWDR-KFLGLE 133


>gi|50294980|ref|XP_449901.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49529215|emb|CAG62881.1| unnamed protein product [Candida glabrata]
          Length = 466

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A+  G+ V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 113 ILKHAKNLVVIGCFCIGTNQVDLDYAASIGVAVFNSPFSNSRSVAELVIAEIISLARQLG 172

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 173 DRSIELHTGTWNK 185


>gi|258571449|ref|XP_002544528.1| D-3-phosphoglycerate dehydrogenase 1 [Uncinocarpus reesii 1704]
 gi|237904798|gb|EEP79199.1| D-3-phosphoglycerate dehydrogenase 1 [Uncinocarpus reesii 1704]
          Length = 489

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 124 VLREAKNLIVIGCFCIGTNQVDLQYAADHGIAVFNSPFSNSRSVAELVIAEIISLARQLC 183

Query: 61  VANESTHKGKWEK 73
             +   H G W+K
Sbjct: 184 DRSMELHNGMWQK 196


>gi|207344338|gb|EDZ71515.1| YIL074Cp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 232

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 116 ILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|41409131|ref|NP_961967.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397951|gb|AAS05581.1| SerA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 528

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA AR+IP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAAREIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|307720842|ref|YP_003891982.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978935|gb|ADN08970.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
          Length = 528

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            + HA  MK + RAG+G DNV++   S+ GI+VMN P  N+I   E  ++ ML+  R  P
Sbjct: 62  FIEHATNMKAIVRAGVGVDNVNIPECSKKGIIVMNVPTANTIAAVELTMTHMLSCMRMFP 121

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            +++     + W++  + G E
Sbjct: 122 YSHDHLKNQRIWKREKWYGYE 142


>gi|224437370|ref|ZP_03658342.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313143835|ref|ZP_07806028.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313128866|gb|EFR46483.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
          Length = 526

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  + +++ V RAG+G DNVD+   SR GIVVMN P  N+I   E  ++ ++   R  P
Sbjct: 60  FLESSGQIRAVVRAGVGVDNVDIDGCSRKGIVVMNVPTANTIAAVELTMAHLINAVRNFP 119

Query: 61  VAN-ESTHKGKWEKFNFMGVE 80
            AN +  ++ KW++ ++ G+E
Sbjct: 120 GANTQLKNERKWKREDWYGIE 140


>gi|293391743|ref|ZP_06636077.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952277|gb|EFE02396.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 410

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIAAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGLWNK 142


>gi|152971866|ref|YP_001336975.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238896457|ref|YP_002921195.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262042558|ref|ZP_06015715.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330011880|ref|ZP_08307181.1| phosphoglycerate dehydrogenase [Klebsiella sp. MS 92-3]
 gi|150956715|gb|ABR78745.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238548777|dbj|BAH65128.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259040118|gb|EEW41232.1| D-3-phosphoglycerate dehydrogenase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534059|gb|EGF60706.1| phosphoglycerate dehydrogenase [Klebsiella sp. MS 92-3]
          Length = 410

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGELLLMLRGVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGVWNK 141


>gi|45185656|ref|NP_983372.1| ACL032Cp [Ashbya gossypii ATCC 10895]
 gi|44981411|gb|AAS51196.1| ACL032Cp [Ashbya gossypii ATCC 10895]
          Length = 470

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGT+ VDL  A++ G+ V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 117 ILKHAKNLVCIGCFCIGTNQVDLDYAAKMGVSVFNSPFSNSRSVAELVIGEIISLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSIEMHTGTWNK 189


>gi|126666910|ref|ZP_01737886.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Marinobacter sp. ELB17]
 gi|126628626|gb|EAZ99247.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Marinobacter sp. ELB17]
          Length = 409

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+  VG   IGT+ VDL  A+R G+ V N PF N+ + AE  ++  + + R +P  N 
Sbjct: 73  AKKLVAVGCFCIGTNQVDLQAATRRGVAVFNAPFSNTRSVAELVLAQAILLLRGVPEKNA 132

Query: 65  STHKGKWEK 73
             H+G+W K
Sbjct: 133 KAHRGEWIK 141


>gi|255728449|ref|XP_002549150.1| D-3-phosphoglycerate dehydrogenase 1 [Candida tropicalis MYA-3404]
 gi|240133466|gb|EER33022.1| D-3-phosphoglycerate dehydrogenase 1 [Candida tropicalis MYA-3404]
          Length = 463

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  IS ++ +ARQ+ 
Sbjct: 110 VLKAAKNLVVIGCFCIGTNQVDLDFAAKSGIAVFNSPFSNSRSVAELVISEIITLARQLG 169

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 170 DRSIEMHTGTWNK 182


>gi|52081995|ref|YP_080786.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD binding
           domain-containing protein [Bacillus licheniformis ATCC
           14580]
 gi|52787382|ref|YP_093211.1| hypothetical protein BLi03698 [Bacillus licheniformis ATCC 14580]
 gi|319647859|ref|ZP_08002077.1| hypothetical protein HMPREF1012_03116 [Bacillus sp. BT1B_CT2]
 gi|52005206|gb|AAU25148.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
           [Bacillus licheniformis ATCC 14580]
 gi|52349884|gb|AAU42518.1| hypothetical protein BLi03698 [Bacillus licheniformis ATCC 14580]
 gi|317390200|gb|EFV71009.1| hypothetical protein HMPREF1012_03116 [Bacillus sp. BT1B_CT2]
          Length = 316

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+V + G+G DN+DL  A    + V N P  N    A+    LML+ ARQIP
Sbjct: 61  VLDRLPSLKIVCKHGVGVDNIDLHAAKERNVWVTNAPNANKHAVADFVFGLMLSAARQIP 120

Query: 61  VANESTHKGKWEK 73
            A+  T  GKW +
Sbjct: 121 AADRETKLGKWPR 133


>gi|325922443|ref|ZP_08184210.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas gardneri ATCC
           19865]
 gi|325547063|gb|EGD18150.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas gardneri ATCC
           19865]
          Length = 420

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  +G   IGT+ V+L  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 78  VLAHAKRLIAIGCFCIGTNQVELDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 137

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 138 QKNAECHRGGWSK 150


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LS A K++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLSLATKLRAVVRAGVGVDNVDIEASSKRGVVVMNVPTANTIAAVELTCAHILSAIRNFP 120

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            AN      + W++ ++ G E
Sbjct: 121 GANAQLKVERVWKREDWYGTE 141


>gi|293605535|ref|ZP_06687916.1| D-isomer specific 2-hydroxyacid dehydrogenase [Achromobacter
           piechaudii ATCC 43553]
 gi|292816060|gb|EFF75160.1| D-isomer specific 2-hydroxyacid dehydrogenase [Achromobacter
           piechaudii ATCC 43553]
          Length = 318

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+++V   G+G +N+DL  A   GI V N P  N+++ A+HA++L+L +AR +P A+   
Sbjct: 67  KLELVCSLGVGYENIDLAAAHARGITVTNGPGANAVSVADHAMALLLGVARHLPQADAWV 126

Query: 67  HKGKWEKF 74
            +G W  F
Sbjct: 127 RQGHWSGF 134


>gi|261868183|ref|YP_003256105.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413515|gb|ACX82886.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 410

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIAAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGLWNK 142


>gi|288573147|ref|ZP_06391504.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568888|gb|EFC90445.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 299

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A  +K++ R G+GTDN+D   A+  GI V NTP  +S+  AE A ++MLA+  ++  
Sbjct: 49  IEKASNLKLIIRGGVGTDNIDKEFAASKGISVRNTPKASSVAVAELAFAMMLAVPNRLVE 108

Query: 62  ANESTHKGKWEK 73
           A+ S   G WEK
Sbjct: 109 AHNSMASGAWEK 120


>gi|254458447|ref|ZP_05071872.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
 gi|207084755|gb|EDZ62042.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
          Length = 528

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            ++ AK MK + RAG+G DNVD+   S+ GI+VMN P  N+I   E  ++ ML+  R  P
Sbjct: 61  FINAAKNMKAIVRAGVGVDNVDIEGCSKEGIIVMNVPTANTIAAVELTMAHMLSCMRMFP 120

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            +++     + W++  + G E
Sbjct: 121 YSHDHLKNQRIWKREKWYGYE 141


>gi|302421008|ref|XP_003008334.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
 gi|261351480|gb|EEY13908.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
          Length = 431

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 117 VLREAKHLLVIGCFCIGTNQVDLEFAAKHGIAVFNSPFANSRSVAELVIAEIITLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 177 DRSSEMHRGFWNK 189


>gi|255943695|ref|XP_002562615.1| Pc20g00530 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587350|emb|CAP85382.1| Pc20g00530 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 463

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I  M+ +ARQ+ 
Sbjct: 111 VLKEAKNLIVIGCFCIGTNQVDLQYAADQGIAVFNSPFSNSRSVAELVIGEMVMLARQLG 170

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 171 DRSSEMHAGTWNK 183


>gi|262341059|ref|YP_003283914.1| phosphoglycerate dehydrogenase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272396|gb|ACY40304.1| phosphoglycerate dehydrogenase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 315

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  AK +K + R G G +N+D     + GIV++++P GN    AEHAI ++L     I  
Sbjct: 58  IKKAKNLKFIARIGSGIENIDTDYVLKKGIVLISSPEGNKDAVAEHAIGMLLCAMNHILR 117

Query: 62  ANESTHKGKWEKFNFMGVE 80
           +++   KGKW + N  G+E
Sbjct: 118 SHQQIKKGKWYRENNRGME 136


>gi|121712550|ref|XP_001273886.1| D-3-phosphoglycerate dehydrogenase [Aspergillus clavatus NRRL 1]
 gi|119402039|gb|EAW12460.1| D-3-phosphoglycerate dehydrogenase [Aspergillus clavatus NRRL 1]
          Length = 474

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  IS ++A+ARQ+ 
Sbjct: 122 VLKEARNLIVIGCFCIGTNQVDLQYAAAHGIAVFNSPFSNSRSVAELVISEIIALARQLG 181

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 182 DRSMEMHAGTWNK 194


>gi|224476026|ref|YP_002633632.1| putative D-isomer specific 2-hydroxyacid dehydrogenase
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222420633|emb|CAL27447.1| putative D-isomer specific 2-hydroxyacid dehydrogenase
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 323

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A K+K++    +G DN+D+ +A   G+ V NTP   + TTAE   +LMLA AR+I  
Sbjct: 62  LDAAPKLKIIANLAVGYDNIDIPLAEERGVTVTNTPEVLTETTAELGFALMLATARRIVE 121

Query: 62  ANESTHKGKWEKF 74
           A +    GKW+ +
Sbjct: 122 AEQYIRDGKWKSW 134


>gi|58426360|gb|AAW75397.1| D-3-phosphoglycerate dehydrogenase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 495

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HAK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 153 VLAHAKRLIAVGCFCIGTNQVDLDAAEVAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 212

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 213 QKNAECHRGGWSK 225


>gi|326797229|ref|YP_004315049.1| phosphoglycerate dehydrogenase [Marinomonas mediterranea MMB-1]
 gi|326547993|gb|ADZ93213.1| Phosphoglycerate dehydrogenase [Marinomonas mediterranea MMB-1]
          Length = 409

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+  +G   IGT+ VDL  AS  G+ V N P+ N+ + AE  I  ++ + R +P
Sbjct: 69  VLEHANKLAAIGCFCIGTNQVDLEAASAKGVAVFNAPYSNTRSVAELVIGQLILLLRGVP 128

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 129 EKNAICHRGGWMK 141


>gi|190574149|ref|YP_001971994.1| D-3-phosphoglycerate dehydrogenase [Stenotrophomonas maltophilia
           K279a]
 gi|190012071|emb|CAQ45693.1| putative D-3-phosphoglycerate dehydrogenase [Stenotrophomonas
           maltophilia K279a]
          Length = 440

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 98  VLAEAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAIMLTRGIP 157

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 158 QKNAECHRGGWSK 170


>gi|120403120|ref|YP_952949.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955938|gb|ABM12943.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
          Length = 528

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 119 AADATLREHSWKRSSFSGTE 138


>gi|242373097|ref|ZP_04818671.1| glyoxylate reductase [Staphylococcus epidermidis M23864:W1]
 gi|242349251|gb|EES40852.1| glyoxylate reductase [Staphylococcus epidermidis M23864:W1]
          Length = 322

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+    +G DN+D+  AS+ GI V NTP   + TTAE   +LML +AR+I 
Sbjct: 61  VLKEASNLKVIANMAVGYDNIDVNKASQYGITVTNTPHVLTETTAELGFTLMLTVARRII 120

Query: 61  VANESTHKGKWEKF 74
            A     +G+WE +
Sbjct: 121 EAATYVQEGQWESW 134


>gi|254523303|ref|ZP_05135358.1| D-3-phosphoglycerate dehydrogenase [Stenotrophomonas sp. SKA14]
 gi|219720894|gb|EED39419.1| D-3-phosphoglycerate dehydrogenase [Stenotrophomonas sp. SKA14]
          Length = 413

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAEAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAIMLTRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|149377131|ref|ZP_01894880.1| D-3-phosphoglycerate dehydrogenase [Marinobacter algicola DG893]
 gi|149358549|gb|EDM47022.1| D-3-phosphoglycerate dehydrogenase [Marinobacter algicola DG893]
          Length = 409

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+R GI V N PF N+ + AE  ++  + + R +P  N 
Sbjct: 73  AQKLVAVGCFCIGTNQVDLQAATRRGIAVFNAPFSNTRSVAELVLAQAILLLRGVPEKNA 132

Query: 65  STHKGKWEK 73
             H+G+W K
Sbjct: 133 KAHRGEWLK 141


>gi|194365564|ref|YP_002028174.1| D-3-phosphoglycerate dehydrogenase [Stenotrophomonas maltophilia
           R551-3]
 gi|194348368|gb|ACF51491.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Stenotrophomonas maltophilia R551-3]
          Length = 413

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK++  VG   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VLAEAKRLIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAIMLTRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 131 QKNAECHRGGWSK 143


>gi|187933947|ref|YP_001887612.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722100|gb|ACD23321.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum B str. Eklund 17B]
          Length = 302

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M A++R + +AN +  
Sbjct: 66  LKLIIRAGVGIDNIDIPYAVKNNLSVTNTPSASSDSVAELALAHMFAVSRFVGIANVTMR 125

Query: 68  KGKWEKFNFMGVE 80
            G+W K  + G E
Sbjct: 126 NGEWNKKKYQGFE 138


>gi|6322116|ref|NP_012191.1| Ser33p [Saccharomyces cerevisiae S288c]
 gi|731830|sp|P40510|SER33_YEAST RecName: Full=D-3-phosphoglycerate dehydrogenase 2; Short=3-PGDH 2
 gi|556873|emb|CAA86096.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285812577|tpg|DAA08476.1| TPA: Ser33p [Saccharomyces cerevisiae S288c]
          Length = 469

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 116 ILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|67903758|ref|XP_682135.1| hypothetical protein AN8866.2 [Aspergillus nidulans FGSC A4]
 gi|40740964|gb|EAA60154.1| hypothetical protein AN8866.2 [Aspergillus nidulans FGSC A4]
          Length = 548

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++A+ARQ+ 
Sbjct: 187 VLKEARNLIVIGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVICEIIALARQLG 246

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 247 DRSNEMHNGTWNK 259


>gi|207345927|gb|EDZ72587.1| YER081Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 314

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 116 VLQHAKNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|117958129|gb|ABK59385.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae]
 gi|117958131|gb|ABK59386.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae]
 gi|117958133|gb|ABK59387.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae]
 gi|117958135|gb|ABK59388.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae]
 gi|117958138|gb|ABK59389.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae]
 gi|151943089|gb|EDN61424.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae YJM789]
 gi|190406289|gb|EDV09556.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae RM11-1a]
 gi|256273726|gb|EEU08652.1| Ser33p [Saccharomyces cerevisiae JAY291]
 gi|259147181|emb|CAY80434.1| Ser33p [Saccharomyces cerevisiae EC1118]
 gi|323337182|gb|EGA78436.1| Ser33p [Saccharomyces cerevisiae Vin13]
 gi|323348123|gb|EGA82377.1| Ser33p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323354587|gb|EGA86423.1| Ser33p [Saccharomyces cerevisiae VL3]
          Length = 469

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 116 ILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|87121193|ref|ZP_01077084.1| D-3-phosphoglycerate dehydrogenase [Marinomonas sp. MED121]
 gi|86163685|gb|EAQ64959.1| D-3-phosphoglycerate dehydrogenase [Marinomonas sp. MED121]
          Length = 409

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHA K+  +G   IGT+ V+L  AS  GI V N PF N+ + AE  I  ++ + R IP
Sbjct: 69  VLSHANKLMAIGCFCIGTNQVNLEAASAKGIAVFNAPFSNTRSVAELVIGQLILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 129 EKSAVCHRGGWMK 141


>gi|46126181|ref|XP_387644.1| hypothetical protein FG07468.1 [Gibberella zeae PH-1]
          Length = 474

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + V+G   IGT+ VDL  A++ GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 122 VLREATNLLVIGCFCIGTNQVDLEFAAKNGIAVFNSPFANSRSVAELVIAEIITLARQLG 181

Query: 61  VANESTHKGKWEK 73
             +   H+G W K
Sbjct: 182 DRSNEMHRGTWNK 194


>gi|302391720|ref|YP_003827540.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acetohalobium arabaticum DSM 5501]
 gi|302203797|gb|ADL12475.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acetohalobium arabaticum DSM 5501]
          Length = 318

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 48/71 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A +++VV + G+G DN+D+  A++ G+VV+N P  N  + AEH ++++L IA+   
Sbjct: 56  VIKNAPQLEVVAKHGVGVDNIDIETATKEGVVVVNAPESNIYSVAEHTLTMILTIAKNFV 115

Query: 61  VANESTHKGKW 71
           V ++   +G++
Sbjct: 116 VMDKEVREGRF 126


>gi|212551100|ref|YP_002309417.1| putative D-3-phosphoglycerate dehydrogenase [Candidatus
           Azobacteroides pseudotrichonymphae genomovar. CFP2]
 gi|212549338|dbj|BAG84006.1| putative D-3-phosphoglycerate dehydrogenase [Candidatus
           Azobacteroides pseudotrichonymphae genomovar. CFP2]
          Length = 305

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+K+V RAG G DNVDLV AS   IVVMNTP  N+   AE AI +M+  +R   
Sbjct: 63  ILDAAKKLKIVVRAGSGVDNVDLVAASVRNIVVMNTPGQNANAVAELAIGMMIYASRNFY 122

Query: 61  VANESTH-KGK 70
             +  T  KGK
Sbjct: 123 DGSNGTELKGK 133


>gi|325969666|ref|YP_004245858.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta moutnovskia 768-28]
 gi|323708869|gb|ADY02356.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta moutnovskia 768-28]
          Length = 307

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++ RAG+G DN+D+  A   GI V+N P G++ + AE  I  M+  AR + 
Sbjct: 58  VIDTANKLRIIARAGVGLDNIDVEYAKSKGIEVINAPEGSTQSVAELVIGFMITAARLVM 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
           + +     G W K  ++G E
Sbjct: 118 LQDRLVKDGGWPKGKYVGTE 137


>gi|313677279|ref|YP_004055275.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Marivirga tractuosa DSM 4126]
 gi|312943977|gb|ADR23167.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Marivirga tractuosa DSM 4126]
          Length = 312

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+  V RAG G DNV++    +  I ++N P GN    AEHA+ ++L +  +I 
Sbjct: 57  LLKNAKKLVFVARAGAGVDNVEVEELKKRNIELINAPEGNRDALAEHAMGMLLTLFNKIN 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     GKW++    GVE
Sbjct: 117 TADLEVRSGKWDREGNRGVE 136


>gi|289622714|emb|CBI50983.1| unnamed protein product [Sordaria macrospora]
          Length = 623

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 54/78 (69%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           +  ++V+ RAG+G DN+D+  A++ GI+V+N+P GN    AEH ++L+LA+AR I  A+ 
Sbjct: 83  SPNLRVIARAGVGVDNIDVEAATKRGIIVVNSPHGNIAAAAEHTLALLLALARNIGRADT 142

Query: 65  STHKGKWEKFNFMGVEAG 82
              +G+WE+   +GVE G
Sbjct: 143 GMKQGRWERSKLVGVEVG 160


>gi|15603536|ref|NP_246610.1| D-3-phosphoglycerate dehydrogenase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12722078|gb|AAK03755.1| SerA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 410

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA+K+  +G   IGT+ V+L  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  VLAHAQKLIAIGCFCIGTNQVNLQAAKLRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGIWNK 142


>gi|330836371|ref|YP_004411012.1| Phosphoglycerate dehydrogenase [Spirochaeta coccoides DSM 17374]
 gi|329748274|gb|AEC01630.1| Phosphoglycerate dehydrogenase [Spirochaeta coccoides DSM 17374]
          Length = 294

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++K + R G+G DN+D+  A+  GI+ +NTP  +SI  AE A SLMLA+   I  
Sbjct: 49  MAGAPRVKAIIRGGVGMDNIDMESAASKGILTLNTPTASSIAVAELAFSLMLAVPNHISE 108

Query: 62  ANESTHKGKWEK 73
            +     GKW K
Sbjct: 109 YDAGMKSGKWLK 120


>gi|111025673|ref|YP_708093.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110824652|gb|ABG99935.1| probable phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 163

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +KV+ R G G D++D+  A+R G+VV N P  NS   A H + L LA  R++P
Sbjct: 35  VLAALPHLKVISRLGTGVDSIDVPAANRHGVVVTNVPDANSEEVATHTMGLALAAHRRLP 94

Query: 61  VANESTHKGKWEKFNFMG 78
             ++S  +G+W      G
Sbjct: 95  SFDKSVRQGQWHSAPIHG 112


>gi|258651755|ref|YP_003200911.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Nakamurella multipartita DSM 44233]
 gi|258554980|gb|ACV77922.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Nakamurella multipartita DSM 44233]
          Length = 327

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 42/70 (60%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++++V R G+G D VDL  A R G++V NTP  NS   A+H ++L+LA  R +  
Sbjct: 65  LAAAPRLRIVARYGVGVDAVDLAAAGRRGVLVTNTPGANSGAVADHTVALLLAALRGVAA 124

Query: 62  ANESTHKGKW 71
            +    +G W
Sbjct: 125 GDRRVREGSW 134


>gi|320101714|ref|YP_004177305.1| phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319748996|gb|ADV60756.1| Phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 351

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 43/65 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           + KVV RAG+G DNVDL  A++AGI V N P   +   A+HA+ L+LA+AR++   +   
Sbjct: 83  RCKVVVRAGVGFDNVDLDAANQAGIPVCNVPDYGTEEVADHALMLLLAVARRLIDCDRPL 142

Query: 67  HKGKW 71
            +G+W
Sbjct: 143 RQGRW 147


>gi|116331109|ref|YP_800827.1| D-3-phosphoglycerate dehydrogenase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116124798|gb|ABJ76069.1| Dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 408

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++  +G   IGT+ VDL  A + GI V N P+ N+ + AE  IS ++ +AR++P
Sbjct: 66  VLEKAKRLLTIGCFCIGTNQVDLSGAEKKGIPVFNAPYSNTRSVAELVISEIIMLARRVP 125

Query: 61  VANESTHKGKWEK 73
               +TH G W K
Sbjct: 126 DHIRNTHSGIWNK 138


>gi|190409979|ref|YP_001965503.1| putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium
           meliloti]
 gi|125631009|gb|ABN47010.1| putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           SM11]
          Length = 412

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   +GT+ VDL  A R GI V N P+ N+ + AE  I  ++ + RQI 
Sbjct: 70  IFESAKKLIAVGCFSVGTNQVDLDAARRRGIPVFNAPYSNTRSVAELVIGEIIMLTRQIF 129

Query: 61  VANESTHKGKWEK 73
             + S H+G WEK
Sbjct: 130 PRSASAHQGGWEK 142


>gi|116328383|ref|YP_798103.1| D-3-phosphoglycerate dehydrogenase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116121127|gb|ABJ79170.1| Dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
          Length = 407

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++  +G   IGT+ VDL  A + GI V N P+ N+ + AE  IS ++ +AR++P
Sbjct: 66  VLEKAKRLLTIGCFCIGTNQVDLSGAEKKGIPVFNAPYSNTRSVAELVISEIIMLARRVP 125

Query: 61  VANESTHKGKWEK 73
               +TH G W K
Sbjct: 126 DHIRNTHSGIWNK 138


>gi|78484972|ref|YP_390897.1| D-3-phosphoglycerate dehydrogenase [Thiomicrospira crunogena XCL-2]
 gi|78363258|gb|ABB41223.1| D-3-phosphoglycerate dehydrogenase [Thiomicrospira crunogena XCL-2]
          Length = 409

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+  VG   IGT+ VDL  A + GI V N PF N+ + AE  +  +L + R IP  N 
Sbjct: 73  AKKLVGVGCFCIGTNQVDLKAAQKRGIPVFNAPFSNTRSVAELVLGEILLLLRDIPAKNA 132

Query: 65  STHKGKWEKFNFMGVEA 81
             H+G+W+K     VEA
Sbjct: 133 KVHRGEWDKSATGSVEA 149


>gi|187730934|ref|YP_001881682.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii CDC 3083-94]
 gi|187427926|gb|ACD07200.1| phosphoglycerate dehydrogenase [Shigella boydii CDC 3083-94]
          Length = 410

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I   L + R +P AN 
Sbjct: 73  AEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGEQLLLLRGVPEANA 132

Query: 65  STHKGKWEKF 74
             H+G W K 
Sbjct: 133 KAHRGVWNKL 142


>gi|325576992|ref|ZP_08147563.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160950|gb|EGC73069.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 419

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 79  MIEAAPKLIAIGCFCIGTNQVDLNAAKMRGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 138

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 139 QANADVHRGLWNK 151


>gi|301155286|emb|CBW14752.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae
           T3T1]
          Length = 410

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIEAAPKLIAIGCFCIGTNQVDLNAAKMRGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANADVHRGLWNK 142


>gi|84496270|ref|ZP_00995124.1| D-3-phosphoglycerate dehydrogenase [Janibacter sp. HTCC2649]
 gi|84383038|gb|EAP98919.1| D-3-phosphoglycerate dehydrogenase [Janibacter sp. HTCC2649]
          Length = 399

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +  VG   IGT+ VDL  AS  G+ V N PF N+ +  E  +  MLA+ R++P
Sbjct: 58  VLAAADDLLAVGCFCIGTNQVDLPAASARGVAVFNAPFSNTRSVVELVLCEMLALTRRLP 117

Query: 61  VANESTHKGKWEK 73
              E  H G W+K
Sbjct: 118 EKTEKMHAGIWDK 130


>gi|268679255|ref|YP_003303686.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617286|gb|ACZ11651.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 528

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD    SR GI+ MN P  N+I   E  ++ ML  AR  P
Sbjct: 61  FLNAATNLKAIVRAGVGVDNVDQEGCSRRGIIAMNVPTANTIAAVELTMAHMLGCARSFP 120

Query: 61  VANESTHKGK-WEKFNFMGVE 80
            AN      + W +  + GVE
Sbjct: 121 NANNHLKIDRIWNREKWYGVE 141


>gi|120555730|ref|YP_960081.1| D-3-phosphoglycerate dehydrogenase [Marinobacter aquaeolei VT8]
 gi|120325579|gb|ABM19894.1| D-3-phosphoglycerate dehydrogenase [Marinobacter aquaeolei VT8]
          Length = 409

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+R G+ V N PF N+ + AE  ++  + + R +P  N 
Sbjct: 73  ARKLVAVGCFCIGTNQVDLQAATRRGVAVFNAPFSNTRSVAELVLAQAILLLRGVPEKNA 132

Query: 65  STHKGKWEK 73
             H+G+W K
Sbjct: 133 KAHRGEWLK 141


>gi|294102732|ref|YP_003554590.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Aminobacterium colombiense DSM 12261]
 gi|293617712|gb|ADE57866.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Aminobacterium colombiense DSM 12261]
          Length = 320

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   +K KVV R G+GTDN+D+  A+  GI V NTP  N    A+HA++  L +AR IP
Sbjct: 61  VLDKLEKCKVVVRQGMGTDNIDIPAATARGIQVCNTPGFNIREVADHALASALCLARYIP 120

Query: 61  VANES-THKGKWEKFNF 76
             N    ++ KW   +F
Sbjct: 121 FFNHVIKNEKKWSHLSF 137


>gi|241950089|ref|XP_002417767.1| 3-PGDH, putative; D-3-phosphoglycerate dehydrogenase 1, putative
           [Candida dubliniensis CD36]
 gi|223641105|emb|CAX45481.1| 3-PGDH, putative [Candida dubliniensis CD36]
          Length = 463

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 110 ILKAAKNLVVIGCFCIGTNQVDLEFAAKSGIAVFNSPFSNSRSVAELVIAEIITLARQLG 169

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 170 DRSIELHTGTWNK 182


>gi|126463811|ref|YP_001044924.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126105622|gb|ABN78152.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 316

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEK 73
             + S   G W++
Sbjct: 118 QGHASVTSGGWDR 130


>gi|254483175|ref|ZP_05096408.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [marine gamma proteobacterium HTCC2148]
 gi|214036546|gb|EEB77220.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [marine gamma proteobacterium HTCC2148]
          Length = 409

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + AKK+  VG   IGT+ VDL  A+R GI V N PF N+ + AE  I+  + + R + 
Sbjct: 69  IFASAKKLAAVGCFCIGTNQVDLEAATRRGIAVFNAPFSNTRSVAELVIAEAILLLRGVA 128

Query: 61  VANESTHKGKWEK 73
             N + H+G+W K
Sbjct: 129 EKNAAAHRGQWMK 141


>gi|167042357|gb|ABZ07085.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine crenarchaeote
           HF4000_ANIW97M7]
          Length = 310

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K K++ R G+G DN+D   A    I V+N   G +   AE  I LML++AR+I 
Sbjct: 61  LIEKADKCKIIARVGVGLDNIDEEAAKEKNIRVINAVEGATTAVAELVIGLMLSMAREIT 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W K   MG E
Sbjct: 121 RADREIRNGNWIKKELMGSE 140


>gi|322487894|emb|CBZ23138.1| D-3-phosphoglycerate dehydrogenase-like protein [Leishmania
           mexicana MHOM/GT/2001/U1103]
          Length = 407

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+  +G   IGT+ VDL  A++ G+ V N+PF N+ + AE  I  +++++R+I 
Sbjct: 66  ILDAAPKLLAIGCFCIGTNQVDLDYANKRGVAVFNSPFANTRSVAELVIGEIISLSRKIT 125

Query: 61  VANESTHKGKWEK 73
             +E  H+G W K
Sbjct: 126 QRSEEVHRGAWNK 138


>gi|208434953|ref|YP_002266619.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
 gi|208432882|gb|ACI27753.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
          Length = 524

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|317009666|gb|ADU80246.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori India7]
          Length = 524

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|68479177|ref|XP_716394.1| hypothetical protein CaO19.12728 [Candida albicans SC5314]
 gi|68479306|ref|XP_716332.1| hypothetical protein CaO19.5263 [Candida albicans SC5314]
 gi|46437998|gb|EAK97336.1| hypothetical protein CaO19.5263 [Candida albicans SC5314]
 gi|46438061|gb|EAK97398.1| hypothetical protein CaO19.12728 [Candida albicans SC5314]
 gi|238878404|gb|EEQ42042.1| D-3-phosphoglycerate dehydrogenase 1 [Candida albicans WO-1]
          Length = 463

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+++GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 110 ILKAAKNLVVIGCFCIGTNQVDLEFAAKSGIAVFNSPFSNSRSVAELVIAEIITLARQLG 169

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 170 DRSIELHTGTWNK 182


>gi|317012830|gb|ADU83438.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Lithuania75]
          Length = 524

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|317011252|gb|ADU84999.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           SouthAfrica7]
          Length = 524

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|289704780|ref|ZP_06501201.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
 gi|289558496|gb|EFD51766.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
          Length = 531

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE     +LA AR I  
Sbjct: 62  IAAAPQLKVIARAGVGLDNVDVPAATEAGVMVVNAPTSNIISAAELTCGHILAAARNIAA 121

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S   G+W++  + GVE
Sbjct: 122 AHGSLKAGEWKRSKYTGVE 140


>gi|327394897|dbj|BAK12319.1| hypothetical protein PAJ_2239 [Pantoea ananatis AJ13355]
          Length = 319

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KVV R G G D VDL  A R G+VV+N P  NS++ AE AI  ML  +R   +  E
Sbjct: 62  AKKLKVVARHGAGYDTVDLESAKRHGVVVLNAPVANSMSVAELAIFYMLHCSRNFRLVEE 121

Query: 65  S-THKGKWEKFNFMGVE 80
                  W K     VE
Sbjct: 122 KMLEDYYWAKLRTPKVE 138


>gi|89900653|ref|YP_523124.1| D-3-phosphoglycerate dehydrogenase [Rhodoferax ferrireducens T118]
 gi|89345390|gb|ABD69593.1| D-3-phosphoglycerate dehydrogenase [Rhodoferax ferrireducens T118]
          Length = 413

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+++  VG   IGT+ VDL  A R G+ V N PF N+ + AE  ++ ++ + R IP
Sbjct: 73  VLQHARQLVAVGCFCIGTNQVDLKEAMRLGVPVFNAPFSNTRSVAELVLAQIIMLMRGIP 132

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 133 EKNAVLHRGGWVK 145


>gi|285018110|ref|YP_003375821.1| d-3-phosphoglycerate dehydrogenase [Xanthomonas albilineans GPE
           PC73]
 gi|283473328|emb|CBA15833.1| probable d-3-phosphoglycerate dehydrogenase protein [Xanthomonas
           albilineans]
          Length = 425

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK++  +G   IGT+ VDL  A  AGI V N P+ N+ + AE  I+  + + R IP
Sbjct: 83  VLAQAKRLIAIGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIAEAILLLRGIP 142

Query: 61  VANESTHKGKWEK 73
             N   H+G W K
Sbjct: 143 QKNAECHRGGWSK 155


>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
 gi|194368790|pdb|3DDN|B Chain B, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
          Length = 528

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|254365629|ref|ZP_04981674.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
 gi|134151142|gb|EBA43187.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
          Length = 528

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|15645025|ref|NP_207195.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 26695]
 gi|2313497|gb|AAD07461.1| phosphoglycerate dehydrogenase (serA) [Helicobacter pylori 26695]
          Length = 524

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|15842552|ref|NP_337589.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31794172|ref|NP_856665.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis AF2122/97]
 gi|57117042|ref|YP_177916.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Rv]
 gi|121638877|ref|YP_979101.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148662846|ref|YP_001284369.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148824186|ref|YP_001288940.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis F11]
 gi|167967839|ref|ZP_02550116.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis H37Ra]
 gi|215404980|ref|ZP_03417161.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           02_1987]
 gi|215428447|ref|ZP_03426366.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T92]
 gi|215431947|ref|ZP_03429866.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           EAS054]
 gi|224991369|ref|YP_002646058.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253797911|ref|YP_003030912.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|254233079|ref|ZP_04926406.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|254552073|ref|ZP_05142520.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260188020|ref|ZP_05765494.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CPHL_A]
 gi|260202137|ref|ZP_05769628.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|260206320|ref|ZP_05773811.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis K85]
 gi|289444561|ref|ZP_06434305.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289448668|ref|ZP_06438412.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289553214|ref|ZP_06442424.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289575703|ref|ZP_06455930.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289746800|ref|ZP_06506178.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289751673|ref|ZP_06511051.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289755114|ref|ZP_06514492.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|294993916|ref|ZP_06799607.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis 210]
 gi|297635621|ref|ZP_06953401.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           4207]
 gi|297732619|ref|ZP_06961737.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           R506]
 gi|306777289|ref|ZP_07415626.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|306781200|ref|ZP_07419537.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|306785839|ref|ZP_07424161.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|306789879|ref|ZP_07428201.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|306794690|ref|ZP_07432992.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|306798933|ref|ZP_07437235.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|306804778|ref|ZP_07441446.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|306969070|ref|ZP_07481731.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|306973407|ref|ZP_07486068.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|307081115|ref|ZP_07490285.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|307085720|ref|ZP_07494833.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|313659951|ref|ZP_07816831.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           V2475]
 gi|61242571|sp|P0A544|SERA_MYCTU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|61242577|sp|P0A545|SERA_MYCBO RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|13882863|gb|AAK47403.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31619767|emb|CAD96707.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium bovis AF2122/97]
 gi|41352771|emb|CAE55535.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium tuberculosis H37Rv]
 gi|121494525|emb|CAL73006.1| Probable D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|124602138|gb|EAY61148.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|148506998|gb|ABQ74807.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148722713|gb|ABR07338.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis F11]
 gi|224774484|dbj|BAH27290.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253319414|gb|ACT24017.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|289417480|gb|EFD14720.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289421626|gb|EFD18827.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289437846|gb|EFD20339.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289540134|gb|EFD44712.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289687328|gb|EFD54816.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289692260|gb|EFD59689.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289695701|gb|EFD63130.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|308214339|gb|EFO73738.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|308325983|gb|EFP14834.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|308329514|gb|EFP18365.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|308333653|gb|EFP22504.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|308337010|gb|EFP25861.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|308340824|gb|EFP29675.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|308348637|gb|EFP37488.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|308353362|gb|EFP42213.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|308357207|gb|EFP46058.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|308361161|gb|EFP50012.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|308364754|gb|EFP53605.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|323718375|gb|EGB27549.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CDC1551A]
 gi|326904610|gb|EGE51543.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis W-148]
 gi|328457686|gb|AEB03109.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 4207]
          Length = 528

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|270261904|ref|ZP_06190176.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Serratia
           odorifera 4Rx13]
 gi|270043780|gb|EFA16872.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Serratia
           odorifera 4Rx13]
          Length = 317

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +S    ++++   G G +N+DL  A   GIVV + P  N  + A+HA++L++AIAR IP 
Sbjct: 60  ISALPALEIICALGAGYENIDLTAAQARGIVVTHGPGTNDASVADHALTLLMAIARGIPQ 119

Query: 62  ANESTHKGKWEK 73
           A+ +  +G+W++
Sbjct: 120 ADAAVRRGEWKQ 131


>gi|308375950|ref|ZP_07445640.2| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
 gi|308344687|gb|EFP33538.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
          Length = 526

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 57  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 117 AADASLREHTWKRSSFSGTE 136


>gi|307637719|gb|ADN80169.1| D-3-phospho glycerate dehydrogenase [Helicobacter pylori 908]
 gi|325996322|gb|ADZ51727.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2018]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|60594358|pdb|1YGY|B Chain B, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|313507314|pdb|3DC2|A Chain A, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
 gi|313507315|pdb|3DC2|B Chain B, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
          Length = 529

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 60  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 120 AADASLREHTWKRSSFSGTE 139


>gi|315634902|ref|ZP_07890184.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter segnis ATCC
           33393]
 gi|315476454|gb|EFU67204.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter segnis ATCC
           33393]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIAAAPKLIAIGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANADVHRGLWNK 142


>gi|301169186|emb|CBW28783.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 10810]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|167752141|ref|ZP_02424268.1| hypothetical protein ALIPUT_00383 [Alistipes putredinis DSM 17216]
 gi|167660382|gb|EDS04512.1| hypothetical protein ALIPUT_00383 [Alistipes putredinis DSM 17216]
          Length = 356

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR-QI 59
           ++  AK +K+V RAG G DNVDL  A+  GIVVMNTP  NS   AE A+ +M+ +AR Q 
Sbjct: 112 VIEAAKNLKIVVRAGAGYDNVDLAAATAKGIVVMNTPGQNSNAVAELALGMMVFMARNQF 171

Query: 60  PVANESTHKGK 70
                S  KGK
Sbjct: 172 TPGTGSELKGK 182


>gi|197123448|ref|YP_002135399.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter sp. K]
 gi|196173297|gb|ACG74270.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter sp. K]
          Length = 399

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +V RAG G + +D+  ASR G+ V N P  NSI  AE AI L++A+ R+IP
Sbjct: 56  VFERAPGLSLVVRAGAGVNTIDVAAASRRGVYVTNCPGQNSIAVAELAIGLLVALDRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               +   G+W+K  F   E 
Sbjct: 116 DNVAALRAGRWDKKRFSEAEG 136


>gi|16272413|ref|NP_438626.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae Rd KW20]
 gi|260580472|ref|ZP_05848300.1| phosphoglycerate dehydrogenase [Haemophilus influenzae RdAW]
 gi|1173427|sp|P43885|SERA_HAEIN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1573443|gb|AAC22124.1| D-3-phosphoglycerate dehydrogenase (serA) [Haemophilus influenzae
           Rd KW20]
 gi|260092814|gb|EEW76749.1| phosphoglycerate dehydrogenase [Haemophilus influenzae RdAW]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|317014441|gb|ADU81877.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Gambia94/24]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|308184795|ref|YP_003928928.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
 gi|308060715|gb|ADO02611.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|217032273|ref|ZP_03437770.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298735944|ref|YP_003728469.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
 gi|216946039|gb|EEC24652.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298355133|emb|CBI66005.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|207092309|ref|ZP_03240096.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|220918253|ref|YP_002493557.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956107|gb|ACL66491.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 399

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +V RAG G + +D+  ASR G+ V N P  NSI  AE AI L++A+ R+IP
Sbjct: 56  VFERAPGLSLVVRAGAGVNTIDVAAASRRGVYVTNCPGQNSIAVAELAIGLLVALDRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               +   G+W+K  F   E 
Sbjct: 116 DNVAALRAGRWDKKRFSEAEG 136


>gi|15612049|ref|NP_223701.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori J99]
 gi|4155559|gb|AAD06553.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Helicobacter pylori J99]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|291514079|emb|CBK63289.1| D-3-phosphoglycerate dehydrogenase [Alistipes shahii WAL 8301]
          Length = 333

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 41/57 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR 57
           +++ AK +K+V RAG G DNVDL  AS  GIVVMNTP  NS   AE A+++M+ ++R
Sbjct: 89  VIAAAKNLKIVVRAGAGYDNVDLAAASARGIVVMNTPGQNSNAVAELALAMMIFMSR 145


>gi|219559028|ref|ZP_03538104.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T17]
 gi|289571195|ref|ZP_06451422.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
 gi|289544949|gb|EFD48597.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
          Length = 528

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGTE 138


>gi|148825255|ref|YP_001290008.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittEE]
 gi|148715415|gb|ABQ97625.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittEE]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|119498643|ref|XP_001266079.1| D-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
 gi|119414243|gb|EAW24182.1| D-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
          Length = 472

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 120 VLKEARNLIVIGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 179

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 180 DRSMEMHGGTWNK 192


>gi|317125479|ref|YP_004099591.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
 gi|315589567|gb|ADU48864.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
          Length = 527

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 55/79 (69%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+ RAG+G DNVD+  A++AG++V+N P  N  + AE AI+L+LA AR I  
Sbjct: 60  IAAGRRLKVIARAGVGLDNVDVQAATQAGVMVVNAPTSNITSAAELAIALLLATARNIAP 119

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN++   G W++  + GVE
Sbjct: 120 ANQALKGGAWKRSKYSGVE 138


>gi|145630356|ref|ZP_01786137.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae R3021]
 gi|144984091|gb|EDJ91528.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae R3021]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|325997911|gb|ADZ50119.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2017]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|108563420|ref|YP_627736.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
 gi|107837193|gb|ABF85062.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|70998716|ref|XP_754080.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
 gi|66851716|gb|EAL92042.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
 gi|159126186|gb|EDP51302.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus A1163]
          Length = 472

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++A+ARQ+ 
Sbjct: 120 VLKEARNLIVIGCFCIGTNQVDLQYAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQLG 179

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 180 DRSMEMHGGTWNK 192


>gi|308062332|gb|ADO04220.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Cuz20]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|210135216|ref|YP_002301655.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
 gi|210133184|gb|ACJ08175.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|317177807|dbj|BAJ55596.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F16]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|297380233|gb|ADI35120.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori v225d]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|254779611|ref|YP_003057717.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B38]
 gi|254001523|emb|CAX29541.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Helicobacter pylori B38]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|326797449|ref|YP_004315268.1| phosphoglycerate dehydrogenase [Sphingobacterium sp. 21]
 gi|326548213|gb|ADZ76598.1| Phosphoglycerate dehydrogenase [Sphingobacterium sp. 21]
          Length = 324

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++K +GRAG G DN+D  +A   GI ++N P GN    AEH I ++LA+   + 
Sbjct: 66  VLHVAQRLKCIGRAGAGMDNIDEPLAVEKGIQLLNAPEGNRDAVAEHLIGMLLAMMNNLI 125

Query: 61  VANESTHKGKW 71
             N    +G+W
Sbjct: 126 RGNVQIREGQW 136


>gi|322496173|emb|CBZ31244.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 407

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+  +G   IGT+ VDL  A++ G+ V N+PF N+ + AE  I  +++++R+I 
Sbjct: 66  LLDAAPKLLAIGCFCIGTNQVDLNYANKRGVAVFNSPFANTRSVAELVIGEIISLSRKIT 125

Query: 61  VANESTHKGKWEK 73
             +E  H+G W K
Sbjct: 126 QRSEEVHRGVWNK 138


>gi|308183160|ref|YP_003927287.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
 gi|308065345|gb|ADO07237.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|308063839|gb|ADO05726.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Sat464]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|188527838|ref|YP_001910525.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
 gi|188144078|gb|ACD48495.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|159186584|ref|NP_396261.2| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Agrobacterium tumefaciens str. C58]
 gi|159141644|gb|AAK90702.2| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Agrobacterium tumefaciens str. C58]
          Length = 349

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  ++V+ + G+G DN+D+  ASR  I V+     N+++ AEHAI+L+ A+ ++I   + 
Sbjct: 86  APSLRVLSKHGVGVDNIDVDAASRREIPVVVAAGANALSVAEHAITLLFAVVKRIVPLDS 145

Query: 65  STHKGKWEKFNFMGVE 80
               G+WEK  + G E
Sbjct: 146 GIRAGRWEKAGYSGKE 161


>gi|119952755|ref|YP_950271.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Arthrobacter aurescens TC1]
 gi|119951885|gb|ABM10794.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Arthrobacter aurescens TC1]
          Length = 329

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K++ R G+GTDNVD+  AS   + V +TP  NS   AEH  SL+L++ R+I 
Sbjct: 56  MIEASPRLKIIARHGVGTDNVDIPAASEHSVWVTSTPGSNSNAVAEHVFSLLLSLTRRII 115

Query: 61  VANESTHKGKWEK 73
            A      G W +
Sbjct: 116 PAANRVLAGTWAE 128


>gi|251794013|ref|YP_003008745.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535412|gb|ACS98658.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Aggregatibacter
           aphrophilus NJ8700]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIAAAPKLIAIGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANADVHRGLWNK 142


>gi|86159382|ref|YP_466167.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775893|gb|ABC82730.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 399

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +V RAG G + +D+  ASR G+ V N P  NSI  AE AI L++A+ R+IP
Sbjct: 56  VFERAPGLSLVVRAGAGVNTIDVAAASRRGVYVTNCPGQNSIAVAELAIGLLVALDRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               +   G+W+K  F   E 
Sbjct: 116 DNVAALRAGRWDKKRFSEAEG 136


>gi|255710785|ref|XP_002551676.1| KLTH0A05038p [Lachancea thermotolerans]
 gi|238933053|emb|CAR21234.1| KLTH0A05038p [Lachancea thermotolerans]
          Length = 470

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK + V+G   IGT+ VDL  A++ G+ V N+PF NS + AE  ++ ++++ARQ+ 
Sbjct: 117 VLKHAKNLVVIGCFCIGTNQVDLDYAAKIGVAVFNSPFSNSRSVAELIMAEVISLARQLG 176

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 177 DRSIEMHTGTWNK 189


>gi|212536012|ref|XP_002148162.1| D-3-phosphoglycerate dehydrogenase [Penicillium marneffei ATCC
           18224]
 gi|210070561|gb|EEA24651.1| D-3-phosphoglycerate dehydrogenase [Penicillium marneffei ATCC
           18224]
          Length = 479

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 127 VLKEAKNLIVIGCFCIGTNQVDLKFAADNGIAVFNSPFSNSRSVAELVIAEIVVLARQLG 186

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 187 DRSNEMHNGTWNK 199


>gi|326389719|ref|ZP_08211284.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325994201|gb|EGD52628.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 318

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A + GI +  TP  N  + A+ A SLML ++R + 
Sbjct: 65  VLKNAKKLKVITKYGVGMDNIDIEEAEKLGIKITFTPGANKESVADLAFSLMLCLSRNVI 124

Query: 61  VANESTHKGKWEK 73
             +      KWEK
Sbjct: 125 KLDNIVRSNKWEK 137


>gi|256750679|ref|ZP_05491565.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750519|gb|EEU63537.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 318

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A + GI +  TP  N  + A+ A SLML ++R + 
Sbjct: 65  VLKNAKKLKVITKYGVGMDNIDIEEAEKLGIKITFTPGANKESVADLAFSLMLCLSRNVI 124

Query: 61  VANESTHKGKWEK 73
             +      KWEK
Sbjct: 125 KLDNIVRSNKWEK 137


>gi|239828219|ref|YP_002950843.1| glyoxylate reductase [Geobacillus sp. WCH70]
 gi|239808512|gb|ACS25577.1| Glyoxylate reductase [Geobacillus sp. WCH70]
          Length = 327

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV   G+G DN+D+  A++ GI V NTP   + TTA+   +L+LA AR+I 
Sbjct: 63  VLKAGKSLKVVANMGVGFDNIDVPAATKYGIAVCNTPDVLTDTTADLTFALLLATARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 123 EAAQFIKEGKWKSWS 137


>gi|167038448|ref|YP_001666026.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|297543719|ref|YP_003676021.1| Glyoxylate reductase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|320116842|ref|YP_004187001.1| Glyoxylate reductase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166857282|gb|ABY95690.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|296841494|gb|ADH60010.1| Glyoxylate reductase [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|319929933|gb|ADV80618.1| Glyoxylate reductase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 320

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A R GI +  TP  N  + A+   +LML ++R+I 
Sbjct: 65  VLRNAKKLKVITKYGVGVDNIDVDEAERMGIKITYTPDANKESVADLVFALMLGLSREII 124

Query: 61  VANESTHKGKWEK 73
             +      +WEK
Sbjct: 125 KLDNIVRNNRWEK 137


>gi|289577432|ref|YP_003476059.1| phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
 gi|289527145|gb|ADD01497.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
          Length = 320

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A R GI +  TP  N  + A+   +LML ++R+I 
Sbjct: 65  VLRNAKKLKVITKYGVGVDNIDVDEAERMGIKITYTPDANKESVADLVFALMLGLSREII 124

Query: 61  VANESTHKGKWEK 73
             +      +WEK
Sbjct: 125 KLDNIVRNNRWEK 137


>gi|167038809|ref|YP_001661794.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300913606|ref|ZP_07130923.1| Glyoxylate reductase [Thermoanaerobacter sp. X561]
 gi|307723379|ref|YP_003903130.1| Glyoxylate reductase [Thermoanaerobacter sp. X513]
 gi|166853049|gb|ABY91458.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300890291|gb|EFK85436.1| Glyoxylate reductase [Thermoanaerobacter sp. X561]
 gi|307580440|gb|ADN53839.1| Glyoxylate reductase [Thermoanaerobacter sp. X513]
          Length = 320

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A R GI +  TP  N  + A+   +LML ++R+I 
Sbjct: 65  VLRNAKKLKVITKYGVGVDNIDVDEAERMGIKITYTPDANKESVADLVFALMLGLSREII 124

Query: 61  VANESTHKGKWEK 73
             +      +WEK
Sbjct: 125 KLDNIVRNNRWEK 137


>gi|94313462|ref|YP_586671.1| D-3-phosphoglycerate dehydrogenase [Cupriavidus metallidurans CH34]
 gi|93357314|gb|ABF11402.1| D-3-phosphoglycerate dehydrogenase, NAD-binding [Cupriavidus
           metallidurans CH34]
          Length = 432

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 42/72 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
            + A+++  VG   IGT  VDL  A+ AGI V N PF N+ + AE  I   + + R+IP 
Sbjct: 91  FAKAQRLLTVGCFCIGTSQVDLGAAAHAGIPVFNAPFSNTRSVAELVIGQAIMLMRRIPE 150

Query: 62  ANESTHKGKWEK 73
            + + H G+W+K
Sbjct: 151 KSRAAHSGQWQK 162


>gi|307265744|ref|ZP_07547296.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919258|gb|EFN49480.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 318

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A + GI +  TP  N  + A+ A SLML ++R + 
Sbjct: 65  VLKNAKKLKVITKYGVGMDNIDIEEAEKLGIKITFTPGANKESVADLAFSLMLCLSRNVI 124

Query: 61  VANESTHKGKWEK 73
             +      KWEK
Sbjct: 125 KLDNIVRSNKWEK 137


>gi|240168941|ref|ZP_04747600.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium kansasii ATCC
           12478]
          Length = 528

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHAIALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +     W++ +F G E
Sbjct: 119 AADATLRVRTWKRSSFSGTE 138


>gi|196249255|ref|ZP_03147953.1| Glyoxylate reductase [Geobacillus sp. G11MC16]
 gi|196211012|gb|EDY05773.1| Glyoxylate reductase [Geobacillus sp. G11MC16]
          Length = 324

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +KVV   G+G DN+D+  A++ GIVV NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  VLSAGSALKVVANMGVGYDNIDVPAATQRGIVVCNTPDVLTDTTADLTFALLLATARRLV 122

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 123 EAADFLKEGKWKSWS 137


>gi|261342315|ref|ZP_05970173.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cancerogenus ATCC
           35316]
 gi|288315658|gb|EFC54596.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cancerogenus ATCC
           35316]
          Length = 410

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A+R GI V N PF N+ + AE  I  +L + R IP
Sbjct: 69  VIAAAEKLVAIGCFCIGTNQVDLNAAARRGIPVFNAPFSNTRSVAELVIGELLLLLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGVWNKLASGSFEA 149


>gi|138896552|ref|YP_001127005.1| glycerate dehydrogenase [Geobacillus thermodenitrificans NG80-2]
 gi|134268065|gb|ABO68260.1| Glycerate dehydrogenase [Geobacillus thermodenitrificans NG80-2]
          Length = 329

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +KVV   G+G DN+D+  A++ GIVV NTP   + TTA+   +L+LA AR++ 
Sbjct: 68  VLSAGSALKVVANMGVGYDNIDVPAATQRGIVVCNTPDVLTDTTADLTFALLLATARRLV 127

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 128 EAADFLKEGKWKSWS 142


>gi|323337971|gb|EGA79210.1| Ser3p [Saccharomyces cerevisiae Vin13]
 gi|323355279|gb|EGA87104.1| Ser3p [Saccharomyces cerevisiae VL3]
          Length = 453

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 100 VLQHAKNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLG 159

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 160 DRSIELHTGTWNK 172


>gi|52424123|ref|YP_087260.1| SerA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306175|gb|AAU36675.1| SerA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 326

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 4   HAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAN 63
            AK +KV+GR G+G D+VD+  A+  GI V+  P  N+ + AEHA +LM A A+ I  ++
Sbjct: 61  QAKNLKVIGRPGVGVDDVDVKTATELGIPVVIAPGSNTRSVAEHAFALMFACAKDIVRSD 120

Query: 64  ESTHKGKW 71
               KG +
Sbjct: 121 NEMRKGNF 128


>gi|6320925|ref|NP_011004.1| Ser3p [Saccharomyces cerevisiae S288c]
 gi|731484|sp|P40054|SERA_YEAST RecName: Full=D-3-phosphoglycerate dehydrogenase 1; Short=3-PGDH 1
 gi|603319|gb|AAB64636.1| Yer081wp [Saccharomyces cerevisiae]
 gi|151944798|gb|EDN63057.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae YJM789]
 gi|190405645|gb|EDV08912.1| 3-phosphoglycerate dehydrogenase [Saccharomyces cerevisiae RM11-1a]
 gi|256271443|gb|EEU06497.1| Ser3p [Saccharomyces cerevisiae JAY291]
 gi|259145999|emb|CAY79259.1| Ser3p [Saccharomyces cerevisiae EC1118]
 gi|285811714|tpg|DAA07742.1| TPA: Ser3p [Saccharomyces cerevisiae S288c]
 gi|323305254|gb|EGA59001.1| Ser3p [Saccharomyces cerevisiae FostersB]
 gi|323309409|gb|EGA62626.1| Ser3p [Saccharomyces cerevisiae FostersO]
 gi|323333765|gb|EGA75156.1| Ser3p [Saccharomyces cerevisiae AWRI796]
 gi|323348896|gb|EGA83133.1| Ser3p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 469

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++++ARQ+ 
Sbjct: 116 VLQHAKNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|323308676|gb|EGA61917.1| Ser33p [Saccharomyces cerevisiae FostersO]
          Length = 257

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 58  ILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLG 117

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 118 DRSIELHTGTWNK 130


>gi|313682014|ref|YP_004059752.1| d-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
 gi|313154874|gb|ADR33552.1| D-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
          Length = 529

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           KMK + RAG+G DNVD+   S+ GI+VMN P  N+I   E  ++ ML+  R  P +++  
Sbjct: 68  KMKAIVRAGVGVDNVDIPGCSKEGIIVMNVPTANTIAAVELTMTHMLSCMRMFPYSHDHL 127

Query: 67  HKGK-WEKFNFMGVE 80
              + W++  + G E
Sbjct: 128 KNQRIWKREKWYGYE 142


>gi|242794644|ref|XP_002482417.1| D-3-phosphoglycerate dehydrogenase [Talaromyces stipitatus ATCC
           10500]
 gi|218719005|gb|EED18425.1| D-3-phosphoglycerate dehydrogenase [Talaromyces stipitatus ATCC
           10500]
          Length = 479

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 127 VLKEAKNLIVIGCFCIGTNQVDLKFAADNGIAVFNSPFSNSRSVAELVIAEIVVLARQLG 186

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 187 DRSNEMHNGTWNK 199


>gi|313903578|ref|ZP_07836968.1| Glyoxylate reductase [Thermaerobacter subterraneus DSM 13965]
 gi|313466131|gb|EFR61655.1| Glyoxylate reductase [Thermaerobacter subterraneus DSM 13965]
          Length = 324

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 52/83 (62%), Gaps = 3/83 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G DNVD+  A R GI+V +TP   +  TA+ A++L+LA AR++P
Sbjct: 63  LLAGAPRLRVVSNCAVGYDNVDVQAAQRRGILVTHTPGVLTEATADLAMALILACARRLP 122

Query: 61  VANESTHKGKWEKFN---FMGVE 80
            A      G+W  ++   ++G+E
Sbjct: 123 QAEADLRAGRWTTWHPLQWLGLE 145


>gi|225011217|ref|ZP_03701676.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-3C]
 gi|225004631|gb|EEG42594.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-3C]
          Length = 315

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 45/80 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K +GR G G +N+DL  A+  G+ +   P GN     EH++ L+LA+ +++ 
Sbjct: 57  FLKAATNLKFIGRVGAGLENIDLATAAELGVFLAAAPEGNRNAVGEHSLGLLLALFQKLH 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++   +G W++    G+E
Sbjct: 117 TADQEVRQGIWDRSGNRGIE 136


>gi|254172865|ref|ZP_04879539.1| glyoxylate reductase [Thermococcus sp. AM4]
 gi|214033021|gb|EEB73849.1| glyoxylate reductase [Thermococcus sp. AM4]
          Length = 334

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A K+++V    +G DN+D+  A+R GI V NTP   +  TA+ A +L+LA AR++ 
Sbjct: 61  VFDNAPKLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLI 120

Query: 61  VANESTHKGKWEK 73
            A+  T  G+W+K
Sbjct: 121 EADNFTRSGEWKK 133


>gi|315223680|ref|ZP_07865531.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga ochracea F0287]
 gi|314946351|gb|EFS98349.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga ochracea F0287]
          Length = 320

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A ++K +GR G G +N+D+  A   GI ++  P GN     EHA+ ++LA+  +   
Sbjct: 58  LDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPEGNKNAVGEHALGMLLALLNKFKK 117

Query: 62  ANESTHKGKW 71
           AN     GKW
Sbjct: 118 ANNEIKNGKW 127


>gi|328862144|gb|EGG11246.1| hypothetical protein MELLADRAFT_92254 [Melampsora larici-populina
           98AG31]
          Length = 429

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A ++ V+G   IGT+ VDL  A+ AGI V N+PF NS + AE  I  ++A++RQ+   + 
Sbjct: 103 AGQLLVIGCFCIGTNQVDLTAAASAGISVFNSPFSNSRSVAELVIGEVIALSRQLFDRSA 162

Query: 65  STHKGKWEKFN 75
             H+G W K +
Sbjct: 163 ELHRGVWNKLS 173


>gi|312126740|ref|YP_003991614.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311776759|gb|ADQ06245.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 332

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K KV+GR G+G + +D+  A+  GI V+N P       ++HA++L+L +AR+I + N S 
Sbjct: 68  KCKVIGRYGVGVNTIDIEAATEKGICVVNVPDYCMDEVSDHALALILTLARKIVLLNNSV 127

Query: 67  HKGKWE 72
            KG W+
Sbjct: 128 KKGIWD 133


>gi|323144608|ref|ZP_08079196.1| phosphoglycerate dehydrogenase [Succinatimonas hippei YIT 12066]
 gi|322415617|gb|EFY06363.1| phosphoglycerate dehydrogenase [Succinatimonas hippei YIT 12066]
          Length = 411

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAK++  VG   IGT+ VDL  A+  GI V N PF N+ + AE      L + R +P
Sbjct: 70  VLQHAKRLVGVGCFCIGTNQVDLDAAAELGIPVFNAPFSNTRSVAELVTGEYLQLLRDVP 129

Query: 61  VANESTHKGKWEK 73
             N   H+G W+K
Sbjct: 130 ARNALLHRGGWKK 142


>gi|330945504|gb|EGH47050.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 300

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++  V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++AR I 
Sbjct: 37  MIEASPRLNAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARHIA 96

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +  T +G W+K    G+E
Sbjct: 97  WLDARTRQGHWDKATANGIE 116


>gi|310659117|ref|YP_003936838.1| phosphoglycerate dehydrogenase [Clostridium sticklandii DSM 519]
 gi|308825895|emb|CBH21933.1| Predicted phosphoglycerate dehydrogenase [Clostridium sticklandii]
          Length = 303

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 47/77 (61%)

Query: 4   HAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAN 63
           H   +K++ RAG+GTDN+D+  A++  I V NTP  ++ + AE A+  +L +AR I  + 
Sbjct: 61  HNGLLKMIVRAGVGTDNIDMDYANQLRIEVYNTPNASTDSVAELALGHLLVLARNINKSI 120

Query: 64  ESTHKGKWEKFNFMGVE 80
            S   G+W K  ++G E
Sbjct: 121 VSLRNGQWNKAAYLGTE 137


>gi|302780109|ref|XP_002971829.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
 gi|300160128|gb|EFJ26746.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
          Length = 625

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNV+L  A+  G +V+N P  N++  AEHAI+L+ A+AR +  AN S 
Sbjct: 142 RLKVVGRAGVGIDNVNLQAATEKGCLVVNAPTANTVAAAEHAIALLAALARNVAQANASV 201

Query: 67  HKGKWEKFNFMGV 79
             G W++  + GV
Sbjct: 202 KSGSWQRSKYTGV 214


>gi|154331555|ref|XP_001561595.1| D-3-phosphoglycerate dehydrogenase-like protein [Leishmania
           braziliensis MHOM/BR/75/M2904]
 gi|134058914|emb|CAM36741.1| D-3-phosphoglycerate dehydrogenase-like protein [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 408

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++  +G   IGT+ VDL  A++ G+VV N+PF N+ + AE  I  ++A++R+I 
Sbjct: 67  LLDAAPQLLAIGCFCIGTNQVDLDYANKRGVVVFNSPFANTRSVAELVIGEVIALSRKIT 126

Query: 61  VANESTHKGKWEK 73
             +E  H+G W K
Sbjct: 127 QRSEEVHQGVWRK 139


>gi|148827662|ref|YP_001292415.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittGG]
 gi|148718904|gb|ABR00032.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittGG]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|319649401|ref|ZP_08003559.1| hypothetical protein HMPREF1013_00163 [Bacillus sp. 2_A_57_CT2]
 gi|317399035|gb|EFV79715.1| hypothetical protein HMPREF1013_00163 [Bacillus sp. 2_A_57_CT2]
          Length = 331

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 48/80 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++KV+GR G+G DN+D   A + GI V+     N+ + AE+ +  ML+++R + 
Sbjct: 74  LMAAGPQLKVIGRLGVGLDNIDTASAKKMGIPVVYAKNANATSVAEYVMMAMLSVSRPLH 133

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +A+     G W++  + G+E
Sbjct: 134 LADYDVRNGNWDRKTYTGME 153


>gi|255034232|ref|YP_003084853.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dyadobacter fermentans DSM 18053]
 gi|254946988|gb|ACT91688.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dyadobacter fermentans DSM 18053]
          Length = 337

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 44/80 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML +AK ++ + RAG G D +DL VA    I V +   GN    AEHA+ ++LA+   I 
Sbjct: 86  MLENAKNLRFIARAGAGLDLIDLNVARELNIEVFHAGTGNRDAVAEHALGMLLALFTNIL 145

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++    G W++    GVE
Sbjct: 146 RADQQVRNGIWDREGNRGVE 165


>gi|109947057|ref|YP_664285.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714278|emb|CAJ99286.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
          Length = 524

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRLFPCANDQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|71278422|ref|YP_268286.1| D-3-phosphoglycerate dehydrogenase [Colwellia psychrerythraea 34H]
 gi|71144162|gb|AAZ24635.1| D-3-phosphoglycerate dehydrogenase [Colwellia psychrerythraea 34H]
          Length = 417

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHA K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +   L + R IP
Sbjct: 72  VLSHANKLVAIGCFCIGTNQVDLKAAQTRGIPVFNAPFSNTRSVAELVLGETLLLLRGIP 131

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +   H+G+W K     VEA
Sbjct: 132 EKSAKAHRGEWLKSAVGSVEA 152


>gi|291280499|ref|YP_003497334.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic component
           [Deferribacter desulfuricans SSM1]
 gi|290755201|dbj|BAI81578.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic component
           [Deferribacter desulfuricans SSM1]
          Length = 316

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A  +KVV    +G +N+D+  A++ G+VV NTP   + TTAE   +LM+++AR++ 
Sbjct: 58  LFDNAPNLKVVANYAVGYNNIDVEYATKKGVVVCNTPDVLTETTAELGFALMISLARRVV 117

Query: 61  VANESTHKGKWEKFN---FMGVE 80
            A++ T +GK+E +    F+G +
Sbjct: 118 EADKFTREGKFEGWTPNLFLGTD 140


>gi|294948457|ref|XP_002785760.1| D-3-phosphoglycerate dehydrogenase, putative [Perkinsus marinus
           ATCC 50983]
 gi|239899808|gb|EER17556.1| D-3-phosphoglycerate dehydrogenase, putative [Perkinsus marinus
           ATCC 50983]
          Length = 318

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 38/65 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
            SHAKK+KV+ RAG G D +DL  A+R G+ V NTP  NS   AE A  ++LA  R    
Sbjct: 67  FSHAKKLKVLVRAGAGVDAIDLAAATRHGVCVQNTPGQNSNAVAELAFGMLLAHKRNYFD 126

Query: 62  ANEST 66
            N  T
Sbjct: 127 GNSGT 131


>gi|212640237|ref|YP_002316757.1| 2-hydroxyacid dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212561717|gb|ACJ34772.1| 2-hydroxyacid dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 320

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L ++  ++VV    +G DN+D+  A++ GI+V NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  LLKNSPHLRVVANVAVGYDNIDVNAATKRGIIVCNTPDVLTETTADLTFALLLATARRLV 122

Query: 61  VANESTHKGKWEKFN 75
            A E   KG+W+ ++
Sbjct: 123 EATEFIKKGEWKSWS 137


>gi|89100552|ref|ZP_01173412.1| hypothetical protein B14911_09477 [Bacillus sp. NRRL B-14911]
 gi|89084739|gb|EAR63880.1| hypothetical protein B14911_09477 [Bacillus sp. NRRL B-14911]
          Length = 321

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVV    +G DN+D+  A+  GI V NTP   + TTA+   +L++A AR+I 
Sbjct: 62  LLAEAHRLKVVANLAVGYDNIDVKAAAEKGITVANTPDVLTDTTADLTFALLMAAARRIT 121

Query: 61  VANESTHKGKWEKFN 75
            + E   +GKW+ ++
Sbjct: 122 ESAEYVKEGKWKSWS 136


>gi|239625825|ref|ZP_04668856.1| D-3-phosphoglycerate dehydrogenase [Clostridiales bacterium
           1_7_47_FAA]
 gi|239520055|gb|EEQ59921.1| D-3-phosphoglycerate dehydrogenase [Clostridiales bacterium
           1_7_47FAA]
          Length = 307

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S A  +KV+G+ G+G + +DL  A   GI V+NTPF N+ + AE  + LML I+R I 
Sbjct: 47  IMSRAVNLKVIGKHGVGCNTIDLAAAKELGIPVINTPFANTNSVAELIVGLMLDISRNIS 106

Query: 61  VANESTHKGKWEKF 74
             ++   K + E F
Sbjct: 107 ACDK---KSRGEGF 117


>gi|145636267|ref|ZP_01791936.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittHH]
 gi|145270432|gb|EDK10366.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittHH]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|330684926|gb|EGG96608.1| 4-phosphoerythronate dehydrogenase [Staphylococcus epidermidis
           VCU121]
          Length = 198

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L++A  +K++    +G DN+D+ +A++ GI V NTP   + TTAE   +LMLA AR+I  
Sbjct: 62  LANAPHLKIIANMAVGYDNIDVNLANQKGIKVTNTPEVLTETTAELGFTLMLATARRIVE 121

Query: 62  ANESTHKGKWEKF 74
           A +   +G+W+ +
Sbjct: 122 AEKYVQEGQWKSW 134


>gi|260582269|ref|ZP_05850062.1| phosphoglycerate dehydrogenase [Haemophilus influenzae NT127]
 gi|260094637|gb|EEW78532.1| phosphoglycerate dehydrogenase [Haemophilus influenzae NT127]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|255038435|ref|YP_003089056.1| D-3-phosphoglycerate dehydrogenase [Dyadobacter fermentans DSM
           18053]
 gi|254951191|gb|ACT95891.1| HAD-superfamily hydrolase, subfamily IB (PSPase- like) [Dyadobacter
           fermentans DSM 18053]
          Length = 635

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA ++  +G   IGT+ +DL  A++ GI V N P+ N+ +  E A+  M+ + R I 
Sbjct: 295 VLEHANRLMAIGAFCIGTNQIDLDEAAKKGIAVFNAPYSNTRSVVELAVGEMILLIRNIV 354

Query: 61  VANESTHKGKWEK 73
             + S HKG W+K
Sbjct: 355 GKSNSMHKGIWDK 367


>gi|145634538|ref|ZP_01790247.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittAA]
 gi|145268083|gb|EDK08078.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittAA]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|118617543|ref|YP_905875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium ulcerans Agy99]
 gi|118569653|gb|ABL04404.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium ulcerans
           Agy99]
          Length = 528

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVDAATTRGVLVVNAPTSNIHSAAEHAMALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGAE 138


>gi|317121076|ref|YP_004101079.1| glyoxylate reductase [Thermaerobacter marianensis DSM 12885]
 gi|315591056|gb|ADU50352.1| Glyoxylate reductase [Thermaerobacter marianensis DSM 12885]
          Length = 325

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G DNVD+  A R G++V +TP   +  TA+ A +L+LA AR++P
Sbjct: 64  LLAAAPRLRVVSNCAVGYDNVDVAAARRRGVMVTHTPGVLTEATADLAFALILACARRLP 123

Query: 61  VANESTHKGKWEKFN---FMGVE 80
            A      G+W  ++   ++G+E
Sbjct: 124 QAEADLRAGRWTTWHPLQWLGLE 146


>gi|145632731|ref|ZP_01788465.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 3655]
 gi|229844375|ref|ZP_04464515.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 6P18H1]
 gi|144986926|gb|EDJ93478.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 3655]
 gi|229812624|gb|EEP48313.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 6P18H1]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|68249067|ref|YP_248179.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae
           86-028NP]
 gi|68057266|gb|AAX87519.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae
           86-028NP]
          Length = 410

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|290511927|ref|ZP_06551295.1| D-isomer specific 2-hydroxyacid dehydrogenase [Klebsiella sp.
           1_1_55]
 gi|289775717|gb|EFD83717.1| D-isomer specific 2-hydroxyacid dehydrogenase [Klebsiella sp.
           1_1_55]
          Length = 317

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KVV R G G D VDL  A R G+VV+N P  NS++ AE  I  ML  +R   +  E
Sbjct: 62  AKKLKVVARHGAGYDTVDLESAKRHGVVVLNAPIANSMSVAELTIFYMLHCSRNFKLVEE 121

Query: 65  S-THKGKWEKFNFMGVE 80
                  W K     VE
Sbjct: 122 KMLEDYYWAKLRTPKVE 138


>gi|183981728|ref|YP_001850019.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
 gi|183175054|gb|ACC40164.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
          Length = 528

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVDAATTRGVLVVNAPTSNIHSAAEHAMALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  +  W++ +F G E
Sbjct: 119 AADASLREHTWKRSSFSGAE 138


>gi|149277462|ref|ZP_01883603.1| phosphoglycerate dehydrogenase [Pedobacter sp. BAL39]
 gi|149231695|gb|EDM37073.1| phosphoglycerate dehydrogenase [Pedobacter sp. BAL39]
          Length = 309

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+K + RAG G DN+D  VA    I ++N P GN     EHA+ LML++     
Sbjct: 60  LIDAGTKLKFIARAGAGLDNIDEAVALERNIHLINAPEGNMDAVGEHAVGLMLSLMNNFR 119

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+    KGKW++    G E
Sbjct: 120 NADMEIRKGKWDREGNRGYE 139


>gi|317178639|dbj|BAJ56427.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F30]
          Length = 524

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 68  KGK-WEKFNFMGVE 80
           + + W++ ++ G E
Sbjct: 126 RQRLWKREDWYGTE 139


>gi|188587665|ref|YP_001922582.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188497946|gb|ACD51082.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E3 str. Alaska E43]
          Length = 302

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M +++R I +AN +  
Sbjct: 66  LKLIIRAGVGIDNIDISHAVKNNLSVTNTPSASSDSVAELALAHMFSVSRFIGIANVTMR 125

Query: 68  KGKWEKFNFMGVE 80
            G+W K  + G E
Sbjct: 126 NGEWNKKKYQGFE 138


>gi|295401385|ref|ZP_06811356.1| Glyoxylate reductase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109655|ref|YP_003987971.1| glyoxylate reductase [Geobacillus sp. Y4.1MC1]
 gi|294976600|gb|EFG52207.1| Glyoxylate reductase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214756|gb|ADP73360.1| Glyoxylate reductase [Geobacillus sp. Y4.1MC1]
          Length = 326

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV   G+G DN+D+  A++ GI V NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  ILEAGKSLKVVANMGVGFDNIDIPAATKHGIAVCNTPDVLTDTTADLTFALLLATARRVV 122

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 123 EAAQWIKEGKWKSWS 137


>gi|326332131|ref|ZP_08198415.1| D-3-phosphoglycerate dehydrogenase [Nocardioidaceae bacterium
           Broad-1]
 gi|325950102|gb|EGD42158.1| D-3-phosphoglycerate dehydrogenase [Nocardioidaceae bacterium
           Broad-1]
          Length = 398

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K +G   IGT+ VDL  A+  G+ V N P+ N+ +  E  I  ++++AR++P
Sbjct: 58  VLDAATDLKAIGCFCIGTNQVDLAGAAERGVAVFNAPYSNTRSVVELVIGYIISLARRLP 117

Query: 61  VANESTHKGKWEK 73
              E  H G W+K
Sbjct: 118 EKTEKMHAGVWDK 130


>gi|314933142|ref|ZP_07840507.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus caprae C87]
 gi|313653292|gb|EFS17049.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus caprae C87]
          Length = 322

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 44/74 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++    +G DN+D+  A+  GI V NTP   + TTAE   +LML +AR+I 
Sbjct: 61  VLKEASKLKIIANMAVGYDNIDVQKANDNGITVTNTPDILTETTAELGFTLMLTVARRIV 120

Query: 61  VANESTHKGKWEKF 74
            A     +G+W+ +
Sbjct: 121 EAERYVQEGQWQSW 134


>gi|221199408|ref|ZP_03572452.1| formate dehydrogenase (NAD-dependent formatedehydrogenase) (FDH)
           [Burkholderia multivorans CGD2M]
 gi|221205689|ref|ZP_03578704.1| formate dehydrogenase (NAD-dependent formatedehydrogenase) (FDH)
           [Burkholderia multivorans CGD2]
 gi|221174527|gb|EEE06959.1| formate dehydrogenase (NAD-dependent formatedehydrogenase) (FDH)
           [Burkholderia multivorans CGD2]
 gi|221180693|gb|EEE13096.1| formate dehydrogenase (NAD-dependent formatedehydrogenase) (FDH)
           [Burkholderia multivorans CGD2M]
          Length = 386

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+K+   AGIG+D+VDL  A+  GIVV    F NSI+ AEH +  +LA+ R    
Sbjct: 110 IAKATKLKLALTAGIGSDHVDLQAATERGIVVAEETFSNSISVAEHVVMTVLALVRNFLP 169

Query: 62  ANESTHKGKW 71
           A+     G W
Sbjct: 170 AHRFAVDGGW 179


>gi|254255323|ref|ZP_04948639.1| Lactate dehydrogenase [Burkholderia dolosa AUO158]
 gi|124901060|gb|EAY71810.1| Lactate dehydrogenase [Burkholderia dolosa AUO158]
          Length = 386

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+K+   AGIG+D+VDL  A+  GIVV    F NSI+ AEH +  +LA+ R    
Sbjct: 110 IAKATKLKLALTAGIGSDHVDLQAATERGIVVAEETFSNSISVAEHVVMTVLALVRNFLP 169

Query: 62  ANESTHKGKW 71
           A+     G W
Sbjct: 170 AHRFAVDGGW 179


>gi|31505490|gb|AAO62580.1| phosphoglycerate dehydrogenase-like protein [Anabaena sp. 90]
 gi|31616728|emb|CAD60095.1| phosphoglycerate dehydrogenase homologue [Anabaena circinalis 90]
          Length = 337

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 43/67 (64%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AK +KV+  +G GTD +D+  A++ GIVV+N P  ++    EH +S++LA+A+++   N+
Sbjct: 77  AKNLKVISTSGFGTDAIDIAAATKRGIVVVNNPGLSTTAVTEHTLSMILALAKKLTFLNQ 136

Query: 65  STHKGKW 71
               G +
Sbjct: 137 CVKAGNY 143


>gi|315586946|gb|ADU41327.1| possible phosphoglycerate dehydrogenase [Helicobacter pylori 35A]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN    
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANNQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|68445555|dbj|BAE03264.1| phosphoglycerate dehydrogenase [unclutured Candidatus Nitrosocaldus
           sp.]
          Length = 312

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +K++ R G+G DN+D+  A   GI V+N         AE  I LM+ +AR I 
Sbjct: 61  VIDAAQNLKIIARVGVGLDNIDVEYAKSKGIKVVNAEEAAMSAVAELVIGLMICLARGIV 120

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W K   MG+E
Sbjct: 121 RADTTMKQGRWIKSELMGIE 140


>gi|317180143|dbj|BAJ57929.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F32]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES-T 66
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN    
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANNQIK 125

Query: 67  HKGKWEKFNFMGVE 80
           H+  W++ ++ G E
Sbjct: 126 HQRLWKREDWYGTE 139


>gi|254451934|ref|ZP_05065371.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198266340|gb|EDY90610.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 302

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 40/58 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           L  A +++++ + G GTD++DL  A+  GIVV N P GNS+  AEH ++LML  A+Q+
Sbjct: 45  LDRAPRLRLIHQHGRGTDSLDLAAATERGIVVANVPGGNSVAVAEHCLALMLFQAKQL 102


>gi|209547232|ref|YP_002279150.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538476|gb|ACI58410.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 412

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S AKK+  VG   +GT+ VDL  A R GI V N P+ N+ + AE  I  ++ + R+I 
Sbjct: 70  IFSSAKKLMAVGCFSVGTNQVDLDAARRRGIPVFNAPYSNTRSVAELVIGEIIMLTRRIF 129

Query: 61  VANESTHKGKWEK 73
             + S H+G W+K
Sbjct: 130 PRSASAHEGGWDK 142


>gi|71064945|ref|YP_263672.1| D-3-phosphoglycerate dehydrogenase [Psychrobacter arcticus 273-4]
 gi|71037930|gb|AAZ18238.1| D-3-phosphoglycerate dehydrogenase [Psychrobacter arcticus 273-4]
          Length = 408

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  ++  + + R IP
Sbjct: 68  VLEHAQKLIGIGCFCIGTNQVDLDAAREFGIPVFNAPFSNTRSVAELVLAEAIMLYRGIP 127

Query: 61  VANESTHKGKWEK 73
             N + H+G W K
Sbjct: 128 EKNATVHRGGWGK 140


>gi|85711163|ref|ZP_01042223.1| D-3-phosphoglycerate dehydrogenase [Idiomarina baltica OS145]
 gi|85695076|gb|EAQ33014.1| D-3-phosphoglycerate dehydrogenase [Idiomarina baltica OS145]
          Length = 409

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (57%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A + G+VV N PF N+ + AE  ++  + + R IP  N 
Sbjct: 73  AEKLIAVGCFCIGTNQVDLKAAQKHGVVVFNAPFSNTRSVAELVLAETIMLLRGIPQKNA 132

Query: 65  STHKGKWEK 73
             HKG W K
Sbjct: 133 QAHKGGWLK 141


>gi|317182310|dbj|BAJ60094.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F57]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 68  KGK-WEKFNFMGVE 80
           + + W++ ++ G E
Sbjct: 126 RQRLWKREDWYGTE 139


>gi|302390429|ref|YP_003826250.1| Glyoxylate reductase [Thermosediminibacter oceani DSM 16646]
 gi|302201057|gb|ADL08627.1| Glyoxylate reductase [Thermosediminibacter oceani DSM 16646]
          Length = 320

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+KV+ + G+G DN+D+  A + G+ +  TP  N+ + A+   SLML ++R + 
Sbjct: 65  VLKNAKKLKVITKYGVGVDNIDIEEADKLGVKITYTPGANTESVADLTFSLMLCLSRNVI 124

Query: 61  VANESTHKGKWEK 73
             +      KWEK
Sbjct: 125 KLDNIVRSNKWEK 137


>gi|261420402|ref|YP_003254084.1| glyoxylate reductase [Geobacillus sp. Y412MC61]
 gi|319768068|ref|YP_004133569.1| glyoxylate reductase [Geobacillus sp. Y412MC52]
 gi|261376859|gb|ACX79602.1| Glyoxylate reductase [Geobacillus sp. Y412MC61]
 gi|317112934|gb|ADU95426.1| Glyoxylate reductase [Geobacillus sp. Y412MC52]
          Length = 324

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    ++VV   G+G DN+D+  A++ GI+V NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  VLSAGSALQVVANMGVGYDNIDVPAATKRGILVCNTPDVLTDTTADLTFALLLATARRLV 122

Query: 61  VANESTHKGKWEKFN 75
            A E   +GKW+ ++
Sbjct: 123 EAAEFLKEGKWKSWS 137


>gi|156064373|ref|XP_001598108.1| hypothetical protein SS1G_00194 [Sclerotinia sclerotiorum 1980]
 gi|154691056|gb|EDN90794.1| hypothetical protein SS1G_00194 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 470

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + VVG   IGT+ VDL  A+  GI V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 118 VLREAKNLIVVGCFCIGTNQVDLEYAAAHGIAVFNSPFANSRSVAELVIAEIIVLARQLG 177

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 178 DRSNELHNGTWNK 190


>gi|261839790|gb|ACX99555.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 52]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 68  KGK-WEKFNFMGVE 80
           + + W++ ++ G E
Sbjct: 126 RQRLWKREDWYGTE 139


>gi|217034326|ref|ZP_03439742.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
 gi|216943211|gb|EEC22678.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 68  KGK-WEKFNFMGVE 80
           + + W++ ++ G E
Sbjct: 126 RQRLWKREDWYGTE 139


>gi|91216104|ref|ZP_01253072.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
 gi|91185621|gb|EAS71996.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
          Length = 303

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A ++K +GR G G +N+D+  A   GI + N P GN    +EHA+ ++L++  ++ 
Sbjct: 45  FLDKATRLKFIGRVGAGLENIDVDYAREKGIQLYNAPEGNRNAVSEHALGMLLSLFNKLR 104

Query: 61  VANESTHKGKWEK 73
            A++    GKW +
Sbjct: 105 TAHDEVVNGKWRR 117


>gi|319898016|ref|YP_004136213.1| d-3-phosphoglycerate dehydrogenase [Haemophilus influenzae F3031]
 gi|317433522|emb|CBY81905.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae F3031]
          Length = 410

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|261838390|gb|ACX98156.1| 3-phosphoglycerate dehydrogenase [Helicobacter pylori 51]
          Length = 524

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K + RAG+G DN+DL   S+ GIVVMN P  N+I   E  ++ ++   R  P AN+   
Sbjct: 66  LKSIVRAGVGVDNIDLESCSQKGIVVMNIPTANTIAAVELTMAHLINAVRSFPCANDQIK 125

Query: 68  KGK-WEKFNFMGVE 80
           + + W++ ++ G E
Sbjct: 126 RQRLWKREDWYGTE 139


>gi|251781232|ref|ZP_04824148.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243081679|gb|EES47740.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 302

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M +++R I +AN +  
Sbjct: 66  LKLIIRAGVGIDNIDIPHAVKNNLSVTNTPSASSDSVAELALAHMFSVSRFIGIANVTMR 125

Query: 68  KGKWEKFNFMGVE 80
            G+W K  + G E
Sbjct: 126 NGEWNKKKYQGFE 138


>gi|149246996|ref|XP_001527923.1| D-3-phosphoglycerate dehydrogenase 1 [Lodderomyces elongisporus
           NRRL YB-4239]
 gi|146447877|gb|EDK42265.1| D-3-phosphoglycerate dehydrogenase 1 [Lodderomyces elongisporus
           NRRL YB-4239]
          Length = 463

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK + V+G   IGT+ VDL  A++ G+ V N+PF NS + AE  I+ ++ +ARQ+ 
Sbjct: 110 VLKQAKNLVVIGCFCIGTNQVDLEFAAKLGVAVFNSPFSNSRSVAELVIAEIITLARQLG 169

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 170 DRSIEMHTGTWNK 182


>gi|146312971|ref|YP_001178045.1| D-3-phosphoglycerate dehydrogenase [Enterobacter sp. 638]
 gi|145319847|gb|ABP61994.1| D-3-phosphoglycerate dehydrogenase [Enterobacter sp. 638]
          Length = 410

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A+R G+ V N PF N+ + AE  I  +L + R IP
Sbjct: 69  VIACAEKLVAIGCFCIGTNQVDLNAAARRGVPVFNAPFSNTRSVAELVIGELLLLLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGIWNKLASGSYEA 149


>gi|256820572|ref|YP_003141851.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Capnocytophaga ochracea DSM 7271]
 gi|256582155|gb|ACU93290.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Capnocytophaga ochracea DSM 7271]
          Length = 316

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A ++K +GR G G +N+D+  A   GI ++  P GN     EHA+ ++LA+  +   
Sbjct: 58  LDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPEGNRNAVGEHALGMLLALLNKFKK 117

Query: 62  ANESTHKGKW 71
           AN     GKW
Sbjct: 118 ANNEIKNGKW 127


>gi|283787857|ref|YP_003367722.1| hypothetical protein ROD_43131 [Citrobacter rodentium ICC168]
 gi|282951311|emb|CBG91010.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 317

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KVV R G G D VDL  A R G+V++N P  NS++ AE  I  ML  +R   +  E
Sbjct: 62  AKKLKVVARHGAGYDTVDLESAKRHGVVILNAPIANSMSVAELTIFYMLHCSRNFKLVEE 121

Query: 65  S-THKGKWEKFNFMGVE 80
                  W K     VE
Sbjct: 122 KMLEDYYWAKLRTPKVE 138


>gi|229846551|ref|ZP_04466659.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 7P49H1]
 gi|229810644|gb|EEP46362.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 7P49H1]
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|23099812|ref|NP_693278.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22778043|dbj|BAC14313.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 322

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK +KVV    +G DN+D+  AS+ GI V NTP   S TTA+   SL+ A AR+I 
Sbjct: 63  LLAEAKNLKVVANMAVGYDNIDIDAASKHGITVANTPDVLSETTADLGFSLLAATARRIT 122

Query: 61  VANESTHKGKWEKF 74
            A+    +  W+++
Sbjct: 123 EASTYVKEDNWKQW 136


>gi|330892127|gb|EGH24788.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 327

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K++ + G+G D +D+  A+  G+ V      N+ + AEHA +LM ++ARQ  
Sbjct: 62  MIQASPKLKIIAKHGVGYDTIDIQAAAEQGVPVTIALGANAQSVAEHAFALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVE 80
             +     G WEK    G E
Sbjct: 122 ALDARMRAGHWEKTTANGTE 141


>gi|306819975|ref|ZP_07453626.1| phosphoglycerate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304552011|gb|EFM39951.1| phosphoglycerate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 326

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (56%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K +G AGIG +++D+  A   GI + N P G++   +E AI  ML + R+I  AN   
Sbjct: 82  KLKAIGMAGIGLNHIDVEYAKSKGIGIFNVPDGSTTAVSELAIGTMLNVLRKIGNANTYV 141

Query: 67  HKGKWEKFNFMGVE 80
             G W+K  F G E
Sbjct: 142 KAGNWDKTGFTGNE 155


>gi|311747005|ref|ZP_07720790.1| D-3-phosphoglycerate dehydrogenase [Algoriphagus sp. PR1]
 gi|126578705|gb|EAZ82869.1| D-3-phosphoglycerate dehydrogenase [Algoriphagus sp. PR1]
          Length = 630

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++  VG   IGT+ +DL      GI V N PF N+ +  E AI+ ++ + R  P
Sbjct: 290 VLENANRLIAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVEMAIAEIIFLMRSFP 349

Query: 61  VANESTHKGKWEK 73
               + HKG WEK
Sbjct: 350 DKTMAMHKGSWEK 362


>gi|309972378|gb|ADO95579.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae R2846]
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGVWNK 142


>gi|315230890|ref|YP_004071326.1| glyoxylate reductase [Thermococcus barophilus MP]
 gi|315183918|gb|ADT84103.1| glyoxylate reductase [Thermococcus barophilus MP]
          Length = 336

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 48/73 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A +++++ +  +G DN+D+  A+R GI V NTP   +  TA+ A +L+LA ARQ+ 
Sbjct: 62  ILDNAPRLRIIAQYAVGYDNIDIEEATRRGIYVTNTPDVLTEATADFAWALLLATARQLV 121

Query: 61  VANESTHKGKWEK 73
            A++    G+W++
Sbjct: 122 DADKFVRSGEWKR 134


>gi|156932634|ref|YP_001436550.1| D-3-phosphoglycerate dehydrogenase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156530888|gb|ABU75714.1| hypothetical protein ESA_00416 [Cronobacter sakazakii ATCC BAA-894]
          Length = 412

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R IP
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGIWNKLATGSFEA 149


>gi|58038554|ref|YP_190518.1| D-3-phosphoglycerate dehydrogenase [Gluconobacter oxydans 621H]
 gi|58000968|gb|AAW59862.1| D-3-phosphoglycerate dehydrogenase [Gluconobacter oxydans 621H]
          Length = 416

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  ++ + R+IP
Sbjct: 70  VLEGADRLMAIGCFCIGTNQVDLNAARMLGIPVFNAPFSNTRSVAELVMGEIVMLLRRIP 129

Query: 61  VANESTHKGKWEK 73
             +E+ HKG W+K
Sbjct: 130 SRSEACHKGGWDK 142


>gi|18309036|ref|NP_560970.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens str. 13]
 gi|18143711|dbj|BAB79760.1| D-3-phosphoglycerate dehydrogenase [Clostridium perfringens str.
           13]
          Length = 301

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  KLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVE 80
             G W+K +++GVE
Sbjct: 126 KAGLWKKKDYVGVE 139


>gi|146340801|ref|YP_001205849.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium
           sp. ORS278]
 gi|146193607|emb|CAL77624.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium
           sp. ORS278]
          Length = 335

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 43/76 (56%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           ++K+K + + G+G DN+D+  A R GI V      NS + AE A +LM A+AR+IP  + 
Sbjct: 75  SQKLKAIAKHGVGYDNIDVEAADRRGIPVFVARGANSQSVAELAFALMFAVAREIPHLDA 134

Query: 65  STHKGKWEKFNFMGVE 80
               G W+K    G +
Sbjct: 135 RIKTGHWDKATTKGAQ 150


>gi|311103711|ref|YP_003976564.1| D-3-phosphoglycerate dehydrogenase 2 [Achromobacter xylosoxidans
           A8]
 gi|310758400|gb|ADP13849.1| D-3-phosphoglycerate dehydrogenase 2 [Achromobacter xylosoxidans
           A8]
          Length = 399

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    ++VVG   IGT+ VDL  A + GI V N PF N+ + AE  +   + + R+IP
Sbjct: 60  LLSGNLDLRVVGCFCIGTNQVDLDAAMQRGIPVFNAPFSNTRSVAELVLGEAILLLRRIP 119

Query: 61  VANESTHKGKWEK 73
             N   H+G W+K
Sbjct: 120 EKNARVHQGHWDK 132


>gi|145628841|ref|ZP_01784641.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 22.1-21]
 gi|145638620|ref|ZP_01794229.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittII]
 gi|144979311|gb|EDJ88997.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae 22.1-21]
 gi|145272215|gb|EDK12123.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae PittII]
 gi|309750119|gb|ADO80103.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae R2866]
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGIWNK 142


>gi|329122345|ref|ZP_08250932.1| D-3-phosphoglycerate dehydrogenase [Haemophilus aegyptius ATCC
           11116]
 gi|327473627|gb|EGF19046.1| D-3-phosphoglycerate dehydrogenase [Haemophilus aegyptius ATCC
           11116]
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGIWNK 142


>gi|323304489|gb|EGA58255.1| Ser33p [Saccharomyces cerevisiae FostersB]
          Length = 469

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA+ +  +G   IGT+ VDL  A+  GI V N+PF NS + AE  I  ++++ARQ+ 
Sbjct: 116 ILQHARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLG 175

Query: 61  VANESTHKGKWEK 73
             +   H G W K
Sbjct: 176 DRSIELHTGTWNK 188


>gi|319775607|ref|YP_004138095.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae F3047]
 gi|317450198|emb|CBY86414.1| D-3-phosphoglycerate dehydrogenase [Haemophilus influenzae F3047]
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R +P
Sbjct: 70  MIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFNAPFSNTRSVAELVLGEILLLMRNVP 129

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 130 QANAEVHRGIWNK 142


>gi|159041365|ref|YP_001540617.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Caldivirga maquilingensis IC-167]
 gi|157920200|gb|ABW01627.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Caldivirga maquilingensis IC-167]
          Length = 317

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ RAG+G DN+D+  A + G+ ++N+P   + + AE  +SLML I+R + 
Sbjct: 65  VIDRGASLKIIARAGVGLDNIDVDYALKRGLTIVNSPNAATYSAAELTLSLMLIISRNLH 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
           +       GKW K  + G+E
Sbjct: 125 LHLIDVKNGKWSKGLYHGIE 144


>gi|323143700|ref|ZP_08078371.1| putative glyoxylate reductase [Succinatimonas hippei YIT 12066]
 gi|322416533|gb|EFY07196.1| putative glyoxylate reductase [Succinatimonas hippei YIT 12066]
          Length = 319

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A+K K V R G+G DN+DL  A    I V N P   S   AEHA++L++   R+I 
Sbjct: 61  VFDAAEKCKAVVRYGVGVDNIDLAYAKSKNIKVANVPDYGSEDVAEHALALLMGATRRIV 120

Query: 61  VANESTHKGKW 71
             +E    GKW
Sbjct: 121 TRDEDVRNGKW 131


>gi|222080786|ref|YP_002542514.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium radiobacter K84]
 gi|221725465|gb|ACM28554.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 412

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S AKK+  VG   +GT+ VDL  A R GI V N P+ N+ + AE  I  ++ + R+I 
Sbjct: 70  IFSSAKKLIAVGCFSVGTNQVDLDAARRRGIPVFNAPYSNTRSVAELVIGEIIMLTRRIF 129

Query: 61  VANESTHKGKWEK 73
             + S H+G W+K
Sbjct: 130 PRSASAHEGGWDK 142


>gi|146085583|ref|XP_001465319.1| D-3-phosphoglycerate dehydrogenase [Leishmania infantum JPCM5]
 gi|321398856|emb|CBZ08307.1| D-3-phosphoglycerate dehydrogenase-like protein [Leishmania
           infantum JPCM5]
          Length = 407

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+  +G   IGT+ VDL  A++ G+ V N+PF N+ + AE  I  +++++R+I 
Sbjct: 66  ILDAAPKLLAIGCFCIGTNQVDLNYANKRGVAVFNSPFANTRSVAELVIGEIISLSRKIM 125

Query: 61  VANESTHKGKWEK 73
             +E  H+G W K
Sbjct: 126 QRSEEVHRGVWNK 138


>gi|311278167|ref|YP_003940398.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Enterobacter cloacae SCF1]
 gi|308747362|gb|ADO47114.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Enterobacter cloacae SCF1]
          Length = 410

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  VG   IGT+ VDL  A+R G+ V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAVGCFCIGTNQVDLDAAARRGVPVFNAPFSNTRSVAELVIGELLLLLRGVPEANA 132

Query: 65  STHKGKWEK 73
             H+G W K
Sbjct: 133 KAHRGLWNK 141


>gi|256422762|ref|YP_003123415.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chitinophaga pinensis DSM 2588]
 gi|256037670|gb|ACU61214.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chitinophaga pinensis DSM 2588]
          Length = 412

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K++ VG   IGT+ VDL  A   G+ V N P+ N+ + AE  I L + + R+IP
Sbjct: 72  VLEAATKLQAVGCFCIGTNQVDLKSARELGVAVFNAPYSNTRSVAELVIGLSIMLIRRIP 131

Query: 61  VANESTHKGKWEK 73
             N + H G W K
Sbjct: 132 DKNAAAHDGIWMK 144


>gi|239917378|ref|YP_002956936.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|281414138|ref|ZP_06245880.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|239838585|gb|ACS30382.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
          Length = 531

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE     +LA AR I  
Sbjct: 62  IAAAPQLKVIARAGVGLDNVDVPAATEAGVMVVNAPTSNIISAAELTCGHILAAARNIAA 121

Query: 62  ANESTHKGKWEKFNFMGVE 80
           AN S   G+W++  + G+E
Sbjct: 122 ANGSLKAGEWKRSKYTGLE 140


>gi|305662806|ref|YP_003859094.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
 gi|304377375|gb|ADM27214.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
          Length = 338

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AK +++V +  +G DN+D+  A+R GI V NTP   +  TAE   +L+L++AR+I 
Sbjct: 62  LLSQAKNLRIVAQLAVGYDNIDVECATRLGIYVTNTPGVLTEATAELTWALILSVARRIV 121

Query: 61  VANESTHKGKWEK 73
            A+     G+W +
Sbjct: 122 EADHYVRWGEWYR 134


>gi|110799921|ref|YP_694527.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens ATCC 13124]
 gi|110674568|gb|ABG83555.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens ATCC 13124]
          Length = 301

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  KLKLIIRGGVGLDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVE 80
             G W+K +++GVE
Sbjct: 126 KDGLWKKKDYVGVE 139


>gi|313900377|ref|ZP_07833871.1| putative glyoxylate reductase [Clostridium sp. HGF2]
 gi|312954926|gb|EFR36600.1| putative glyoxylate reductase [Clostridium sp. HGF2]
          Length = 309

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++ R G+G DN+D   A + GI V  T   N+   A++ I+LMLA  R + 
Sbjct: 63  VLDKADKLKIISRYGVGIDNIDTAEAEKRGIAVTVTKNCNTEAVADYTIALMLATLRHVC 122

Query: 61  VANESTHKGKWEK 73
             + S  KG W+K
Sbjct: 123 NVHSSLQKGIWKK 135


>gi|227499028|ref|ZP_03929165.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidaminococcus sp.
           D21]
 gi|226904477|gb|EEH90395.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidaminococcus sp.
           D21]
          Length = 318

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+ +K++ R GIG +N++L    + G+ V      N+ + AEHAI+LMLA  RQI   + 
Sbjct: 61  ARNLKIIARYGIGYENINLEACDKKGVTVTLARGCNTYSVAEHAITLMLAALRQISQLDR 120

Query: 65  STHKGKWE 72
              KG W+
Sbjct: 121 EVRKGDWK 128


>gi|260599254|ref|YP_003211825.1| D-3-phosphoglycerate dehydrogenase [Cronobacter turicensis z3032]
 gi|260218431|emb|CBA33539.1| D-3-phosphoglycerate dehydrogenase [Cronobacter turicensis z3032]
          Length = 428

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R IP
Sbjct: 85  IFAAAEKLVAVGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGIP 144

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 145 EANAKAHRGIWNKLATGSFEA 165


>gi|206578191|ref|YP_002236137.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Klebsiella pneumoniae 342]
 gi|206567249|gb|ACI09025.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Klebsiella pneumoniae 342]
          Length = 317

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 36/60 (60%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+KVV R G G D VDL  A R G+VV+N P  NS++ AE  I  ML  +R   +  E
Sbjct: 62  AKKLKVVARHGAGYDTVDLESAKRHGVVVLNAPIANSMSVAELTIFYMLHCSRNFKLVEE 121


>gi|149199039|ref|ZP_01876079.1| SerA [Lentisphaera araneosa HTCC2155]
 gi|149137828|gb|EDM26241.1| SerA [Lentisphaera araneosa HTCC2155]
          Length = 522

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 8   MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTH 67
           +K V RAG G + +D+  A    I VMNTP  NS   AE A+ +M++ AR     + ST 
Sbjct: 65  LKAVVRAGAGYNTIDIQYARSKDITVMNTPGANSNAVAEEAVGMMISCARFFIEGDRSTR 124

Query: 68  KGKWEKFNFMGVE 80
            G+W+K    G E
Sbjct: 125 AGEWKKAQLQGFE 137


>gi|206578579|ref|YP_002236625.1| phosphoglycerate dehydrogenase [Klebsiella pneumoniae 342]
 gi|288933603|ref|YP_003437662.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Klebsiella variicola At-22]
 gi|290511331|ref|ZP_06550700.1| D-3-phosphoglycerate dehydrogenase [Klebsiella sp. 1_1_55]
 gi|206567637|gb|ACI09413.1| phosphoglycerate dehydrogenase [Klebsiella pneumoniae 342]
 gi|288888332|gb|ADC56650.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Klebsiella variicola At-22]
 gi|289776324|gb|EFD84323.1| D-3-phosphoglycerate dehydrogenase [Klebsiella sp. 1_1_55]
          Length = 410

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P
Sbjct: 69  IFAAAEKLVAVGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGVWNKLAVGSFEA 149


>gi|149908680|ref|ZP_01897341.1| phosphoglycerate dehydrogenase [Moritella sp. PE36]
 gi|149808222|gb|EDM68161.1| phosphoglycerate dehydrogenase [Moritella sp. PE36]
          Length = 409

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+  +G   IGT+ VDL  A +A I V N PF N+ + AE  +  +L + R IP
Sbjct: 69  VIAAAKKLVGIGCFCIGTNQVDLAAAQKAAIPVFNAPFSNTRSVAELVLGEILLLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N   H+G+W+K
Sbjct: 129 EKNAKAHRGEWQK 141


>gi|331695673|ref|YP_004331912.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950362|gb|AEA24059.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 533

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ + ++KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA AR + 
Sbjct: 63  VLAASTRLKVVARAGVGLDNVDVPAATARGVMVVNAPTSNIVSAAEHAIALLLAAARHVA 122

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +G+W++  + GVE
Sbjct: 123 PADAALRQGQWKRSAYTGVE 142


>gi|283788431|ref|YP_003368296.1| D-3-phosphoglycerate dehydrogenase [Citrobacter rodentium ICC168]
 gi|282951885|emb|CBG91601.1| D-3-phosphoglycerate dehydrogenase [Citrobacter rodentium ICC168]
          Length = 410

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAIGCFCIGTNQVDLTAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANA 132

Query: 65  STHKGKWEKF 74
             H+G W K 
Sbjct: 133 KAHRGVWNKL 142


>gi|221131523|ref|XP_002160624.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 268

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           K+K+VGRAG G DN+D+  AS  G++VMNTP GN+I+ AE   +L+ ++A
Sbjct: 66  KLKLVGRAGTGVDNIDISSASSHGVLVMNTPDGNTISAAELTCTLISSLA 115


>gi|313157710|gb|EFR57121.1| D-phosphoglycerate dehydrogenase [Alistipes sp. HGB5]
          Length = 334

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR 57
           ++  A+ +K+V RAG G DNVDL  A+  GIVVMNTP  NS   AE A+++M+ +AR
Sbjct: 90  VIEAARNLKIVVRAGAGYDNVDLAAATARGIVVMNTPGQNSNAVAELALAMMIFMAR 146


>gi|108798878|ref|YP_639075.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119867993|ref|YP_937945.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
 gi|108769297|gb|ABG08019.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119694082|gb|ABL91155.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
          Length = 528

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 119 AADSTLRERTWKRSSFNGTE 138


>gi|323704547|ref|ZP_08116125.1| Glyoxylate reductase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536009|gb|EGB25782.1| Glyoxylate reductase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 319

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ + K +KV+ + G+G D +D+  A+R GI+V N P  N+   A+ A  L++ +AR + 
Sbjct: 66  VIENCKNLKVIAKHGVGVDGIDIKTANRLGIIVTNAPASNNQEVADLAFGLLIMLARGLY 125

Query: 61  VANESTHKGKWEK 73
            AN  T  G+W K
Sbjct: 126 QANYDTKAGRWIK 138


>gi|126434478|ref|YP_001070169.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
 gi|126234278|gb|ABN97678.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
          Length = 528

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ +  +  W++ +F G E
Sbjct: 119 AADSTLRERTWKRSSFNGTE 138


>gi|225548046|ref|ZP_03769331.1| hypothetical protein RUMHYD_00025 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040722|gb|EEG50968.1| hypothetical protein RUMHYD_00025 [Blautia hydrogenotrophica DSM
           10507]
          Length = 329

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (64%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           + ++  +KV+GR G+G D+VD+  A+  GI V+ TP  N+ + AEHA+++M A+++ +  
Sbjct: 56  IENSPNLKVIGRTGVGYDSVDVETATAHGIPVVITPGANNRSVAEHAVAMMFALSKNLVE 115

Query: 62  ANESTHKGKWE 72
           A     +G W+
Sbjct: 116 AQTEMCRGNWK 126


>gi|58258089|ref|XP_566457.1| D-3-phosphoglycerate dehydrogenase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57222594|gb|AAW40638.1| D-3-phosphoglycerate dehydrogenase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 594

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K + + G G D +D+V A + GI VMNTP  N+   AE A  +ML++ARQ P  +   
Sbjct: 98  KLKYISKQGTGVDKIDIVNAKKLGIPVMNTPGVNAQAVAELAFGMMLSLARQTPSIDRKI 157

Query: 67  HKG 69
            KG
Sbjct: 158 RKG 160


>gi|330505478|ref|YP_004382347.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina NK-01]
 gi|328919764|gb|AEB60595.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina NK-01]
          Length = 409

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (56%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP  N 
Sbjct: 73  AKKLVAVGCFCIGTNQVDLDAARERGIAVFNAPYSNTRSVAELVLAQAILLLRGIPEKNA 132

Query: 65  STHKGKWEK 73
           S H+G W K
Sbjct: 133 SCHRGGWIK 141


>gi|315929969|gb|EFV09120.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 133

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR 57
           L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR
Sbjct: 61  LNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSAR 116


>gi|111025626|ref|YP_708046.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110824605|gb|ABG99888.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 325

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFG-NSITTAEHAISLMLAIARQI 59
           ++     ++V+ RAG+G DN+D+  A+ AG+VV+  P G N+I+ AEH I + LA  R+ 
Sbjct: 65  LIEACPSLRVIARAGVGLDNIDVKCANEAGVVVV-APLGANAISVAEHTIGMALAAVRRT 123

Query: 60  PVANESTHKGKWEK 73
              +    +G WE+
Sbjct: 124 VELDADCRRGGWER 137


>gi|297528895|ref|YP_003670170.1| glyoxylate reductase [Geobacillus sp. C56-T3]
 gi|297252147|gb|ADI25593.1| Glyoxylate reductase [Geobacillus sp. C56-T3]
          Length = 324

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    ++VV   G+G DN+D+  A+  GI+V NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  VLSAGSALQVVANMGVGYDNIDVAAATHRGILVCNTPDVLTDTTADLTFALLLATARRLV 122

Query: 61  VANESTHKGKWEKFN 75
            A E   +GKW+ ++
Sbjct: 123 EAAEFLKEGKWKSWS 137


>gi|330987218|gb|EGH85321.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 306

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDCAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|153005766|ref|YP_001380091.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter sp. Fw109-5]
 gi|152029339|gb|ABS27107.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Anaeromyxobacter sp. Fw109-5]
          Length = 399

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 42/72 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A  + +V RAG G + +D+  ASR G+ V N P  NSI  AE AI L++A+ R+IP    
Sbjct: 60  APGLSLVVRAGAGVNTIDVAAASRRGVYVANCPGQNSIAVAELAIGLVVALDRRIPDNVA 119

Query: 65  STHKGKWEKFNF 76
               GKW+K  F
Sbjct: 120 LLRAGKWDKKTF 131


>gi|28872406|ref|NP_795025.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971995|ref|ZP_03400092.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           T1]
 gi|301384886|ref|ZP_07233304.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063032|ref|ZP_07254573.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           K40]
 gi|302133847|ref|ZP_07259837.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855661|gb|AAO58720.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923257|gb|EEB56855.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           T1]
 gi|330874161|gb|EGH08310.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967066|gb|EGH67326.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331017037|gb|EGH97093.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 409

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDSAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|82701562|ref|YP_411128.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Nitrosospira multiformis ATCC 25196]
 gi|82409627|gb|ABB73736.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Nitrosospira multiformis ATCC 25196]
          Length = 315

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S A+ +KVV R G G D+VDL  A R GI V+NTP   +   AE +++L++A  R+I 
Sbjct: 65  VFSCARSLKVVSRCGSGLDSVDLGAAKRHGIKVLNTPEAPAQAVAELSLALIMAALRKIC 124

Query: 61  VANESTHKGKWEK 73
             ++    G+W +
Sbjct: 125 QTDKQVRAGQWPR 137


>gi|108762751|ref|YP_634480.1| D-3-phosphoglycerate dehydrogenase [Myxococcus xanthus DK 1622]
 gi|108466631|gb|ABF91816.1| D-3-phosphoglycerate dehydrogenase [Myxococcus xanthus DK 1622]
          Length = 417

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L HA+ +  +G   IGT+ VDL  A+  GI V N PF N+ + AE  I+ ++ + RQ+  
Sbjct: 78  LEHAENLLAIGAFCIGTNQVDLTSANTHGIPVFNAPFSNTRSVAEMVIAEVIVLTRQLFE 137

Query: 62  ANESTHKGKWEK 73
            ++  H G+W K
Sbjct: 138 RSQEVHAGQWRK 149


>gi|315656840|ref|ZP_07909727.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|315492795|gb|EFU82399.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 431

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +   G   IGT+ +DL  A++ G+ V N P+ N+ + AE AI+ ++A+ARQ+P
Sbjct: 77  VFDECPDLVCAGTFTIGTNQIDLKEAAKHGVAVFNAPYSNTRSVAELAIAEIIALARQLP 136

Query: 61  VANESTHKGKWEK 73
           V N       W+K
Sbjct: 137 VRNAHLQNADWQK 149


>gi|330961905|gb|EGH62165.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 409

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDSAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|90023028|ref|YP_528855.1| D-3-phosphoglycerate dehydrogenase [Saccharophagus degradans 2-40]
 gi|89952628|gb|ABD82643.1| D-3-phosphoglycerate dehydrogenase [Saccharophagus degradans 2-40]
          Length = 411

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A K+   G   IGT+ VDL  A+  G+ V N P+ N+ + AE  I+  + + R IP
Sbjct: 71  VFENAPKLVAAGCFCIGTNQVDLQAATEHGVAVFNAPYSNTRSVAELVIAEAILLLRGIP 130

Query: 61  VANESTHKGKWEK 73
             N   H+G+W+K
Sbjct: 131 AKNAGCHRGEWQK 143


>gi|315655239|ref|ZP_07908140.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 51333]
 gi|315490494|gb|EFU80118.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 51333]
          Length = 413

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +   G   IGT+ +DL  A++ G+ V N P+ N+ + AE AI+ ++A+ARQ+P
Sbjct: 59  VFDECPDLVCAGTFTIGTNQIDLKEAAKHGVAVFNAPYSNTRSVAELAIAEIIALARQLP 118

Query: 61  VANESTHKGKWEK 73
           V N       W+K
Sbjct: 119 VRNAHLQNADWQK 131


>gi|221369409|ref|YP_002520505.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
 gi|221162461|gb|ACM03432.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
          Length = 316

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEK 73
             + S   G W++
Sbjct: 118 QGHASVTSGGWDR 130


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ ML+  R+ P
Sbjct: 61  FLNAAVNLKAIIRAGVGYDNVDMEGCSKRGIIAMNVPTANTIAAVELTMTHMLSCMRKFP 120

Query: 61  VA-NESTHKGKWEKFNFMGVE 80
            A N+  ++  W++ ++ G E
Sbjct: 121 YAHNQLKNERVWKREDWYGNE 141


>gi|295097448|emb|CBK86538.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 410

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R IP
Sbjct: 69  VIAAAEKLVAIGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGVWNKLAAGSYEA 149


>gi|77465409|ref|YP_354912.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Rhodobacter sphaeroides 2.4.1]
 gi|77389827|gb|ABA81011.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Rhodobacter sphaeroides 2.4.1]
          Length = 316

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEK 73
             + S   G W++
Sbjct: 118 QGHASVTSGGWDR 130


>gi|325954638|ref|YP_004238298.1| phosphoglycerate dehydrogenase [Weeksella virosa DSM 16922]
 gi|323437256|gb|ADX67720.1| Phosphoglycerate dehydrogenase [Weeksella virosa DSM 16922]
          Length = 316

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A K+K +GR G G +N+D   A+  GIV+ N+P GN  +  EHAI ++L +   +  
Sbjct: 58  IEKATKLKWIGRVGAGLENIDESFAAEKGIVLFNSPEGNRTSVGEHAIGMLLMLMHHLRR 117

Query: 62  ANESTHKGKWEK 73
           A+     G W +
Sbjct: 118 ADLEVRNGIWRR 129


>gi|298346694|ref|YP_003719381.1| phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 43063]
 gi|304389597|ref|ZP_07371559.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|298236755|gb|ADI67887.1| phosphoglycerate dehydrogenase [Mobiluncus curtisii ATCC 43063]
 gi|304327150|gb|EFL94386.1| D-3-phosphoglycerate dehydrogenase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 413

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +   G   IGT+ +DL  A++ G+ V N P+ N+ + AE AI+ ++A+ARQ+P
Sbjct: 59  VFDECPDLVCAGTFTIGTNQIDLKEAAKHGVAVFNAPYSNTRSVAELAIAEIIALARQLP 118

Query: 61  VANESTHKGKWEK 73
           V N       W+K
Sbjct: 119 VRNAHLQNADWQK 131


>gi|296104575|ref|YP_003614721.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059034|gb|ADF63772.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 410

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R IP
Sbjct: 69  VIAAAEKLVAIGCFCIGTNQVDLNAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGVWNKLAAGSYEA 149


>gi|283835322|ref|ZP_06355063.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291068484|gb|EFE06593.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 410

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P
Sbjct: 69  VIAAAEKLVAIGCFCIGTNQVDLSAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      EA
Sbjct: 129 EANAKAHRGVWNKLATGSFEA 149


>gi|71735117|ref|YP_276976.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555670|gb|AAZ34881.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 429

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 89  LFDCAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 148

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 149 EKNASCHRGGWIK 161


>gi|330429319|gb|AEC20653.1| D-3-phosphoglycerate dehydrogenase [Pusillimonas sp. T7-7]
          Length = 399

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  ++ VG   IGT+ VDL  A   G+ V N PF N+ + AE  +   + + R+IP
Sbjct: 60  LLAQAPDLRAVGCFCIGTNQVDLEAAMMHGVPVFNAPFSNTRSVAELVLGEAILLLRRIP 119

Query: 61  VANESTHKGKWEK 73
             N   H+G W+K
Sbjct: 120 EKNARVHQGHWDK 132


>gi|237802243|ref|ZP_04590704.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025100|gb|EGI05156.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 409

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDCAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|146387108|pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double
           Mutant Of E.Coli Phosphoglycerate Dehydrogenase
 gi|146387109|pdb|2P9G|B Chain B, Crystal Structure Of Serine Bound G336v,G337v Double
           Mutant Of E.Coli Phosphoglycerate Dehydrogenase
          Length = 410

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 5   AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P AN 
Sbjct: 73  AEKLVAIGAFAIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANA 132

Query: 65  STHKGKWEKF 74
             H+G W K 
Sbjct: 133 KAHRGVWNKL 142


>gi|330974548|gb|EGH74614.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 409

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDCAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|257483777|ref|ZP_05637818.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289626080|ref|ZP_06459034.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651108|ref|ZP_06482451.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289672288|ref|ZP_06493178.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           syringae FF5]
 gi|298489284|ref|ZP_07007300.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302187840|ref|ZP_07264513.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           syringae 642]
 gi|298156183|gb|EFH97287.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326268|gb|EFW82321.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331732|gb|EFW87670.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330868960|gb|EGH03669.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330872494|gb|EGH06643.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330891631|gb|EGH24292.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330899116|gb|EGH30535.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330944687|gb|EGH46626.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330954761|gb|EGH55021.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae Cit 7]
 gi|330982248|gb|EGH80351.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 409

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+  VG   IGT+ VDL  A   GI V N P+ N+ + AE  ++  + + R IP
Sbjct: 69  LFDCAKKLVAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIP 128

Query: 61  VANESTHKGKWEK 73
             N S H+G W K
Sbjct: 129 EKNASCHRGGWIK 141


>gi|212710020|ref|ZP_03318148.1| hypothetical protein PROVALCAL_01072 [Providencia alcalifaciens DSM
           30120]
 gi|212687227|gb|EEB46755.1| hypothetical protein PROVALCAL_01072 [Providencia alcalifaciens DSM
           30120]
          Length = 416

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A+K+  VG   IGT+ VDL  A++ GI V N PF N+ + AE  +  +L + R+IP
Sbjct: 69  IFASAEKLVAVGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAEMVLGQLLLLLRRIP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G WEK
Sbjct: 129 EANMQAHRGIWEK 141


>gi|220928617|ref|YP_002505526.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
 gi|219998945|gb|ACL75546.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
          Length = 535

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV GRAG G DN+++   ++ GI+V+NTP  N +  AE A+    AI R IP
Sbjct: 57  LLQRASKLKVAGRAGNGIDNIEVPACTKRGIIVVNTPESNIMAAAELAVGHAYAIFRNIP 116

Query: 61  VA 62
            A
Sbjct: 117 QA 118


>gi|213405501|ref|XP_002173522.1| D-3 phosphoglycerate dehydrogenase [Schizosaccharomyces japonicus