PSIBLAST alignment of GI: 254780152 and protein with PDB id: 1mx3

>gi|27574013|pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347
 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 35/68 (51%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L   K ++++ R G G DN+D+  A   GI V N P  +   TA+  +  +L + R+   
Sbjct: 80  LEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATW 139

Query: 62  ANESTHKG 69
            +++  +G
Sbjct: 140 LHQALREG 147