PSIBLAST alignment of GI: 254780152 and protein with PDB id: 2w2l

>gi|268612124|pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348
 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 1   MLSHAKK-MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++SH    +KV   AG G D +DL   +  G+   N+       T++ A+ L+L++ R  
Sbjct: 73  IISHLPSSLKVFAAAGAGFDWLDLDALNERGVAFANSRGAGDTATSDLALYLILSVFRLA 132

Query: 60  PVANESTHKGKWEKFNFMGVEAG 82
             +  +   G  E FN + +E G
Sbjct: 133 SYSERAARTGDPETFNRVHLEIG 155