PSIBLAST alignment of GI: 254780152 and protein with PDB id: 3ga0

>gi|227343811|pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358
 Score = 52.2 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 35/68 (51%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L   K ++++ R G G DN+D+  A   GI V N P  +   TA+  +  +L + R+   
Sbjct: 83  LEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTW 142

Query: 62  ANESTHKG 69
            +++  +G
Sbjct: 143 LHQALREG 150