PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2nac

>gi|999845|pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393
>gi|999846|pdb|2NAC|B Chain B, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393
 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 41/71 (57%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +K+   AGIG+D+VDL  A    + V    + NSI+ AEH + ++L++ R    
Sbjct: 108 IAKAKNLKLALTAGIGSDHVDLQSAIDRNVTVAEVTYCNSISVAEHVVMMILSLVRNYLP 167

Query: 62  ANESTHKGKWE 72
           ++E   KG W 
Sbjct: 168 SHEWARKGGWN 178