PSIBLAST alignment of GI: 254780152 and protein with PDB id: 1wwk

gi|88191759|pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307
>gi|88191760|pdb|1WWK|B Chain B, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307
 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM ++AR+I 
Sbjct: 60  VIESAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFSVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 120 FADRKMREGVWAKKEAMGIEL 140