PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2g76

>gi|93279902|pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335
>gi|93279903|pdb|2G76|B Chain B, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335
 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 83  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 142

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 143 QATASMKDGKWERKKFMGTEL 163