PSIBLAST alignment of GI: 254780152 and protein with PDB id: 1gdh

>gi|494035|pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320
>gi|494036|pdb|1GDH|B Chain B, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320
 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++      +K +    IG D++DL      GI V N P G ++ TAE A+ L+L  AR+ 
Sbjct: 60  VIDRIPENIKCISTYSIGFDHIDLDACKARGIKVGNAPHGVTVATAEIAMLLLLGSARRA 119

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
               +      W  +  +  E 
Sbjct: 120 GEGEKMIRTRSWPGWEPL--EL 139