PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2p9c

>gi|146387102|pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410
>gi|146387103|pdb|2P9C|B Chain B, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410
 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 44/73 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K+  +G   IGT+ VDL  A++ GI V N PF N+ + AE  I  +L + R +P
Sbjct: 69  VINAAEKLVAIGAFAIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVP 128

Query: 61  VANESTHKGKWEK 73
            AN   H+G W K
Sbjct: 129 EANAKAHRGVWNK 141