PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2j6i

>gi|149242255|pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364
>gi|149242256|pdb|2J6I|B Chain B, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364
 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASR--AGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +  AKK+K+V  AG+G+D++DL   ++    I V+     N ++ AEH +  ML + R  
Sbjct: 79  IDKAKKLKLVVVAGVGSDHIDLDYINQTGKKISVLEVTGSNVVSVAEHVVMTMLVLVRNF 138

Query: 60  PVANESTHKGKWE 72
             A+E      WE
Sbjct: 139 VPAHEQIINHDWE 151