PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2gsd

>gi|109158019|pdb|2GSD|A Chain A, Nad-Dependent Formate Dehydrogenase From Bacterium Moraxella Sp.C2 In Complex With Nad And Azide Length = 402
 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 38/71 (53%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+K+   AGIG+D+VDL  A    I V    + NS + AEH + ++L + R    
Sbjct: 109 IAKAPKLKLALTAGIGSDHVDLQAAIDNNITVAEVTYCNSNSVAEHVVMMVLGLVRNYIP 168

Query: 62  ANESTHKGKWE 72
           +++    G W 
Sbjct: 169 SHDWARNGGWN 179