PSIBLAST alignment of GI: 254780152 and protein with PDB id: 3gg9

>gi|225734260|pdb|3GG9|A Chain A, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352
>gi|225734261|pdb|3GG9|B Chain B, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352
 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 7/84 (8%)

Query: 1   MLSHAKKMKVVGRAG-----IGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAI 55
           +L    K+K++ + G      G  ++DL   +  G+VV+          AE   +L++A 
Sbjct: 65  LLDRLPKLKIISQTGRVSRDAG-GHIDLEACTDKGVVVLEGKGSPV-APAELTWALVMAA 122

Query: 56  ARQIPVANESTHKGKWEKFNFMGV 79
            R+IP    S   G W++      
Sbjct: 123 QRRIPQYVASLKHGAWQQSGLKST 146