BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate
dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
         (82 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|11498419|ref|NP_069647.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus fulgidus DSM
           4304]
 gi|3122861|sp|O29445|SERA_ARCFU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2649798|gb|AAB90429.1| phosphoglycerate dehydrogenase (serA) [Archaeoglobus fulgidus DSM
           4304]
          Length = 527

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/81 (55%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+TAEHAI+LMLA AR+IP
Sbjct: 57  VIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +GKWE+  FMG+E 
Sbjct: 117 QADRSVKEGKWERKKFMGIEL 137


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH+I LMLA+AR+I 
Sbjct: 59  VIEAAPRLKIIARAGVGVDNVDVKAATDRGIMVINAPESTSITVAEHSIGLMLALARKIA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+ S  +GKWEK  FMG+E 
Sbjct: 119 IADRSVKEGKWEKNRFMGIEL 139


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+D+  A++ G++V+N P GN+I+  EH+++++L++AR IP
Sbjct: 59  IIEAAPNLKVIARAGVGVDNIDVDAATKHGVIVINAPDGNTISATEHSMAMILSMARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKW++  + G E 
Sbjct: 119 QAHQSLKDGKWDRKTYRGTEL 139


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH+I LMLA+AR+I 
Sbjct: 59  VIEAAPRLKIIARAGVGVDNVDVKAATERGIMVINAPESTSITVAEHSIGLMLALARKIS 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +GKWEK  FMG+E 
Sbjct: 119 LADKSVKEGKWEKNRFMGIEL 139


>gi|20093737|ref|NP_613584.1| D-3-phosphoglycerate dehydrogenase [Methanopyrus kandleri AV19]
 gi|19886634|gb|AAM01514.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 522

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+ RAG+G DN+D+  A+  GI+V+N P  +SI+ AEH + L+LA+AR+IP
Sbjct: 57  LIEEAKNLKVIARAGVGVDNIDVKAATERGIIVVNAPESSSISVAEHTMGLILALARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W++  FMGVE 
Sbjct: 117 QADRSVRRGEWDRKRFMGVEL 137


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DN+D+  A++ GI+V+N P GN++   EH +++MLA+AR IP
Sbjct: 56  VIDAAANLKVIGRAGVGVDNIDVEAATKRGIIVLNAPEGNTVAATEHTMAMMLALARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   G+W++  FMGVE 
Sbjct: 116 QAHATMKAGEWQRSKFMGVEL 136


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A ++KV+GRAG G DN+D+  AS  G +VMNTP  N+   AEH I++MLA+AR IP
Sbjct: 58  LIENAPRLKVIGRAGTGVDNIDVKAASARGALVMNTPGANATAAAEHTIAMMLALARHIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W+K  FMG E 
Sbjct: 118 QATQSMREGRWDKKRFMGTEL 138


>gi|291238608|ref|XP_002739220.1| PREDICTED: phosphoglycerate dehydrogenase-like [Saccoglossus
           kowalevskii]
          Length = 405

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG G DN+DL  +S+ G++VMNTP GN+++ AEH  +++ A++R IP
Sbjct: 62  VIEAATNLKIIGRAGTGVDNIDLNASSKKGVIVMNTPSGNTLSAAEHTCAMICAMSRNIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKW++  FMG E 
Sbjct: 122 QAHMSMKSGKWDRKAFMGSEL 142


>gi|284161805|ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
 gi|284011802|gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
          Length = 525

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+K++GRAG+G DN+D+  A+  GIVV+N P GNS++ AEH I L+L+IAR+IP
Sbjct: 57  VIDRAKKLKIIGRAGVGVDNIDVDYATEKGIVVVNAPGGNSVSAAEHTIGLILSIARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +GKWE+  F+G+E 
Sbjct: 117 QADRSVKEGKWERKKFVGIEL 137


>gi|239736188|gb|ACS12894.1| 3-phosphoglycerate dehydrogenase-like protein [Chironex fleckeri]
          Length = 520

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + S A  +K+VGRAG G DN+DL  A+  G+ VMNTP GN+++ AEH  ++M ++AR IP
Sbjct: 63  VFSAAPNLKLVGRAGTGVDNIDLKAATNNGVFVMNTPGGNTMSAAEHTCAMMFSLARHIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S  +GKWE+  FMG E 
Sbjct: 123 QGYMSMQEGKWERSKFMGCEL 143


>gi|327401404|ref|YP_004342243.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
 gi|327316912|gb|AEA47528.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
          Length = 523

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK++++GRAG+G DN+D+  A++ GI+V+N P GNS++TAEH ++L+LA+AR+IP
Sbjct: 57  VIEAAKKLRIIGRAGVGVDNIDVQAATQHGIIVVNAPGGNSVSTAEHTLALILAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+WE+  F+G+E 
Sbjct: 117 QADRSVKEGRWERKKFIGMEL 137


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +AK +K++ RAG+G DN+D+  A+  GI+V+N P   SIT AEHA+ LML+++R+I 
Sbjct: 57  VIENAKNLKIIARAGVGVDNIDVQAATDHGILVVNAPQSTSITVAEHAMGLMLSLSRKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+ S   GKWEK  FMG+E 
Sbjct: 117 IADASVKAGKWEKSKFMGMEL 137


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILAAAPNLKVIGRAGIGTDNIDKEAASKQGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DNVD+  A++ GI+VMNTP GN+I+TAEHA SLM++ AR IP
Sbjct: 61  VIEAATNLKVIGRAGVGVDNVDVDAATKRGIIVMNTPGGNTISTAEHAFSLMVSTARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKW++  F+GVE 
Sbjct: 121 QADASVKSGKWDRKTFVGVEL 141


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+GRAGIG DN+DL  AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 60  LLSAATNLKVIGRAGIGVDNIDLKAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 120 EASASTHAGKWEKSKFMGVEL 140


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILDNATNLKVIARAGIGTDNIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILDNATNLKVIARAGIGTDNIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|20093758|ref|NP_613605.1| dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
 gi|19886661|gb|AAM01535.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 252

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +KV+ RAG+G DN+D+  A+  GIVV+N P  +SI+ AEH +SLML +AR+IP
Sbjct: 63  LIEEAENLKVIARAGVGVDNIDVEAATERGIVVVNAPESSSISVAEHTMSLMLVLARRIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W++  FMGVE 
Sbjct: 123 QADRSVRRGEWDRKLFMGVEL 143


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN+DL  A+  GI+V+N+P   SIT AEH + L+L++AR+  
Sbjct: 56  VIDKADNLKIIARAGVGVDNIDLNAATEKGIMVVNSPESTSITVAEHTMGLLLSLARKSA 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +GKWEK  FMGVE 
Sbjct: 116 IADKSVKEGKWEKKKFMGVEL 136


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN+DL  A+  GI+V+N+P   SIT AEH + L+L++AR+  
Sbjct: 56  VIDKADNLKIIARAGVGVDNIDLNAATEKGIMVVNSPESTSITVAEHTMGLLLSLARKSA 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +GKWEK  FMGVE 
Sbjct: 116 IADKSVKEGKWEKKKFMGVEL 136


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHA+++M A+ARQIP
Sbjct: 60  ILDAATNLKVIGRAGIGVDNVDIPYASSKGVVVMNTPFGNSITTAEHAVAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+  T  G+W K +FMGVE 
Sbjct: 120 QADRRTQAGEWPKNDFMGVEL 140


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILDAATNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI+LM A+ARQIP
Sbjct: 61  ILEKADRLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIALMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKSKFMGVEL 141


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +K++GRAG+G DN+DL  AS+ GI+V+N+P GN+I  AEH  +LM+A+ R IP
Sbjct: 57  IIEAAENLKIIGRAGVGVDNIDLAAASKKGIIVVNSPEGNTIAAAEHTFALMMALLRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +GKW +  F G E 
Sbjct: 117 QAHAALKEGKWLRKEFTGYEL 137


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++ RAG+G DNVD+  A+  GI+V+N P   SIT AEH + L+L+++R+I 
Sbjct: 58  VIEAADKLKIIARAGVGVDNVDVQAATERGIMVINAPESTSITVAEHTMGLILSLSRKIS 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+ S   GKWEK  FMG+E 
Sbjct: 118 IADSSVKDGKWEKSRFMGIEL 138


>gi|147676347|ref|YP_001210562.1| D-3-phosphoglycerate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
 gi|146272444|dbj|BAF58193.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [Pelotomaculum thermopropionicum SI]
          Length = 526

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KVVGRAG+G DN+D+  A+  GI+V+N P GN++  AEH I++ML++AR IP
Sbjct: 58  IIEKAARLKVVGRAGVGVDNIDVPAATARGILVVNAPEGNTLAVAEHTIAMMLSLARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKW+K +FMGVE 
Sbjct: 118 QANASLRAGKWDKKSFMGVEL 138


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+KV+GRAGIGTDN+D   AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  IIAAATKLKVIGRAGIGTDNIDKDAASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKNRFMGVEI 141


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKNRFMGVEI 141


>gi|298674284|ref|YP_003726034.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
 gi|298287272|gb|ADI73238.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
          Length = 525

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K++GRAG+G DN+D+  A+  GI+V+NTP GN I+ AEH IS+M+A+ R IP
Sbjct: 56  VINAADNLKIIGRAGVGVDNIDVDAATNKGIIVVNTPEGNMISAAEHTISMMMAMCRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    KWE+  FMGVE 
Sbjct: 116 QAHASLKSRKWERKKFMGVEV 136


>gi|213964733|ref|ZP_03392933.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
 gi|213952926|gb|EEB64308.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
          Length = 531

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A++ G++V+N P  N  +  EHAI+L+LA ARQ+P
Sbjct: 62  VLEAAPNLKIVGRAGVGLDNVDIDTATKRGVMVVNAPTSNIHSACEHAIALLLATARQLP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W++ +F GVE 
Sbjct: 122 AADASLREGEWKRSSFKGVEI 142


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDNVD   AS+AGI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 46  LLESAPNLKVIGRAGIGTDNVDKEAASKAGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 105

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 106 EASASTHAGKWEKSKFMGVEL 126


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVDL  ASR GI+VMNTPFGNSITTAEHA+SLM+A+ARQIP
Sbjct: 64  LIEAATNLKVIGRAGIGVDNVDLKAASRRGIIVMNTPFGNSITTAEHAMSLMMAVARQIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST +GKWEK  FMGVE 
Sbjct: 124 AADNSTQQGKWEKSKFMGVEL 144


>gi|116754525|ref|YP_843643.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
 gi|116665976|gb|ABK15003.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
          Length = 523

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DNVD+  A++ GI+V+N P GN+I+ AEH I++ML++AR IP
Sbjct: 56  VINAADRLKVIARAGVGVDNVDVDAATKKGIIVVNAPGGNTISAAEHTIAMMLSLARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W +  + GVE 
Sbjct: 116 QAHASVRRGEWNRKKYTGVEV 136


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANADNLKVIARAGIGTDNIDKEAASKRGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMG E 
Sbjct: 121 EASASTHAGKWEKSKFMGTEL 141


>gi|91774294|ref|YP_566986.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
 gi|91713309|gb|ABE53236.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
          Length = 523

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A+  GI+V+N P GN ++ AEH I++M+++AR IP
Sbjct: 56  VIEAADNLKIIGRAGVGVDNVDVDAATEKGIIVVNAPEGNMLSAAEHTIAMMMSMARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    KWE+ NFMGVE 
Sbjct: 116 QANASLKAKKWERKNFMGVEV 136


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 64  LLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFACARQLP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 124 EANASTHAGKWEKSRFMGVEL 144


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 61  LLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFACARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKSRFMGVEL 141


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 69/81 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAAENLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKSRFMGVEL 141


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAISLM+A+ARQIP
Sbjct: 61  IIAAATNLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISLMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKSRFMGVEL 141


>gi|322381790|ref|ZP_08055744.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154178|gb|EFX46500.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 535

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GRAG+G DN+DL  A++ GIVV+N P GN+I T EH  ++++A+AR IP
Sbjct: 67  IMEAAPRLKVIGRAGVGVDNIDLEAATKRGIVVINAPDGNTIATCEHTFAMIMAVARNIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A + T  G+W++ +F+GVE 
Sbjct: 127 QAYKKTISGEWDRKSFLGVEL 147


>gi|167465145|ref|ZP_02330234.1| phosphoglycerate dehydrogenase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 527

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GRAG+G DN+DL  A++ GIVV+N P GN+I T EH  ++++A+AR IP
Sbjct: 59  IMEAAPRLKVIGRAGVGVDNIDLEAATKRGIVVINAPDGNTIATCEHTFAMIMAVARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A + T  G+W++ +F+GVE 
Sbjct: 119 QAYKKTISGEWDRKSFLGVEL 139


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEAADNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EASASTQAGKWEKSKFMGVEL 141


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KVVGRAG+G DN+D+  A+  G++V+N P GN+I+ AEHAI++M ++AR IP
Sbjct: 56  VLENAGRLKVVGRAGVGVDNIDVEAATERGVIVINAPEGNTISAAEHAIAMMTSLARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++  FMGVE 
Sbjct: 116 NASASMKAGEWKRSKFMGVEL 136


>gi|260881561|ref|ZP_05404709.2| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
 gi|260848763|gb|EEX68770.1| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
          Length = 558

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 86  VIARAKKLKIIGRAGVGVDNIDIPAATAKGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 145

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +ANE+ HKG+W +  ++GVE 
Sbjct: 146 IANETMHKGEWNRKKYVGVEL 166


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++VVGRAG+G DNVD+  A++ GIVVMNTP GN+I+TAE   S+++A+AR+IP
Sbjct: 56  VIEAAPKLRVVGRAGVGVDNVDVDAATQRGIVVMNTPSGNTISTAELTFSMLMALARKIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W +  F GVE 
Sbjct: 116 QAHSSMKAGEWNRKAFSGVEL 136


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAVAMIFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKNRFMGVEI 141


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|327438749|dbj|BAK15114.1| phosphoglycerate dehydrogenase [Solibacillus silvestris StLB046]
          Length = 541

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP
Sbjct: 73  VIEAAKNLKLIGRAGVGVDNIDLNAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARFIP 132

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   GKW++ +++GVE 
Sbjct: 133 QAFNTLKNGKWDRKSYVGVEL 153


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 61/80 (76%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+K++ RAG+GTDN+D+  A+  GIVV+N P GN+I  AEH I++MLA+AR IP 
Sbjct: 58  INAAKKLKIIARAGVGTDNIDVAAATERGIVVVNAPEGNTIAAAEHTIAMMLALARNIPQ 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +  +G+WEK  F+GVE 
Sbjct: 118 ASAALKQGRWEKKKFVGVEL 137


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEH +++ML++AR IP
Sbjct: 57  VIEAANQLKIIGRAGVGVDNVDVPAATRKGIIVVNSPEGNTIAAAEHTLAMMLSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +   G+W++  F GVE 
Sbjct: 117 DANAAVKAGQWDRKRFTGVEI 137


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+GRAG+G DN+DL  A+R GI+V+N P GN+I  AEH  ++M+++AR IP
Sbjct: 60  VIESAKKLKVIGRAGVGVDNIDLEAATRRGILVINAPDGNTIAAAEHTFAMMISLARHIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W +  ++GVE 
Sbjct: 120 AAHRDLLQGNWNRKKWIGVEL 140


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG G DNVD + A++ GIVVMNTP GN+ITTAEHAI+++ ++AR+IP
Sbjct: 57  IIDAADKLKVIGRAGTGVDNVDKIAATKKGIVVMNTPGGNTITTAEHAIAMLFSLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  FMGVE 
Sbjct: 117 QATASMKSGKWEKKKFMGVEL 137


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+GRAGIG DNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILAAATNLKVIGRAGIGVDNVDREAASKNGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 58  ILAAATNLKVVGRAGIGVDNVDVPAATARGIVVMNTPFGNSITTAEHAIAMMFALAREIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 118 EANASTHAGKWEKNRFMGVEL 138


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 58  ILAAATNLKVVGRAGIGVDNVDVPAATARGIVVMNTPFGNSITTAEHAIAMMFALAREIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 118 EANASTHAGKWEKNRFMGVEL 138


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKASRLKVIGRAGIGVDNVDIPAATARGVIVMNTPFGNSITTAEHAIAMMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 QADASTQAGKWEKNRFMGVEL 141


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILENATNLKVIGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R+IP
Sbjct: 56  LLEKMPNLKIIGRAGVGVDNIDVDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 116 QAHISVKSREWNRSAFVGNEL 136


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R+IP
Sbjct: 42  LLEKMPNLKIIGRAGVGVDNIDVDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRRIP 101

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 102 QAHISVKSREWNRSAFVGNEL 122


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 57/80 (71%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP 
Sbjct: 70  IEAAKNLKLIGRAGVGVDNIDLAAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARHIPQ 129

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A  +   GKW++ +++GVE 
Sbjct: 130 AFNTLKNGKWDRKSYVGVEL 149


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  ++V+GRAGIG DNVD+  AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  VIAAADNLRVIGRAGIGVDNVDIPHASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSRFMGVEL 141


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATRLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKNRFMGVEI 141


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENATNLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQVP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENATNLKVIGRAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQVP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IIEAASNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   G+W +  F G E 
Sbjct: 120 QAHQSLKAGEWNRKAFRGTEL 140


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K ++++ RAG+G DN+D+  A+  GI+V+N P   SIT AEH + LML +AR+I 
Sbjct: 57  VIEAGKNLEIIARAGVGVDNIDVGAATEKGIMVVNAPESTSITVAEHTMGLMLTLARKIV 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +G+W +  FMG+E 
Sbjct: 117 LADKSVRRGEWNRSKFMGIEL 137


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAG+G DN+D+  A+  GI+V+N P GN++   EH ++LML++AR +P
Sbjct: 57  VMESAPNLKVVGRAGVGVDNIDVSTATERGIIVVNAPDGNTMAATEHTMALMLSLARNLP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W+K  F+GVE 
Sbjct: 117 QADARLKSGVWDKKAFVGVEL 137


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +K++GRAG+G DNVD+  A+  GI+V N P GN+I   EH +S+MLA++R IP
Sbjct: 58  VIAAGKNLKIIGRAGVGIDNVDVPAATEKGIIVANAPEGNTIAACEHTLSMMLAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWE+  FMGVE 
Sbjct: 118 QANASLKSGKWERSKFMGVEV 138


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKATNLKVVGRAGIGTDNVDKDAASKHGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH +++M ++AR IP
Sbjct: 67  VIEAAKSLKLIGRAGVGVDNIDLAAATEHGIIVVNAPDGNTNSAAEHTVAMMTSLARHIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   GKW++ +++GVE 
Sbjct: 127 QAFNTLKNGKWDRKSYVGVEL 147


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+ RAGIGTDN+D V AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILNAATNLKVIARAGIGTDNIDKVAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 59/81 (72%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AKK+KVVGRAGIG DNVDL  A+ AG++VMNTPFGNSITTAEHAI++M A+AR IP
Sbjct: 58  VLAAAKKLKVVGRAGIGVDNVDLPAATAAGVIVMNTPFGNSITTAEHAIAMMFALARDIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 118 QANASTHAGKWEKSKFMGVEV 138


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++++A+ARQIP
Sbjct: 70  ILDAATNLKVIGRAGIGVDNVDVPYASGKGVVVMNTPFGNSITTAEHAIAMIMALARQIP 129

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+  T  G+W K +FMGVE 
Sbjct: 130 QADRRTQAGEWPKNDFMGVEV 150


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A  +KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILANATNLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMG E 
Sbjct: 121 EASTSTHAGKWEKSKFMGTEL 141


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAIS+M+A+ARQIP
Sbjct: 61  LIEQATNLKVIGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSRFMGVEL 141


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DN+DL  A+  G++V+N P GN+ + AEH +++++A++R IP
Sbjct: 60  LIEKASNLKIIGRAGVGVDNIDLEAATENGVIVVNAPNGNTNSAAEHTMAMIMALSRNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +  + +W++  F+GVE 
Sbjct: 120 QAYHALKQKQWDRKRFVGVEL 140


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DNVDL  A+  G+VV+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 68  IIQKMPNLKIIGRAGVGVDNVDLDAATANGVVVVNAPDGNTISTAEHTFAMLASVVRNIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S  +G+W++  + G E 
Sbjct: 128 QANQSMKEGRWDRKLYTGTEL 148


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLEKATNLKVVGRAGIGVDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEKADKLKVIGRAGIGTDNIDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMG+E 
Sbjct: 121 EASTSTHAGKWEKSRFMGIEL 141


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +KV+GRAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILENADNLKVIGRAGIGTDNIDREAASKRGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K+V RAG+G DNVD+  A++ G+VV+N P GN+I+TAEH  ++M A+ R IP
Sbjct: 65  LLSRMPRLKIVARAGVGVDNVDIQAATKHGVVVINAPDGNTISTAEHTFAMMCALLRNIP 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKW++  + G E 
Sbjct: 125 QANASVKSGKWDRKAYQGTEL 145


>gi|196001599|ref|XP_002110667.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
 gi|190586618|gb|EDV26671.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
          Length = 520

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG G DN+D+  A+  G++VMNTP GN+++ AEH  +LM+ +ARQ+P
Sbjct: 61  VIKAGKNLKIIGRAGTGVDNIDIKAATECGVIVMNTPGGNTLSAAEHTCTLMVCLARQVP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  +MG+E 
Sbjct: 121 QAAASMREGRWDRKKYMGIEL 141


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K+++ +GRAG G DN+D+  A+R G++V N P GN++   EH +++M ++ R IP
Sbjct: 58  VIEAGKRLRFIGRAGAGVDNIDMNAATRRGVIVANAPEGNTLAATEHTMAMMQSLCRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  FMGVE 
Sbjct: 118 QANASMQAGEWKRSKFMGVEL 138


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LINAAGNLKVIGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++STH GKWEK  FMGVE 
Sbjct: 121 EASQSTHAGKWEKSKFMGVEL 141


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DN++   A++ G++V+N P GN+I+  EH+++++LA+ARQIP
Sbjct: 59  VIEAADNLKIIARAGVGVDNINKDAATKRGVLVINAPDGNTISATEHSMAMILAMARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +GKW +  F G E 
Sbjct: 119 MAHQSLKEGKWNRSEFKGTEL 139


>gi|21227855|ref|NP_633777.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
 gi|20906268|gb|AAM31449.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
          Length = 540

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A++ GI+V N P GN I+ AEH I++M++++R IP
Sbjct: 73  IIEAADNLKIIGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHTIAMMMSMSRNIP 132

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W++  FMGVE 
Sbjct: 133 QANASLKAREWKRNKFMGVEV 153


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|256255607|ref|ZP_05461143.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|261222811|ref|ZP_05937092.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|260921395|gb|EEX88048.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
          Length = 478

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 126 EADTSTRAGKWEKNRFMGVEI 146


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 126 EADTSTRAGKWEKNRFMGVEI 146


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 126 EADTSTRAGKWEKNRFMGVEI 146


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 EADTSTRAGKWEKNRFMGVEI 141


>gi|294496187|ref|YP_003542680.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
 gi|292667186|gb|ADE37035.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
          Length = 523

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K+VGRAG+G DN+D+  A+  GI+V+N P GN ++ AEH I++ML++AR IP
Sbjct: 56  VIEAADKLKIVGRAGVGVDNIDIPAATEKGIIVVNAPEGNMLSAAEHTIAMMLSMARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  F+GVE 
Sbjct: 116 QATASLKAGKWERKKFLGVEV 136


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G DN+D+  AS+ G+VVMNTP GN+I+TAEHA +LM ++AR+IP
Sbjct: 62  VMEAAPNLKVIGRAGVGVDNIDVPAASKRGVVVMNTPGGNTISTAEHAFALMTSLARKIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   GK+++  F G E 
Sbjct: 122 QAHANVASGKFDRKTFQGTEL 142


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH I++M ++AR IP
Sbjct: 67  VIEAAKSLKLIGRAGVGVDNIDLTAATEHGIIVVNAPDGNTNSAAEHTIAMMTSLARHIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   GKW++ +++GVE 
Sbjct: 127 QAFNTLKNGKWDRKSYVGVEL 147


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIGTDNVD   +S+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 448 LLEHATNLKVVGRAGIGTDNVDKEASSKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 507

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 508 EADASTQAGKWEKSKFMGVEL 528


>gi|119356910|ref|YP_911554.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354259|gb|ABL65130.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
          Length = 526

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+K++GRAG G DN+D+  A+R GI+VMNTP GN+I+ AEH   +MLA ARQIP
Sbjct: 57  IIELGKKLKLIGRAGAGVDNIDIEAATRNGIIVMNTPGGNTISAAEHTCGMMLAAARQIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      GKW+K  FMGVE 
Sbjct: 117 QATAELKNGKWDKKKFMGVEL 137


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHA++++ A+ARQIP
Sbjct: 61  LINAATKLKVVGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAVAMIFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKNRFMGVEI 141


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 116 QAHISVKSREWNRSAFVGTEL 136


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 116 QAHISVKSREWNRSAFVGTEL 136


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+GRAG+G DN+DL  A+R GI+V+N P GN+I  AEH  ++M+++AR IP
Sbjct: 60  VIESAKKLKVIGRAGVGVDNIDLEAATRRGILVINAPDGNTIAAAEHTFAMMISLARHIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W +  ++GVE 
Sbjct: 120 AAHRDLLQGHWNRKKWIGVEL 140


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+++LA+ARQIP
Sbjct: 61  ILEAATNLKVIGRAGIGVDNVDIPAASERGVVVMNTPFGNSITTAEHAIAMLLALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T  G+W K +FMG+E 
Sbjct: 121 QANARTQAGEWPKSDFMGIEL 141


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEAAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 SADASTQAGKWEKSKFMGVEI 141


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++GRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLSKMPNLKIIGRAGVGVDNIDVEAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 116 QAHVSVKSREWNRSAFVGTEL 136


>gi|47218064|emb|CAG09936.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 584

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG G DNVD+  A++ GI+VMNTP GN+I+ AE   +L+++++R +P
Sbjct: 63  VIDAADNLKIIGRAGTGVDNVDVDAATKKGIIVMNTPSGNTISAAELTCALLMSLSRNVP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G W++  FMG E 
Sbjct: 123 QAVISMKEGHWDRKKFMGSEL 143


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++VVGRAG+G DN+D+  A+  GIVVMN P GN+ITTAEH ++L++A+AR++P
Sbjct: 60  LMDAATNLRVVGRAGVGVDNIDVPAATARGIVVMNAPDGNTITTAEHTVALLIALARRVP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKW++ +F+GVE 
Sbjct: 120 QANSSLKSGKWDRKSFIGVEL 140


>gi|154313912|ref|XP_001556281.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
 gi|150849045|gb|EDN24238.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
          Length = 487

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 56/82 (68%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ AK +KVV RAG+G DN+D+  A++ GI+V+N+P GN    AEH I+L++A+AR +P
Sbjct: 75  ILAAAKNLKVVARAGVGVDNIDVEAATKHGIIVVNSPSGNIAAAAEHTIALLMAVARNVP 134

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G WE+   +G E G
Sbjct: 135 AGDRSLRSGGWERGKLVGTEVG 156


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++GRAG G DN+D   A+ AGI+VMNTP GN+++ AEH  +++ A+ARQIP
Sbjct: 71  IIAAGTRLKIIGRAGTGVDNIDTDAATHAGIIVMNTPGGNTLSAAEHTCAMISALARQIP 130

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +GKW++ NFMGVE 
Sbjct: 131 QAHATMKQGKWDRKNFMGVEL 151


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KVV RAGIG DNVD+  AS+ G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 63  VLDAATELKVVARAGIGVDNVDIPAASQKGVIVMNTPFGNSITTAEHAIAMMFAVARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 123 EADASTQAGKWEKSKFMGVEL 143


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 61  IIAAATNLKVVGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASTSTHDGKWEKSKFMGVEL 141


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 66  LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G+WEK  FMGVE 
Sbjct: 126 EADTSTRAGRWEKNRFMGVEI 146


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 49  ILEHATNLKVVGRAGIGVDNVDIPAASAKGVVVMNTPFGNSITTAEHAIALMFALARQLP 108

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 109 EADASTQAGKWEKNRFMGVEL 129


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKSKFMGVEI 141


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKSKFMGVEI 141


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+V RAG+G DN+DL  A++ G+VV+N P GN+I+TAEH  +++ ++ R+IP
Sbjct: 72  LLQKMPNLKIVARAGVGVDNIDLDAATKHGVVVVNAPDGNTISTAEHTFAMISSLLRKIP 131

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W +  F G E 
Sbjct: 132 QANASIKAGEWNRKAFQGSEL 152


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML ++R IP
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLTLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW++  F+G E 
Sbjct: 117 QAHGGMRAGKWDRKKFVGNEL 137


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K +GRAG G DN+D   A++ GI+V N P GN++   EH +++M ++AR+IP
Sbjct: 58  VIEAAAKLKFIGRAGAGVDNIDTNAATQRGIIVANAPAGNTLAACEHTLAMMASLARKIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  FMGVE 
Sbjct: 118 QATASVKRGEWKRSAFMGVEL 138


>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIEAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADSSTQAGKWEKSKFMGVEI 141


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIEAATNLKVIGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADSSTQAGKWEKSKFMGVEI 141


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ GIVV+N+P GN+I  AEHA++LML+++R IP
Sbjct: 57  VIEAATQLKIIGRAGVGVDNVDVPTATKKGIVVVNSPEGNTIAAAEHALALMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S   GKWE+  F GVE 
Sbjct: 117 DANQSVKAGKWERKKFTGVEV 137


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 61  ILEKATNLKVVGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 SADASTQAGKWEKNKFMGVEI 141


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  ILEHATNLKVVGRAGIGTDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG E 
Sbjct: 121 AADASTQAGKWEKSKFMGTEL 141


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VIEKASNLKVIARAGVGVDNIDIDAATLQGILVINAPDGNTISATEHSVAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F GVE 
Sbjct: 120 QAHASLKNKEWNRKAFKGVEL 140


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VIAAAHKLRVIARAGIGVDNVDIPAATAKGIVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 120 AADASTQAGKWEKNRFMGVEL 140


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  AS+ GI+VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  IIDAATNLKVVGRAGIGVDNVDIPAASKKGIIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKSRFMGVEL 141


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A++ G+VVMNTPFGN++TTAEHAI+++L++ARQIP
Sbjct: 58  ILDAAPNLKVVGRAGIGVDNVDIPEATKRGVVVMNTPFGNAVTTAEHAITMILSLARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ANEST  GKWEK  FMG E 
Sbjct: 118 AANESTQAGKWEKSRFMGTEI 138


>gi|126179793|ref|YP_001047758.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
 gi|125862587|gb|ABN57776.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+K +GRAG G DN+D   A+R GI+V N P GN++   EH +++ML++AR IP
Sbjct: 58  VIDAGAKLKFIGRAGAGVDNIDTDAATRRGIIVANAPEGNTLAATEHTMAMMLSLARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  KG+W++  FMGVE 
Sbjct: 118 QATASLKKGEWKRSKFMGVEL 138


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KVV RAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A ARQ+P
Sbjct: 61  LLENATRLKVVARAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFAAARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANASTHAGKWEKSRFMGVEL 141


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A+  GI+V N P GN+I   EH I++M A++R IP
Sbjct: 58  VIEAADSLKIIGRAGVGIDNVDVPAATAKGIIVANAPEGNTIAACEHTIAMMFAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWE+  FMGVE 
Sbjct: 118 QANSSLKGGKWERSKFMGVEV 138


>gi|255603392|ref|XP_002538041.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223514072|gb|EEF24343.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 223

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDAAANLKVVGRAGIGVDNVDIPAASARGVVVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 118 EADASTQAGKWEKNRFMGVEL 138


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW++  ++G E 
Sbjct: 117 QANAGMRAGKWDRKKYVGNEL 137


>gi|237785818|ref|YP_002906523.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758730|gb|ACR17980.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 532

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++K++GRAG+G DNVD+  A++ G++V+N P  N  +  EHAI+L+LA ARQIP
Sbjct: 62  VLDAAKELKIIGRAGVGLDNVDIEGATQRGVMVVNAPTSNIHSACEHAITLLLAAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F GVE 
Sbjct: 122 QADQSLRQGEWKRSSFKGVEV 142


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 183 VIEAANQLKIIGRAGVGVDNVDVPAATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 242

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKW++ +F GVE 
Sbjct: 243 AASQSVKSGKWDRKSFTGVEV 263


>gi|307826385|ref|ZP_07656587.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
 gi|307732562|gb|EFO03437.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++GRAGIG DNVD+  A+  GI+VMNTP  N+ TTAE AI+ M++++R +P
Sbjct: 59  VLQAAKNLKLIGRAGIGVDNVDIPAATELGIIVMNTPDANATTTAELAIAHMMSLSRHLP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKWE+   MG E 
Sbjct: 119 TADRSVRAGKWERSKLMGSEI 139


>gi|300781348|ref|ZP_07091202.1| phosphoglycerate dehydrogenase [Corynebacterium genitalium ATCC
           33030]
 gi|300533055|gb|EFK54116.1| phosphoglycerate dehydrogenase [Corynebacterium genitalium ATCC
           33030]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAI+L+L+ ARQIP
Sbjct: 59  VLEAAPNLRIVGRAGVGLDNVDVPTATERGVMVVNAPTSNIHSACEHAIALLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 119 AADKTLRDGEWKRSSFKGVEI 139


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+GRAG+G DN+D+  A+R GI+V+N P GN+I   EH I LMLAI+R+IP
Sbjct: 59  VIERAKNLKVIGRAGVGVDNIDVEEATRKGILVINAPEGNTIAACEHTIGLMLAISRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +GKWE+ +F+G E 
Sbjct: 119 QAFSLLRQGKWERKSFIGNEL 139


>gi|156373763|ref|XP_001629480.1| predicted protein [Nematostella vectensis]
 gi|156216481|gb|EDO37417.1| predicted protein [Nematostella vectensis]
          Length = 487

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG G DN+D V AS  G++VMNTP GN+++ AEH  +L+ ++AR IP
Sbjct: 63  VIKAGKNLKIIGRAGTGVDNIDTVAASLHGVLVMNTPGGNTLSAAEHTCALISSLARHIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST +GKWE+  FMG E 
Sbjct: 123 QASASTKEGKWERKQFMGNEL 143


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++K++GRAG+G DN+D+  A+  GI+V N P GN++  AEH I LML++AR IP
Sbjct: 59  VLEKARRLKIIGRAGVGVDNIDVKAATAKGIIVANAPGGNTVAAAEHTIGLMLSLARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++ +FMGVE 
Sbjct: 119 EACARTKSGVWDRKSFMGVEL 139


>gi|269926541|ref|YP_003323164.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790201|gb|ACZ42342.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 524

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    +++V+ RAGIG DN+D+  A++ GI+V+N P GN++  AEHAI+L+L++AR IP
Sbjct: 58  IIEAGDRLQVIARAGIGVDNIDVDAATKRGILVVNAPLGNTVAAAEHAIALILSLARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W++  FMGVE 
Sbjct: 118 QADASIRRGEWQRSKFMGVEL 138


>gi|220931993|ref|YP_002508901.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
 gi|219993303|gb|ACL69906.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A+ +KV+GRAG G DN+D+  AS+ GI+V NTP GN+I+  EH I +MLA++R IP 
Sbjct: 58  LDKARNLKVIGRAGTGYDNIDIEEASKRGIIVFNTPTGNTISAVEHTIGMMLALSRNIPQ 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN++ H+G W++  +MGVE 
Sbjct: 118 ANQALHEGIWDRKKYMGVEV 137


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 45/81 (55%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLAI+R IP
Sbjct: 57  IIEAANQLKIIGRAGVGVDNVDVPAATRKGIVVVNSPEGNTIAAAEHAIAMMLAISRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKWE+  FMGVE 
Sbjct: 117 DADNSVKNGKWERNRFMGVEV 137


>gi|330509011|ref|YP_004385439.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
 gi|328929819|gb|AEB69621.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
          Length = 525

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 64/80 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK++KV+GRAG+G DNVD+  A++ GI+V+NTP GN+I+ AEH I++MLA+AR IP
Sbjct: 56  VINAAKRLKVIGRAGVGIDNVDVEAATKKGIIVLNTPGGNTISAAEHTIAMMLALARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN + H+G+W +  + GVE
Sbjct: 116 QANSALHQGEWNRKKYTGVE 135


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K+V RAG+G DN+D+  +++ G+VV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLAKMPNLKIVARAGVGVDNIDIEASTKRGVVVINAPNGNTISTAEHTFAMMASLFRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             N S    +W +  F+G E 
Sbjct: 116 QGNASVKAREWNRSAFVGTEL 136


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K+V RAG+G DN+D+  +++ G+VV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLAKMPNLKIVARAGVGVDNIDIEASTKRGVVVINAPNGNTISTAEHTFAMMASLFRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             N S    +W +  F+G E 
Sbjct: 116 QGNASVKAREWNRSAFVGTEL 136


>gi|198430449|ref|XP_002130537.1| PREDICTED: similar to 3-phosphoglycerate dehydrogenase [Ciona
           intestinalis]
          Length = 523

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  K+ ++GRAG G DNVD+  A++ G++VMNTP GN+++ AEH  +L+  +AR +P
Sbjct: 63  IIENCPKLSIIGRAGTGVDNVDVKFATKKGVIVMNTPGGNTLSAAEHTCTLVCCLARNVP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKW++  FMG E 
Sbjct: 123 AADASVKAGKWDRKAFMGHEL 143


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  ASR G++VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  LLEAATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 121 EANVSTHAGKWEKSRFMGVEV 141


>gi|296119581|ref|ZP_06838139.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
 gi|295967464|gb|EFG80731.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
          Length = 528

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAISL+L+ ARQIP
Sbjct: 59  VLEAASNLKIVGRAGVGLDNVDVPAATTRGVMVVNAPTSNIHSACEHAISLLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++ +F GVE 
Sbjct: 119 QADATLREGEWKRSSFKGVEI 139


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IITAASNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKW++  F G E 
Sbjct: 120 QAHQSLKSGKWDRKAFRGTEL 140


>gi|149600926|ref|XP_001515318.1| PREDICTED: similar to Phosphoglycerate dehydrogenase
           [Ornithorhynchus anatinus]
          Length = 533

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    ++L++ARQIP
Sbjct: 63  VIDAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMILSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKW++  FMG E 
Sbjct: 123 QASASMKDGKWDRKKFMGTEL 143


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +K VGRAG+G DN+D+  A+R GI+V+N P GN+I+TAEH  ++++A+AR IP
Sbjct: 59  LLAGARNLKAVGRAGVGVDNIDIEAATRRGIIVVNAPDGNTISTAEHTFAMLMALARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++ +F+GVE 
Sbjct: 119 QAYASIQSGKWDRKSFVGVEL 139


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  A+  G+VVMNTP+GN+ITTAEHAI LM A+AR++P
Sbjct: 58  LLDAATNLKVIGRAGIGVDNVDVKSATARGVVVMNTPYGNAITTAEHAIGLMFALARELP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 118 EASASTKAGKWEKNRFMGVEL 138


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+GRAG+G DN+D+  A+R GI+V+N P GN+I   EH I LMLAI+R+IP
Sbjct: 59  VIEKAKNLKVIGRAGVGVDNIDVEEATRKGILVINAPEGNTIAACEHTIGLMLAISRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +GKWE+ +F+G E 
Sbjct: 119 QAFSLLKQGKWERKSFIGNEL 139


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN+ITTAEH +S+M+++AR+IP
Sbjct: 63  VLEGATRLKVIGRAGAGLDNVDLPAATNRGIVVMNTPGGNTITTAEHTVSMMMSMARRIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWEK  FMG+E 
Sbjct: 123 QANASNRSGKWEKSKFMGIEL 143


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAAGRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW++  ++G E 
Sbjct: 117 QANAGMRAGKWDRKKYVGNEL 137


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  VIQAASQLKVIARAGVGVDNIDIDAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G+E 
Sbjct: 120 QAHQSLRNKEWNRKAFRGIEL 140


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++++A+AR IP
Sbjct: 67  ILDAATNLKVIGRAGIGVDNVDIPYASGKGVVVMNTPFGNSITTAEHAIAMIMALARMIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+  T  G+W K +FMG+E 
Sbjct: 127 AADARTQNGEWPKKDFMGIEV 147


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score = 96.9 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAG+G DNVD+  A++AG++V+N P  N  + AEH ++++LA AR IP
Sbjct: 59  VIAAAPKLRVIARAGVGLDNVDVEAATKAGVMVVNAPTSNITSAAEHTVAMILASARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   G+W++  + GVE 
Sbjct: 119 QAHAALKGGEWKRSKYTGVEL 139


>gi|304437357|ref|ZP_07397316.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369613|gb|EFM23279.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 563

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA+AR IP
Sbjct: 92  VLERAGKLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTVAMMLAMARNIP 151

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ + H G+W +  ++GVE 
Sbjct: 152 TADATMHAGQWNRKAYVGVEL 172


>gi|238927354|ref|ZP_04659114.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
 gi|238884636|gb|EEQ48274.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
          Length = 565

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA+AR IP
Sbjct: 94  VLERAGKLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTVAMMLAMARNIP 153

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ + H G+W +  ++GVE 
Sbjct: 154 TADATMHAGQWNRKAYVGVEL 174


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVVGRAGIG DN+D+  AS+ G+VVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VLAAATKLKVVGRAGIGVDNIDIPEASKKGVVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T  GKW K +FMGVE 
Sbjct: 120 EANALTQAGKWPKNDFMGVEL 140


>gi|306835934|ref|ZP_07468927.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
 gi|304568208|gb|EFM43780.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
          Length = 528

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAAPKLKIVGRAGVGLDNVDIDTATNKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F GVE 
Sbjct: 119 AADQSLREGEWKRSSFKGVEV 139


>gi|227501755|ref|ZP_03931804.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
 gi|227077780|gb|EEI15743.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
          Length = 528

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAAPKLKIVGRAGVGLDNVDIDTATNKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F GVE 
Sbjct: 119 AADQSLREGEWKRSSFKGVEV 139


>gi|288559935|ref|YP_003423421.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
 gi|288542645|gb|ADC46529.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
          Length = 524

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++ RAG+G DNVD+  A++ GI+V+N P   SIT AEH + L+L+  R+I 
Sbjct: 56  VIEKADNLKIIARAGVGVDNVDVNAATKKGIMVVNAPESTSITVAEHTMGLILSTIRKIA 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++ST  GKWEK  FMG+E 
Sbjct: 116 IADKSTKAGKWEKKAFMGMEL 136


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VVGRAG+G DNVD+  A+  G+VVMNTP+GNS+TTAEH I+LM+A+ARQIP
Sbjct: 61  LLARAGRLRVVGRAGVGVDNVDVGAATAHGVVVMNTPYGNSVTTAEHTIALMMALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTRAGKWEKSRFMGVEL 141


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLEKADHLKVVGRAGIGTDNVDKDAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSRFMGVEL 141


>gi|320529979|ref|ZP_08031055.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
 gi|320137776|gb|EFW29682.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
          Length = 534

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 63  VIARAENLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSMARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E+  +G+W +  ++GVE 
Sbjct: 123 AADETMQRGEWNRKAYVGVEL 143


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIERAEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  F G+E 
Sbjct: 117 QATASLKRGEWDRKRFKGIEL 137


>gi|178056550|ref|NP_001116634.1| D-3-phosphoglycerate dehydrogenase [Sus scrofa]
 gi|166977567|sp|A5GFY8|SERA_PIG RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|147223383|emb|CAN13230.1| phosphoglycerate dehydrogenase [Sus scrofa]
          Length = 533

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 45/81 (55%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VINAAKKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIEKAEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  F G+E 
Sbjct: 117 QATASLKRGEWDRKRFKGIEL 137


>gi|292669667|ref|ZP_06603093.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292648464|gb|EFF66436.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 526

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 55  VLERADRLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSLARNIP 114

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ + H G W +  ++GVE 
Sbjct: 115 AADATMHTGGWNRKAYVGVEL 135


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  ++VVGRAGIG DNVD+  A+  G+VVMNTPFGNSITTAEHAI++M+A+AR IP
Sbjct: 58  VLAVATNLRVVGRAGIGVDNVDVPAATARGVVVMNTPFGNSITTAEHAIAMMMALARDIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 118 EANASTHAGKWEKNRFMGVEL 138


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIEKAEKLKVIGRAGVGVDNIDVDAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  F G+E 
Sbjct: 117 QATASLKRGEWDRKRFKGIEL 137


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 62  LLAEANRLKVVGRAGIGVDNVDVPAATSRGVIVMNTPFGNSITTAEHAIAMMFALARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 QADASTQAGKWEKNRFMGVEL 142


>gi|74012733|ref|XP_849042.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
          Length = 411

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +AR IP
Sbjct: 44  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARHIP 103

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 104 QATASMKDGKWERKKFMGTEL 124


>gi|73981259|ref|XP_849835.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981286|ref|XP_849919.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981343|ref|XP_850035.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
          Length = 533

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +AR IP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARHIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|19552504|ref|NP_600506.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|62390170|ref|YP_225572.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|145295425|ref|YP_001138246.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum R]
 gi|21324052|dbj|BAB98677.1| Phosphoglycerate dehydrogenase and related dehydrogenases or
           D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glutamicum ATCC 13032]
 gi|41325506|emb|CAF19986.1| Phosphoglycerate Dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|140845345|dbj|BAF54344.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 530

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++ +F GVE 
Sbjct: 122 AADATLREGEWKRSSFNGVEI 142


>gi|126313575|ref|XP_001367170.1| PREDICTED: similar to Phosphoglycerate dehydrogenase [Monodelphis
           domestica]
          Length = 533

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++++ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QAAASMKNGKWERKKFMGTEL 143


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/81 (55%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++VVGRAG+G DN+D+  A+  GIVVMN P GN+ITTAEH I+L++A+AR+IP
Sbjct: 88  LLDGAPALRVVGRAGVGVDNIDVPAATERGIVVMNAPDGNTITTAEHTIALLIALARRIP 147

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+WE+  F+GVE 
Sbjct: 148 QANSSLKSGRWERKTFIGVEL 168


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++K++GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  I LMLA AR I 
Sbjct: 56  LIERGKRLKIIGRAGVGVDNIDVEAATERGIIVVNAPDASSISVAELTIGLMLAAARNIV 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G+W +  F G+E 
Sbjct: 116 QANNSVKRGEWNRKKFKGIEL 136


>gi|172040439|ref|YP_001800153.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
 gi|171851743|emb|CAQ04719.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
          Length = 530

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VLEAAKNLKIVGRAGVGLDNVDIETATERGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 122 AADKTLRDGEWKRSSFKGVEI 142


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVVGRAGIG DNVD+  A+  G+VVMNTPFGN+ITTAEHAI++M A+ARQIP
Sbjct: 58  VLAAAGKLKVVGRAGIGVDNVDIAAATAGGVVVMNTPFGNAITTAEHAIAMMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 118 QADASTQAGKWEKSKFMGVEL 138


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIGTDNVD   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILEAATNLKVVGRAGIGTDNVDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASVSTHAGKWEKSKFMGVEL 141


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 61  LIQAATNLKVIGRAGIGVDNVDIPAASRKGIIVMNTPFGNSITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKNRFMGVEI 141


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAISL++A+ARQIP
Sbjct: 60  VLASAERLKVVGRAGIGVDNVDVPAATARGVIVMNTPFGNSITTAEHAISLLMALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 120 EADRSTQAGKWEKSKFMGVEV 140


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA  +KVVGRAGIGTDNVD V AS+ G++VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLAHADNLKVVGRAGIGTDNVDKVAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 67  LLAQATRLKVVGRAGIGVDNVDVPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 127 AADASTQAGKWEKNRFMGVEL 147


>gi|20089481|ref|NP_615556.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
 gi|19914387|gb|AAM04036.1| phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
          Length = 523

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG+G DNVD+  A++ GI+V N P GN I+ AEH I +M+A++R IP
Sbjct: 56  VIEAADNLKIVGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHTIGMMMAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W++  FMGVE 
Sbjct: 116 QANASLKGREWKRNKFMGVEV 136


>gi|288932457|ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
 gi|288894705|gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
          Length = 527

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+K++GRAG+G DN+D+  A+  GI+V+N P GN+I+TAE  + L+++ AR+IP
Sbjct: 57  IIERGEKLKIIGRAGVGVDNIDVDAATERGIIVVNAPGGNTISTAELTMGLIISAARKIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +GKWE+  F G+E 
Sbjct: 117 QADRSVKEGKWERKKFEGLEL 137


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ RAG+G DN+D+  A++ GIVV+N P GN+I+TAEH  +++ ++ R+IP
Sbjct: 71  LMEKMSSLKIIARAGVGVDNIDIDAATKHGIVVVNAPDGNTISTAEHTFAMICSLLRKIP 130

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F G E 
Sbjct: 131 QANASIKAGEWKRKAFQGTEL 151


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+I+++LA+AR IP
Sbjct: 60  IINSASRLKVIARAGVGVDNIDIEAATLKGILVINAPDGNTISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W++  F GVE 
Sbjct: 120 QAHQSLRNKEWKRKAFRGVEL 140


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KV+ RAG+G DN+D+  A+  GI+V+N P GN I+  EH+I+++LA+AR IP
Sbjct: 60  IINSASRLKVIARAGVGVDNIDIEAATLKGILVINAPDGNIISATEHSIAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F GVE 
Sbjct: 120 QAHQSLRNKEWNRKAFRGVEL 140


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F GVE 
Sbjct: 120 QAHQSLRNKEWNRKAFRGVEL 140


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F GVE 
Sbjct: 120 QAHQSLRNKEWNRKAFRGVEL 140


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F GVE 
Sbjct: 120 QAHQSLRNKEWNRKAFRGVEL 140


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINAATNLKVIARAGVGVDNINIEAATLKGILVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F GVE 
Sbjct: 120 QAHQSLRNKEWNRKAFRGVEL 140


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +KV+GRAGIG DNVD+  A+  GI+VMNTPFGN+ITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAAENLKVIGRAGIGVDNVDIPKATARGIIVMNTPFGNAITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG E 
Sbjct: 121 AADTSTQSGKWEKSRFMGREL 141


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VIEAGKNLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSMSRFIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ANES   G+W +  F GVE 
Sbjct: 117 AANESMKAGEWNRKAFTGVEV 137


>gi|25027935|ref|NP_737989.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium efficiens
           YS-314]
 gi|259506328|ref|ZP_05749230.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
 gi|23493218|dbj|BAC18189.1| putative D-3-phosphoglycerate dehydrogenase [Corynebacterium
           efficiens YS-314]
 gi|259166108|gb|EEW50662.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
          Length = 530

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHA+SL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVMVANAPTSNIHSACEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   G+W++ +F GVE 
Sbjct: 122 AADATLRDGEWKRSSFNGVEI 142


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  + V+GRAGIGTDN+D   AS+AGI+VMNTPFGN ITTAEHAI++M A+ARQIP
Sbjct: 61  LLQNAPNLTVIGRAGIGTDNIDKDAASKAGIIVMNTPFGNMITTAEHAIAMMFAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKSKFMGVEL 141


>gi|26345686|dbj|BAC36494.1| unnamed protein product [Mus musculus]
          Length = 533

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 123 QATASMKDGKWDRKKFMGTEL 143


>gi|52353955|ref|NP_058662.2| D-3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|55584180|sp|Q61753|SERA_MOUSE RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH;
           AltName: Full=A10
 gi|41529270|dbj|BAD08449.1| 3-phosphoglycerate dehyrogenase [Mus musculus]
 gi|56104627|gb|AAH86668.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|74146580|dbj|BAE41303.1| unnamed protein product [Mus musculus]
 gi|83404941|gb|AAI10674.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|148707012|gb|EDL38959.1| mCG11110 [Mus musculus]
          Length = 533

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 123 QATASMKDGKWDRKKFMGTEL 143


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 65  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 125 AADTSTQAGKWEKSKFMGVEI 145


>gi|218516115|ref|ZP_03512955.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 283

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 44  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 103

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 104 AADTSTQAGKWEKSKFMGVEI 124


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|327288752|ref|XP_003229089.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Anolis
           carolinensis]
          Length = 531

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+GRAG G DNVD+  A+R GI+VMNTP GNS++ AE    +++++ARQIP
Sbjct: 68  VINAAAKLQVIGRAGTGVDNVDVDAATRKGILVMNTPTGNSLSAAELTCGMIMSLARQIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKW++  FMG+E 
Sbjct: 128 QAAASMKEGKWDRKKFMGMEL 148


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  VIAAASKLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW++  ++G E 
Sbjct: 117 QAHAGMRVGKWDRKKYVGNEL 137


>gi|218507544|ref|ZP_03505422.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 239

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGAKNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+AR +P
Sbjct: 58  VLAAATNLKVVGRAGIGVDNVDIPAASAKGVVVMNTPFGNSITTAEHAIALMFALARDLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++ST  GKWEK  FMGVE 
Sbjct: 118 EADKSTQAGKWEKNRFMGVEV 138


>gi|124486358|ref|YP_001030974.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
 gi|124363899|gb|ABN07707.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
          Length = 527

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A KMK +GRAG+G DN+D   A++ GI+V N P GN++   EH I++M+A+AR IP
Sbjct: 58  IIEAADKMKYIGRAGVGVDNIDCEAATKKGIIVSNAPEGNTLAATEHTIAMMMAMARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S  KG+W++  FMG E
Sbjct: 118 QASASLKKGEWKRSKFMGNE 137


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VIEAGNQLKIIGRAGVGVDNIDVPAATRRGIMVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S  + KWE+ NF+G E 
Sbjct: 117 EANQSVKEKKWERKNFIGSEV 137


>gi|193787479|dbj|BAG52685.1| unnamed protein product [Homo sapiens]
          Length = 499

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 29  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 88

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 89  QATASMKDGKWERKKFMGTEL 109


>gi|56204623|emb|CAI22213.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205098|emb|CAI22409.1| phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 499

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 29  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 88

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 89  QATASMKDGKWERKKFMGTEL 109


>gi|148727271|ref|NP_001092041.1| D-3-phosphoglycerate dehydrogenase [Pan troglodytes]
 gi|156633629|sp|A5A6P1|SERA_PANTR RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|146741516|dbj|BAF62414.1| phosphoglycerate dehydrogenase [Pan troglodytes verus]
          Length = 533

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|93279902|pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate
           Dehydrogenase
 gi|93279903|pdb|2G76|B Chain B, Crystal Structure Of Human 3-Phosphoglycerate
           Dehydrogenase
          Length = 335

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 83  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 142

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 143 QATASMKDGKWERKKFMGTEL 163


>gi|5771523|gb|AAD51415.1|AF171237_1 3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|2674062|gb|AAB88664.1| 3-phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 533

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|197098608|ref|NP_001126309.1| D-3-phosphoglycerate dehydrogenase [Pongo abelii]
 gi|71153760|sp|Q5R7M2|SERA_PONAB RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|55731044|emb|CAH92238.1| hypothetical protein [Pongo abelii]
          Length = 533

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|23308577|ref|NP_006614.2| D-3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|21264510|sp|O43175|SERA_HUMAN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|12653075|gb|AAH00303.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|12655003|gb|AAH01349.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|15030035|gb|AAH11262.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|48145707|emb|CAG33076.1| PHGDH [Homo sapiens]
 gi|56204622|emb|CAI22212.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205096|emb|CAI22407.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|119577112|gb|EAW56708.1| phosphoglycerate dehydrogenase, isoform CRA_b [Homo sapiens]
 gi|123982516|gb|ABM82999.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|157928102|gb|ABW03347.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|189067496|dbj|BAG37755.1| unnamed protein product [Homo sapiens]
 gi|261860040|dbj|BAI46542.1| phosphoglycerate dehydrogenase [synthetic construct]
          Length = 533

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KV+GRAGIG DNV++  A+ AGIVVMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 60  VIAAAKKLKVIGRAGIGVDNVNIPAATAAGIVVMNTPFGNSITTAEHAIAMMFALARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 120 AADASTQAGKWEKNRFMGVEL 140


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A K+KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILANAHKLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASASTHAGKWEKNAFMGVEL 141


>gi|18977766|ref|NP_579123.1| phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM 3638]
 gi|18893507|gb|AAL81518.1| phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM 3638]
          Length = 306

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM A+AR+I 
Sbjct: 57  VIENAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +GKW K   MG+E 
Sbjct: 117 YADRKMREGKWAKKECMGIEL 137


>gi|301786056|ref|XP_002928441.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Ailuropoda
           melanoleuca]
 gi|281341105|gb|EFB16689.1| hypothetical protein PANDA_018382 [Ailuropoda melanoleuca]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 50/81 (61%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+GRAG+  DN+DL  A+  G++VMNTPFGNSITTAEHAI+LM A+AR+IP
Sbjct: 61  VLERAERLKVIGRAGVSVDNIDLAAATAKGVIVMNTPFGNSITTAEHAIALMFALARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST +GKWEK  F+GVE 
Sbjct: 121 AADASTRQGKWEKARFLGVEI 141


>gi|90079521|dbj|BAE89440.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|90076160|dbj|BAE87760.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|166900094|sp|Q60HD7|SERA_MACFA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|90075028|dbj|BAE87194.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|109014689|ref|XP_001114128.1| PREDICTED: d-3-phosphoglycerate dehydrogenase isoform 3 [Macaca
           mulatta]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|52782263|dbj|BAD51978.1| 3-phosphoglycerate dehydrogenase [Macaca fascicularis]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 60  ILEAATNLKVIGRAGIGVDNVDIPAASAQGVVVMNTPFGNSITTAEHAIALMFALARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 120 EADLSTQAGKWEKNRFMGVEV 140


>gi|13928850|ref|NP_113808.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|3122856|sp|O08651|SERA_RAT RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|1944614|emb|CAA66374.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|7688285|emb|CAB89828.1| 3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|55562727|gb|AAH86327.1| Phgdh protein [Rattus norvegicus]
 gi|149030526|gb|EDL85563.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
 gi|149030528|gb|EDL85565.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 123 QATASMKDGKWDRKKFMGTEL 143


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN++TTAEH +SL++++AR+IP
Sbjct: 61  ILKNADRLKVIGRAGAGLDNVDLEAATERGIVVMNTPGGNTVTTAEHTMSLLMSMARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWEK  FMGVE 
Sbjct: 121 QANASNKAGKWEKSKFMGVEL 141


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAG G DNVDL  A+  GIVVMNTP GN++TTAEH +SL++++AR+IP
Sbjct: 61  ILKNADRLKVIGRAGAGLDNVDLEAATERGIVVMNTPGGNTVTTAEHTMSLLMSMARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWEK  FMGVE 
Sbjct: 121 QANASNKAGKWEKSKFMGVEL 141


>gi|207079971|ref|NP_001128745.1| DKFZP469K2432 protein [Pongo abelii]
 gi|55725727|emb|CAH89645.1| hypothetical protein [Pongo abelii]
          Length = 329

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE A  +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELACGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|67971102|dbj|BAE01893.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++ MNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLGMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DN+D+  A+  G+VVMNTPFGN+ITTAEHAI+++ A ARQIP
Sbjct: 58  VIAAATNLKVIGRAGIGVDNIDIKAATAKGVVVMNTPFGNAITTAEHAIAMLFAAARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T  GKW K  +MGVE 
Sbjct: 118 AANADTQAGKWPKSGYMGVEL 138


>gi|86821596|gb|AAI05480.1| Phosphoglycerate dehydrogenase [Bos taurus]
 gi|296489452|gb|DAA31565.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  IINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QAAASMKDGKWERKKFMGTEL 143


>gi|78042498|ref|NP_001030189.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
 gi|71153759|sp|Q5EAD2|SERA_BOVIN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|59857639|gb|AAX08654.1| phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  IINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QAAASMKDGKWERKKFMGTEL 143


>gi|330839849|ref|YP_004414429.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329747613|gb|AEC00970.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
          Length = 527

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 56  VIDKAAKLKIIGRAGVGVDNIDVAAATARGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +ANE+  KG+W +  ++GVE 
Sbjct: 116 IANETMQKGEWNRKKYVGVEL 136


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI+LM A+ARQIP
Sbjct: 61  ILENASRLKVIGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIALMFALARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG+E 
Sbjct: 121 AADASTQAGKWEKNRFMGLEI 141


>gi|260888757|ref|ZP_05900020.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
 gi|260861510|gb|EEX76010.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++MLA++R IP
Sbjct: 58  VIDKAAKLKIIGRAGVGVDNIDVAAATARGIIVINSPGGNTIAATEHTMAMMLAMSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +ANE+  KG+W +  ++GVE 
Sbjct: 118 IANETMQKGEWNRKKYVGVEL 138


>gi|116751067|ref|YP_847754.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700131|gb|ABK19319.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 526

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVV RAGIG DNVD+  AS+ GIVVMNTP GN +TTAEHAI+++LA++R IP
Sbjct: 58  IIDAADNLKVVARAGIGLDNVDVEAASKRGIVVMNTPEGNIVTTAEHAIAMILALSRSIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  FMG E 
Sbjct: 118 QATNSIKSGKWEKKRFMGREV 138


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  A+  GI+VMNTPFGN+ITTAEHAIS+M+A+ARQIP
Sbjct: 61  IIAAADNLKVVGRAGIGVDNVDIPKATARGIIVMNTPFGNAITTAEHAISMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG E 
Sbjct: 121 AADASTQAGKWEKSRFMGREI 141


>gi|327321766|gb|AEA48241.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum]
          Length = 530

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K+VGRAG+G DNVD+  A+ AG++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VIAAAPNLKIVGRAGVGLDNVDIPAATEAGVLVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++ +F GVE 
Sbjct: 122 AADATLREGEWKRSSFNGVEI 142


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  AS+ GIVVMN P GN+ T AEHA+++M+A+ R +P
Sbjct: 57  IIEAADNLKVVGRAGIGLDNVDVAAASQKGIVVMNAPDGNATTAAEHAVAMMMALTRNVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK  F G E 
Sbjct: 117 QATASMKEGKWEKKKFQGREV 137


>gi|73668955|ref|YP_304970.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
 gi|72396117|gb|AAZ70390.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
          Length = 523

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DNVD+  A++ GI+V N+P GN I+ AEH I++M+A++R IP
Sbjct: 56  IIEAADNLKIIGRAGVGIDNVDVDAATKKGIIVANSPEGNMISAAEHTIAMMMAMSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W++  F GVE 
Sbjct: 116 QANASLKGKEWKRSKFTGVEV 136


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++ +GRAG+G DNVD+  A+R G++V N P GN++   EH +++ML++AR IP
Sbjct: 59  VITAGKKLRFIGRAGVGVDNVDVDAATRQGVIVANAPEGNTLAATEHTMAMMLSLARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  K +W++  FMGVE 
Sbjct: 119 QANASLKKKEWKRSKFMGVEL 139


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A ++KVVGRAGIG DNVD+  A+  G++VMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 61  ILANATRLKVVGRAGIGVDNVDIPAATAKGVIVMNTPFGNSITTAEHAIAMMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKNRFMGVEL 141


>gi|296228521|ref|XP_002759845.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Callithrix jacchus]
          Length = 533

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    ++L++ARQIP
Sbjct: 63  VISAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMILSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/81 (61%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNV++  A+  GI+VMNTPFGN+ITTAEHAI++M ++ARQIP
Sbjct: 61  IIEAATNLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNAITTAEHAIAMMFSVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKSKFMGVEI 141


>gi|308177181|ref|YP_003916587.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744644|emb|CBT75616.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
          Length = 531

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 57/80 (71%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N I+ AE  +  ++++AR+IP 
Sbjct: 62  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIISAAELTVGHIVSLARRIPA 121

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN S   G+W++ +F GVE 
Sbjct: 122 ANASLKNGEWKRSSFTGVEL 141


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 127 AADASTQAGKWEKNRFMGVEL 147


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 127 AADASTQAGKWEKNRFMGVEL 147


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 127 AADASTQAGKWEKNRFMGVEL 147


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIG D +D+  A+  G++VMNTPFGNSITTAEHAI+L+ A+ARQIP
Sbjct: 67  LLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPFGNSITTAEHAIALIFALARQIP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 127 AADASTQAGKWEKNRFMGVEL 147


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS+AK +K++GRAG+G DN+++  A++ GIVV+N+P GN I+ AEH   L++++ R IP
Sbjct: 59  ILSNAKNLKIIGRAGVGVDNINVEAATKYGIVVVNSPEGNIISAAEHTFGLIISLLRNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W++  F G E 
Sbjct: 119 QADRSVRNLEWKRNKFTGHEL 139


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVD+  ASR GI+VMNTPFGNS+TTAEHAI+LM A+ARQ+P
Sbjct: 61  LLEKAGRLKVIGRAGIGVDNVDISAASRRGIIVMNTPFGNSVTTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH G+WEK  FMGVE 
Sbjct: 121 EASASTHAGRWEKNRFMGVEL 141


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A+K+K++GRAG+G DN+D+  A+  GI+V+N P  +SI+ AE  + LMLA AR IP
Sbjct: 57  VIENAEKLKIIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTLGLMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  F G+E 
Sbjct: 117 QATASLKRGEWDRKRFKGIEL 137


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++V+ RAGIG DNVD+  A+  GIVVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 60  VIAAANKLRVIARAGIGVDNVDIPAATAKGIVVMNTPFGNSITTAEHAIAMMFALARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 120 AADVSTQGGKWEKNRFMGVEL 140


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAEATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADNSTQAGKWEKSKFMGVEI 141


>gi|255324581|ref|ZP_05365698.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
 gi|255298487|gb|EET77787.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
          Length = 528

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAATKLKIVGRAGVGLDNVDIPAATDKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F GVE 
Sbjct: 119 AADQSLREGEWKRSSFKGVEV 139


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG+G DN+DL  A+  GI+V+N P GN+ + AEH +++++++AR+IP
Sbjct: 60  LIEKASNLKIIGRAGVGVDNIDLEAATEHGIIVVNAPDGNTNSAAEHTMAMIMSMARKIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +    +W++ +++GVE 
Sbjct: 120 QAFHALRNQQWDRKSYVGVEL 140


>gi|312194898|ref|YP_004014959.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
 gi|311226234|gb|ADP79089.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
          Length = 527

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A K+KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAAPKLKVVARAGIGLDNVDVPAATTRGVMVVNAPQSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A++S   G+W++  + GVE 
Sbjct: 118 ADQSLQNGEWKRSKYTGVEL 137


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 49  ILDAATNLKVIGRAGIGVDNVDIPYASAKGVIVMNTPFGNSITTAEHAIALMFALARQLP 108

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T  G W K  FMGVE 
Sbjct: 109 EANAQTQAGLWPKNGFMGVEV 129


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+ARQIP
Sbjct: 62  ILANAKNLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLALARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG+E 
Sbjct: 122 QADASTQAGKWEKNRFMGIEI 142


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +  ++V+ RAG+G DN+D+  A+R GI+V+N+P GN+I+  EH +++ML+++R IP
Sbjct: 59  IIEASGNLRVIARAGVGVDNIDVDAATRKGIIVVNSPGGNTISATEHTLAMMLSLSRNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   GKWE+  F GVE 
Sbjct: 119 QAHKSAAAGKWEREKFKGVEL 139


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADGSTQAGKWEKSKFMGVEI 141


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADGSTQAGKWEKSKFMGVEI 141


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADGSTQAGKWEKSKFMGVEI 141


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  LIAAATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADGSTQAGKWEKSKFMGVEI 141


>gi|94265988|ref|ZP_01289711.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase,
           NAD-binding [delta proteobacterium MLMS-1]
 gi|93453454|gb|EAT03870.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase,
           NAD-binding [delta proteobacterium MLMS-1]
          Length = 304

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ +KVVGRAGIG DNVD+  AS+ G+VVMN P GN+ T AEHA+S+M+A+ R IP
Sbjct: 57  ILEAAENLKVVGRAGIGLDNVDVPAASKKGVVVMNAPDGNATTAAEHAVSMMMALTRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  F G E 
Sbjct: 117 QATASMKAGKWEKKKFQGHEV 137


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++ML ++R IP
Sbjct: 57  VIAAASRLKIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMMLTLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW++  ++G E 
Sbjct: 117 QAHGGMQAGKWDRKKYVGNEL 137


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KVVGRAGIG DNVD+  A+ AG+VVMNTPFGNSITTAEHAI++M A+ARQ+P
Sbjct: 58  VIAAAKNLKVVGRAGIGVDNVDIPSATAAGVVVMNTPFGNSITTAEHAIAMMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 118 AADVSTQAGKWEKNRFMGVEL 138


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+     +KV+GRAGIG DNVD+  A+  GI VMNTPFGN+ TTAEHAI++ML++ARQIP
Sbjct: 60  MIEAGTDLKVIGRAGIGVDNVDIDAATATGIAVMNTPFGNATTTAEHAIAMMLSLARQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ANESTH+GKWEK  FMG E 
Sbjct: 120 QANESTHQGKWEKSRFMGREI 140


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIEGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 69/81 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+GRAGIG DNVD+  AS+ G++VMNTPFGNS+TTAEHAI+LM A+ARQ+P
Sbjct: 60  LLENAGKLKVIGRAGIGVDNVDIPAASKKGVIVMNTPFGNSVTTAEHAIALMFAVARQLP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH+GKWEK  FMGVE 
Sbjct: 120 EASVSTHEGKWEKNRFMGVEL 140


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  IIEAAPRLKIIGRAGVGVDNVDVPTATKNGVLVVNSPEGNTIAAAEHALAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W +  ++G E 
Sbjct: 117 AAHSSTASGGWNRKAYVGNEL 137


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLA++R IP
Sbjct: 57  IIEAGTHLKIIGRAGVGVDNVDVPAATRQGIVVVNSPQGNTIAAAEHAIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W +  F+GVE 
Sbjct: 117 EANVSVKNGQWNRKQFIGVEV 137


>gi|90077516|dbj|BAE88438.1| unnamed protein product [Macaca fascicularis]
          Length = 299

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKDGKWERKKFMGTEL 143


>gi|227832959|ref|YP_002834666.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|262182554|ref|ZP_06041975.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|227453975|gb|ACP32728.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
          Length = 528

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQ+P
Sbjct: 59  VLAAAENLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSACEQAIALLLATARQVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F GVE 
Sbjct: 119 AADQSLRQGEWKRSSFKGVEI 139


>gi|260577503|ref|ZP_05845445.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
 gi|258604372|gb|EEW17607.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
          Length = 529

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 61  VLEAAPKLQIVGRAGVGLDNVDIDTATSRGVMVANAPTSNIHSACEHAISLLLSTARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 121 AADKTLRDGEWKRSSFKGVEI 141


>gi|68536373|ref|YP_251078.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
 gi|68263972|emb|CAI37460.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
          Length = 529

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 61  VLEAAPKLQIVGRAGVGLDNVDIDTATSRGVMVANAPTSNIHSACEHAISLLLSTARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 121 AADKTLRDGEWKRSSFKGVEI 141


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAATQLKIIGRAGVGVDNIDVQAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    KWE+  F+G E 
Sbjct: 117 EANQSVKNDKWERKRFIGAEV 137


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DNVDL  A+  GI+V+N+P  +SI+ AE A+ LML+ AR IP
Sbjct: 57  IIDAADNLKVIARAGVGVDNVDLTAATEKGIIVVNSPDASSISVAELALGLMLSSARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++ +F G+E 
Sbjct: 117 QATASLKRGEWDRKSFKGMEL 137


>gi|57641901|ref|YP_184379.1| D-3-phosphoglycerate dehydrogenase [Thermococcus kodakarensis KOD1]
 gi|57160225|dbj|BAD86155.1| D-3-phosphoglycerate dehydrogenase [Thermococcus kodakarensis KOD1]
          Length = 304

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE AI L+ A+AR+I 
Sbjct: 57  VIEAAPKLKVIGRAGVGLDNIDLKAAEERGIKVVNSPGASSRSVAELAIGLIFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 117 FADRKMREGVWAKKQCMGIEL 137


>gi|14520969|ref|NP_126444.1| phosphoglycerate dehydrogenase (serA), Nter fragment [Pyrococcus
           abyssi GE5]
 gi|5458186|emb|CAB49675.1| serA D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) [Pyrococcus
           abyssi GE5]
          Length = 307

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A++LM A+AR+I 
Sbjct: 60  VIESAPKLKVIARAGVGLDNIDVEAAKERGIEVVNAPAASSRSVAELAVALMFAVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 120 FADRKMREGVWAKKQAMGIEL 140


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K +GRAGIG DN+D+  A++ GI+V N P  N++  AEH + LMLA+AR+IP
Sbjct: 56  VIEAAGRLKAIGRAGIGVDNIDIEAATKRGILVANAPESNTVAAAEHTLGLMLAVARRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W +  F GVE 
Sbjct: 116 AADASLRRGEWNRAAFKGVEV 136


>gi|194210920|ref|XP_001501069.2| PREDICTED: similar to phosphoglycerate dehydrogenase isoform 1
           [Equus caballus]
          Length = 545

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 75  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 134

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 135 QATASMKGGKWDRKKFMGTEL 155


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNVD+  AS  G+VVMNTPFGNSITTAEHAI++M A+ARQIP
Sbjct: 72  ILDAATNLKVIGRAGIGVDNVDIPAASAQGVVVMNTPFGNSITTAEHAIAMMFALARQIP 131

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T  G W K  FMGVE 
Sbjct: 132 EANAQTQAGLWPKNGFMGVEV 152


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VIEAGKNLKIIGRAGVGVDNVDIPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    +W +  F+G E 
Sbjct: 117 DANQSVKAKEWNRKKFIGAEV 137


>gi|332159609|ref|YP_004424888.1| phosphoglycerate dehydrogenase [Pyrococcus sp. NA2]
 gi|331035072|gb|AEC52884.1| phosphoglycerate dehydrogenase [Pyrococcus sp. NA2]
          Length = 304

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM A+AR+I 
Sbjct: 57  VIENAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +GKW K   MG+E 
Sbjct: 117 FADRKMREGKWAKKEAMGIEL 137


>gi|310794865|gb|EFQ30326.1| phosphoglycerate dehydrogenase [Glomerella graminicola M1.001]
          Length = 567

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  KK++VV RAG+G DN+D+  A+  GI+V+N+P GN    AEH I+L+LA AR + 
Sbjct: 76  VLAAGKKLRVVARAGVGVDNIDVDTATERGIIVVNSPNGNIFAAAEHTIALLLATARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 136 RADTTMKEGKWERSKLVGVEVG 157


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K +GRAG+G DN+D   A+R GI+V N P GN++   EH +++M+A+AR IP
Sbjct: 62  VIEAGTHLKFIGRAGVGVDNIDTDAATRQGIIVANAPEGNTLAATEHTVAMMMALARNIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  + +W++  F G+E 
Sbjct: 122 QANASVKRHEWKRSKFTGIEV 142


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A++++VVGRAGIG DNVD+  A+  G++VMNTP GN++TTAEHAI++MLA+AR+IP
Sbjct: 63  LLDKAERLRVVGRAGIGVDNVDVPAATARGVIVMNTPHGNAVTTAEHAIAMMLALAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST +G+WEK  F+G+E 
Sbjct: 123 QADASTQQGRWEKNRFLGIEL 143


>gi|291398138|ref|XP_002715722.1| PREDICTED: phosphoglycerate dehydrogenase [Oryctolagus cuniculus]
          Length = 533

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  FMG E 
Sbjct: 123 QATASMKGGKWERKKFMGTEL 143


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNVDL  A+  G++VMNTPFGNSITTAEHAI++M A+AR+IP
Sbjct: 61  ILQKAGRLKVIGRAGIGVDNVDLPAATAKGVIVMNTPFGNSITTAEHAIAMMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKNRFMGVEV 141


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++++ RAG+G DN+D+  A++ GIVV+N P GN+I+TAEH  ++M ++ R IP
Sbjct: 56  LLDKMPRLQIIARAGVGVDNIDVAEATKRGIVVVNAPDGNTISTAEHTFAMMASLMRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +    +W + +F+G E 
Sbjct: 116 QAHRTVKNLEWNRNSFIGNEL 136


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A K+KV+ RAGIGTDN+D   AS+ G++VMNTPFGN ITTAEHAI++M A+ARQ+P
Sbjct: 61  ILANAHKLKVIARAGIGTDNIDKEAASKKGVIVMNTPFGNMITTAEHAIAMMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ STH GKWEK  FMGVE 
Sbjct: 121 EASVSTHAGKWEKNAFMGVEL 141


>gi|41054619|ref|NP_955871.1| D-3-phosphoglycerate dehydrogenase [Danio rerio]
 gi|33990002|gb|AAH56334.1| Zgc:65956 [Danio rerio]
          Length = 527

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +K++GRAG G DNVD+  A++ GI+VMNTP GN+++ AE   +L+++++R IP
Sbjct: 63  VINAGSSLKIIGRAGTGVDNVDVDAATKRGIIVMNTPSGNTLSAAELTCALVMSLSRHIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 123 QAVISMKDGKWDRKKFMGSEL 143


>gi|227548065|ref|ZP_03978114.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079863|gb|EEI17826.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 554

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A+  G++V N P  N  +  EHAI+L+LA ARQIP
Sbjct: 86  VIEAAPQLKIIGRAGVGLDNVDIDAATERGVMVANAPTSNIHSACEHAIALLLATARQIP 145

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++    +W++  F GVE 
Sbjct: 146 AADKTLRDAEWKRSAFKGVEV 166


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+ V+GRAG G DN+D+  AS+ GIVVMNTP GN++TT EHAI++ML++AR+IP
Sbjct: 59  ILDSADKLTVIGRAGAGVDNIDVEAASKKGIVVMNTPGGNTVTTGEHAIAMMLSLARKIP 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   GKWEK  FMG E
Sbjct: 119 QATASMKAGKWEKSRFMGNE 138


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +MLA AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLAAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++ +F G+E 
Sbjct: 117 QATASIKSGKWDRKSFKGMEI 137


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA+++MLA++R +P
Sbjct: 57  IIEAATRLKIIGRAGVGVDNVDVEAATQRGVLVVNSPEGNTIAAAEHALAMMLALSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G WE+  ++G E 
Sbjct: 117 QAHVSTMAGGWERKKYVGNEL 137


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDHATNLKVIGRAGIGVDNVDIPAASSKGVIVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T +G W K  FMGVE 
Sbjct: 118 EANAQTQQGLWPKNGFMGVEV 138


>gi|289432486|ref|YP_003462359.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
 gi|288946206|gb|ADC73903.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
          Length = 526

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 RANASLKSGQWKRNEFVGSEL 137


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAGIG DNVD+  A+  GIVVMNTPFGN+ITTAEHAI++M A+ RQIP
Sbjct: 61  IIKAATNLKVIGRAGIGVDNVDIPAATAKGIVVMNTPFGNAITTAEHAIAMMFAVTRQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG E 
Sbjct: 121 AADVSTQAGKWEKSRFMGNEV 141


>gi|147669219|ref|YP_001214037.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
 gi|146270167|gb|ABQ17159.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
          Length = 526

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 RANASLKSGQWKRNEFVGSEL 137


>gi|14591190|ref|NP_143266.1| phosphoglycerate dehydrogenase [Pyrococcus horikoshii OT3]
 gi|88191759|pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From
           Pyrococcus Horikoshii Ot3
 gi|88191760|pdb|1WWK|B Chain B, Crystal Structure Of Phosphoglycerate Dehydrogenase From
           Pyrococcus Horikoshii Ot3
 gi|3257810|dbj|BAA30493.1| 307aa long hypothetical phosphoglycerate dehydrogenase [Pyrococcus
           horikoshii OT3]
          Length = 307

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG+G DN+D+  A   GI V+N P  +S + AE A+ LM ++AR+I 
Sbjct: 60  VIESAPKLKVIARAGVGLDNIDVEAAKEKGIEVVNAPAASSRSVAELAVGLMFSVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 120 FADRKMREGVWAKKEAMGIEL 140


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHAI++MLA++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRQGIVVVNSPQGNTIAAAEHAIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W +  F+GVE 
Sbjct: 117 EANVSVKSGQWNRKQFIGVEV 137


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  +KV+GRAGIG DNVD+  AS  G++VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 58  ILDHATNLKVIGRAGIGVDNVDIPAASAKGVIVMNTPFGNSITTAEHAIALMFALARQLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN  T +G W K  FMGVE 
Sbjct: 118 EANAQTQQGLWPKNGFMGVEV 138


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A++++++GRAG+G DNVDL  A+R GIVV+N+P GN+I  AEHAI+LM++++R + 
Sbjct: 57  VIEAAQRLRIIGRAGVGVDNVDLQAATRKGIVVVNSPEGNTIAAAEHAIALMMSLSRHVG 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+GVE 
Sbjct: 117 EANASLKAGQWKRSQFIGVEV 137


>gi|325833264|ref|ZP_08165770.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
 gi|325485646|gb|EGC88114.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
          Length = 530

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++++GRAG+G DNVD+  A+  GI+V N P  N ++ AEHAI LMLA AR++P
Sbjct: 63  VVEAADRLRIIGRAGVGVDNVDVEAATEHGIIVCNAPTSNIVSAAEHAIGLMLACARKVP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S H+G WE+  + GVE 
Sbjct: 123 QANASMHEGVWERGKYTGVEL 143


>gi|257791620|ref|YP_003182226.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|317487964|ref|ZP_07946548.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
 gi|257475517|gb|ACV55837.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|316912946|gb|EFV34471.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
          Length = 526

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++++GRAG+G DNVD+  A+  GI+V N P  N ++ AEHAI LMLA AR++P
Sbjct: 59  VVEAADRLRIIGRAGVGVDNVDVEAATEHGIIVCNAPTSNIVSAAEHAIGLMLACARKVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S H+G WE+  + GVE 
Sbjct: 119 QANASMHEGVWERGKYTGVEL 139


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 DANASVKSGEWDRKTFVGAEV 137


>gi|148265877|ref|YP_001232583.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146399377|gb|ABQ28010.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 539

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++L+LA  R I 
Sbjct: 58  LLDAAKKLKMVARAGVGIDNVDVDYASARGVIVVNAPFGNTNSAAEHTMALLLAFYRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F G E 
Sbjct: 118 KANASLKSGEWKRAPFTGYEL 138


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANAKNLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 QADASTQAGKWEKNRFMGVEI 142


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++++L+++R +P
Sbjct: 57  VIEAADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALAMLLSVSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G W++  ++G E 
Sbjct: 117 QAHGSMRSGAWDRKKYVGNEL 137


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIAAGTQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    KWE+  F+G E 
Sbjct: 117 EANQSVKNNKWERKRFIGAEI 137


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KV+GRAGIGT+N+DL  A+  G+VVMNTPFGNS+TTAEHAI+LM ++ARQIP
Sbjct: 58  LLAAATRLKVIGRAGIGTENIDLAAATDQGVVVMNTPFGNSVTTAEHAIALMFSLARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN STH GKWEK  FMGVE 
Sbjct: 118 AANASTHLGKWEKSRFMGVEL 138


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VLESASHLKVVARAGVGVDNIDINAATLNGIIVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G W +  F GVE 
Sbjct: 120 NAHASLQQGAWNRKAFRGVEL 140


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMAAGKNLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++  F+GVE 
Sbjct: 119 QAYAKTIGGTWDRKTFLGVEL 139


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  VLESASHLKVVARAGVGVDNIDINAATLNGIIVINAPDGNTISATEHSVAMLLAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G W +  F GVE 
Sbjct: 120 NAHASLQQGAWNRKAFRGVEL 140


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  HAKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AEHAI+L+LA AR +P
Sbjct: 59  VFEHAKKLRVVARAGVGLDNVDVEAATKAGVMVVNAPTSNIVTAAEHAIALLLATARNVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++  + GVE 
Sbjct: 119 QAHAALKQGEWKRSKYTGVEL 139


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A+R G+VV+N P GN+I+TAEH  ++M ++ R+IP
Sbjct: 56  LLQKMTNLKIVGRAGVGVDNIDVDAATRYGVVVINAPNGNTISTAEHTFAMMASLVRRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G+E 
Sbjct: 116 QAHISVKSREWNRSAFVGIEL 136


>gi|302408012|ref|XP_003001841.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
 gi|261359562|gb|EEY21990.1| D-3-phosphoglycerate dehydrogenase [Verticillium albo-atrum
           VaMs.102]
          Length = 630

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  KK+KVV RAG+G DN+D+  A++ GI+V+N+P GN +  AEH I+L+ A AR + 
Sbjct: 76  VLAAGKKLKVVARAGVGVDNIDVDAATQHGIIVVNSPAGNILAAAEHTIALLFATARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +   GKWE+   +GVE G
Sbjct: 136 RADTTMKDGKWERGKLVGVEVG 157


>gi|50751002|ref|XP_422226.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 525

 Score = 93.8 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAG G DNVD+  A+R G++VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VLEAAGRLQVVGRAGTGVDNVDVDAATRKGVLVMNTPTGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKW++  +MG+E 
Sbjct: 123 QAAASMKEGKWDRKKYMGMEL 143


>gi|255932639|ref|XP_002557876.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582495|emb|CAP80682.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 596

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LM+++AR+IP
Sbjct: 64  VLRAAKNLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALMMSMARKIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +  S   GKWE+  F+GVE 
Sbjct: 124 ESCASLKDGKWERSKFVGVEV 144


>gi|270307961|ref|YP_003330019.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
 gi|270153853|gb|ACZ61691.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
          Length = 526

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LML++AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLSMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 RANASLKSGQWKRNEFVGSEL 137


>gi|57234596|ref|YP_181341.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
 gi|57225044|gb|AAW40101.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
          Length = 526

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LML++AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHTLALMLSMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 RANASLKSGQWKRNEFVGSEL 137


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G+W++  F+G E 
Sbjct: 117 DANASVKRGEWDRKTFVGAEV 137


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G+W++  F+G E 
Sbjct: 117 DANASVKRGEWDRKTFVGAEV 137


>gi|240102377|ref|YP_002958686.1| D-3-phosphoglycerate dehydrogenase, putative (serA) [Thermococcus
           gammatolerans EJ3]
 gi|239909931|gb|ACS32822.1| D-3-phosphoglycerate dehydrogenase, putative (serA) [Thermococcus
           gammatolerans EJ3]
          Length = 304

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE    L+ A+AR++ 
Sbjct: 57  VIENAPKLKVIGRAGVGLDNIDLEAAKERGIKVVNSPGASSRSVAELVFGLLFAVARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 117 FADRKMREGVWAKKQCMGIEL 137


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  IIERAKRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 QADASTQAGKWEKNRFMGVEI 142


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K++++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 74  VIEAGQKLRIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 133

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN ST  G W++ +F+G E 
Sbjct: 134 DANASTKSGGWDRKSFVGTEV 154


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  IIERAKRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 QADASTQAGKWEKNRFMGVEI 142


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 53/75 (70%), Positives = 62/75 (82%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +KV+GRAGIGTDN+D   AS+ GI+VMNTPFGN ITTAEHAI++M A+ARQIP A+ ST
Sbjct: 67  NLKVIGRAGIGTDNIDKDAASKKGIIVMNTPFGNMITTAEHAIAMMFAVARQIPEASAST 126

Query: 67  HKGKWEKFNFMGVEA 81
           H GKWEK  FMGVE 
Sbjct: 127 HAGKWEKSKFMGVEL 141


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++L++A  R + 
Sbjct: 58  LLDAAKNLKMVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHTMALLMAACRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           VAN S   G+W++  F GVE 
Sbjct: 118 VANASLKAGEWKRAPFTGVEL 138


>gi|326924873|ref|XP_003208648.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Meleagris
           gallopavo]
          Length = 490

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAG G DNVD+  A+R G++VMNTP GNS++ AE    ++L +ARQIP
Sbjct: 63  VLEAAGRLQVVGRAGTGVDNVDVEAATRKGVLVMNTPTGNSLSAAELTCGMILCLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKW++  +MG+E 
Sbjct: 123 QAAASMKEGKWDRKKYMGMEL 143


>gi|311740551|ref|ZP_07714378.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304071|gb|EFQ80147.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 528

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLEAATKLKIVGRAGVGLDNVDIPTATDKGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  KG+W++ +F GVE 
Sbjct: 119 AADQSLRKGEWKRSSFKGVEV 139


>gi|291276391|ref|YP_003516163.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
 gi|290963585|emb|CBG39417.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
          Length = 527

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 59/81 (72%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ H+ K+K++GRAG+G DN+D+  A++ GI+V N+P GN+I  AEH + L+ A+ R IP
Sbjct: 56  VIQHS-KLKIIGRAGVGVDNIDIEAATQKGIIVTNSPDGNTIAAAEHTLGLIFALTRNIP 114

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN S  +GKWE+  F+G E 
Sbjct: 115 LANASVQEGKWERSKFVGREL 135


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILEKATNLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 QADASTQAGKWEKNRFMGVEI 142


>gi|297156963|gb|ADI06675.1| D-3-phosphoglycerate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 534

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IAAAKNLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 125 ANAALKNGEWKRSKYTGVEL 144


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VVEAGTQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S  + KW++  FMG E 
Sbjct: 117 DANQSVKENKWDRKRFMGTEV 137


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  G+VV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGVVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  KG+W++ +F G+E 
Sbjct: 117 QATASIKKGEWDRKSFKGMEI 137


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 60  IINHASNLKVIARAGVGVDNIDIKSATLNGILVVNAPDGNTISATEHSVAMILAMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    +W +  F GVE 
Sbjct: 120 QAYTSLKNKEWNRKAFKGVEL 140


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ HA ++KVVGRAGIG DN+D+  A+  GI+VMNTPFGN+ITTAEHAI++M+A+ARQIP
Sbjct: 61  IIVHADQLKVVGRAGIGVDNIDIPKATARGIIVMNTPFGNAITTAEHAIAMMMAVARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMG E 
Sbjct: 121 AADASTQAGKWEKSRFMGTEL 141


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ RAG+G DN+D+  A+  GI+V+N P GN+I+  EH+++++LA+AR IP
Sbjct: 398 IINHASNLKVIARAGVGVDNIDIKSATLNGILVVNAPDGNTISATEHSVAMILAMARNIP 457

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    +W +  F GVE 
Sbjct: 458 QAYTSLKNKEWNRKAFKGVEL 478


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAGIG DNVD+  ASR GI+VMNTPFGNSITTAEHAI+LM A+ARQ+P
Sbjct: 61  IIQGATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADTSTQAGKWEKSKFMGVEI 141


>gi|148690212|gb|EDL22159.1| mCG50387 [Mus musculus]
          Length = 204

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S A+K++VVGRAG G DNVDL  A+R GI+VMNTP  NS++  E    +++ +ARQIP
Sbjct: 65  VISAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNVNSLSAEELTCGMIMCLARQIP 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      GKW++  FMG E 
Sbjct: 125 QATAWMKDGKWDQKKFMGTEL 145


>gi|212224614|ref|YP_002307850.1| D-3-phosphoglycerate dehydrogenase [Thermococcus onnurineus NA1]
 gi|212009571|gb|ACJ16953.1| D-3-phosphoglycerate dehydrogenase [Thermococcus onnurineus NA1]
          Length = 307

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE  ++LM A+AR+I 
Sbjct: 60  VIEAAPKLKVIGRAGVGLDNIDLDAAKERGIKVVNSPGASSRSVAELVVALMFAVARKIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W K   MG+E 
Sbjct: 120 FADRKMRGGVWAKKQCMGIEL 140


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + G+E 
Sbjct: 120 ASAALKDGEWKRSKYTGIEL 139


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + G+E 
Sbjct: 120 ASAALKDGEWKRSKYTGIEL 139


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + G+E 
Sbjct: 120 ASAALKDGEWKRSKYTGIEL 139


>gi|189346493|ref|YP_001943022.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
 gi|189340640|gb|ACD90043.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
          Length = 526

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG G DN+D+  A+R GI+VMNTP GN+++ AEHA  +++A AR IP
Sbjct: 57  IIECGKNLKLIGRAGAGVDNIDIEAATRHGIIVMNTPGGNTVSAAEHACGMLMAAARMIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G W K  F G+E 
Sbjct: 117 QATAELKAGLWNKKKFTGIEL 137


>gi|254173361|ref|ZP_04880034.1| D-3-phosphoglycerate dehydrogenase [Thermococcus sp. AM4]
 gi|214032770|gb|EEB73599.1| D-3-phosphoglycerate dehydrogenase [Thermococcus sp. AM4]
          Length = 304

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE    L+ A+AR+I 
Sbjct: 57  VIEAAPKLKVIGRAGVGLDNIDLEAAKERGIKVVNSPGASSRSVAELVFGLLFAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   +G+E 
Sbjct: 117 FADRKMREGVWAKKQCLGIEL 137


>gi|300933674|ref|ZP_07148930.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium resistens DSM
           45100]
          Length = 530

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VFEAAPKLQIVGRAGVGLDNVDIETATARGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 122 AADKTLRDGEWKRSSFKGVEI 142


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGVDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  KG+W++ +F G+E 
Sbjct: 117 QATASIKKGEWDRKSFKGMEI 137


>gi|257054946|ref|YP_003132778.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256584818|gb|ACU95951.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
          Length = 531

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR IP
Sbjct: 62  VLAEATKLKVVARAGVGLDNVDVAEATERGVLVVNAPTSNIVSAAEHAIALLLAVARNIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   G+W++  F GVE 
Sbjct: 122 AADQSLRSGEWKRSAFTGVEL 142


>gi|227504457|ref|ZP_03934506.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
 gi|227199105|gb|EEI79153.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
          Length = 528

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+VGRAG+G DNVD+  A+  G++V+N P  N  +  E AI+L+LA ARQIP
Sbjct: 59  VLAAATNLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSACEQAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++  F GVE 
Sbjct: 119 AADQSLRQGEWKRSCFKGVEV 139


>gi|319948224|ref|ZP_08022380.1| D-3-phosphoglycerate dehydrogenase [Dietzia cinnamea P4]
 gi|319438099|gb|EFV93063.1| D-3-phosphoglycerate dehydrogenase [Dietzia cinnamea P4]
          Length = 530

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K++GRAG+G DNV++  A+  G++V+N P  N  + AEHA++L++A  RQIP
Sbjct: 62  VLAAAPNLKIIGRAGVGLDNVEIPAATERGVMVVNAPTSNIHSAAEHAVALLMAACRQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F GVE 
Sbjct: 122 AADRTLREHTWKRSSFNGVEL 142


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANAALKNGEWKRSKYTGVEL 140


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GI+V+N+P GN+I  AEHA++++L+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRKGIIVVNSPEGNTIAAAEHALAMILSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G+W++  F+G E 
Sbjct: 117 DANASVKRGEWDRKTFVGAEV 137


>gi|189219266|ref|YP_001939907.1| D-3-phosphoglycerate dehydrogenase [Methylacidiphilum infernorum
           V4]
 gi|189186124|gb|ACD83309.1| Phosphoglycerate dehydrogenase and ACT domains [Methylacidiphilum
           infernorum V4]
          Length = 531

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+KV+GRAG+G DNVD+  A+  GIVVMNTP GN+I TAEH  SL+LA+AR + 
Sbjct: 62  VIEAGKKLKVIGRAGVGIDNVDVDAATEKGIVVMNTPGGNTIATAEHTFSLLLALARNVA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++ NF G+E 
Sbjct: 122 QAHASMQLGEWKRKNFEGIEL 142


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++V+GRAG+G DNVDL  A+ AG++VMNTP GN+I+ AEH ++LMLA+AR IP
Sbjct: 55  VLEKGPKLRVIGRAGVGVDNVDLEAATAAGVLVMNTPGGNAISVAEHTLALMLAMARHIP 114

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  ST  GKWEK  FMG E 
Sbjct: 115 QATASTCGGKWEKKKFMGNEL 135


>gi|260812008|ref|XP_002600713.1| hypothetical protein BRAFLDRAFT_123498 [Branchiostoma floridae]
 gi|229286002|gb|EEN56725.1| hypothetical protein BRAFLDRAFT_123498 [Branchiostoma floridae]
          Length = 323

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +  +K+VGRAG G DNVD+  A++  IVVMNTP GN+++ AEH   L+ ++ARQIP
Sbjct: 63  VIEASDCLKIVGRAGTGVDNVDIPSATKKNIVVMNTPGGNTLSAAEHTCFLIGSLARQIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W++  FMG E 
Sbjct: 123 QAHMSMREGRWDRKKFMGNEL 143


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DN+D+  A++AGI+V+N+P GN+I  AEHAI+LM+A++R I 
Sbjct: 57  VIEAGTNLKIIGRAGVGVDNIDVAAATKAGILVVNSPEGNTIAAAEHAIALMMALSRHIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+GVE 
Sbjct: 117 DANASLKAGQWKRQEFVGVEV 137


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 50/81 (61%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++KV+GRAGIG DNVD+  A+  G++VMNTPFGNS+TTAEHAI+LM A+AR+IP
Sbjct: 61  IIARGGRLKVIGRAGIGVDNVDIPAATARGVIVMNTPFGNSVTTAEHAIALMFALAREIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 121 AADASTQAGKWEKNRFMGVEI 141


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNIDVKAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ANES    KW++  FMG E 
Sbjct: 117 AANESVKANKWDRKRFMGAEV 137


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVPAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|302542286|ref|ZP_07294628.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459904|gb|EFL22997.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 533

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 125 ANAALKNGEWKRSKYTGVEL 144


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANAALKNGEWKRSKYTGVEL 140


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
          Length = 530

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 61/80 (76%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K+KV+ RAG+G DN+D+  A+ AG++V+N P  N ++ AEHAI L+LA+AR+IP+
Sbjct: 60  IAAARKLKVIARAGVGLDNIDVKAATNAGVMVVNAPQSNIVSAAEHAIGLLLAVARRIPL 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN S   G+W++  F+GVE 
Sbjct: 120 ANASLKGGEWKRSKFVGVEI 139


>gi|73748439|ref|YP_307678.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
 gi|73660155|emb|CAI82762.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
          Length = 526

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++V+GRAG+G DN+DL  A+  GI+V+N P GN+I+  EH ++LMLA+AR IP
Sbjct: 57  IINAGKKLQVIGRAGVGVDNIDLKTATGNGIIVVNAPTGNTISATEHTLALMLAMARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G E 
Sbjct: 117 RANASLKSGQWKRNEFVGSEL 137


>gi|312144313|ref|YP_003995759.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
 gi|311904964|gb|ADQ15405.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
          Length = 534

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           LS AK +KV+GRAG G DN+DL  A++ GI V NTP GN+I+  EH + LMLA+AR IP 
Sbjct: 59  LSKAKSLKVIGRAGTGYDNIDLDEATKKGIFVFNTPTGNTISAVEHTLGLMLALARNIPQ 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN++ H   W++  + GVE 
Sbjct: 119 ANQALHNDIWDRKKYQGVEI 138


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score = 92.6 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DN+D+  A++AGI+V+N+P GN+I  AEHAI+LM+A++R IP
Sbjct: 57  VIEAGTNLKIIGRAGVGVDNIDVPAATKAGILVVNSPEGNTIAAAEHAIALMMALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W +  F+GVE 
Sbjct: 117 DANASLKSGLWNRQEFVGVEV 137


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++VVGRAGIG DNVD+  A+  G++VMNTP GN++TTAEHAI+LMLA+AR+IP
Sbjct: 63  LLERAGRLRVVGRAGIGVDNVDVPAATARGVIVMNTPHGNAVTTAEHAIALMLALAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G+WEK  F+G+E 
Sbjct: 123 QADASTQAGRWEKNRFLGIEL 143


>gi|220917793|ref|YP_002493097.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955647|gb|ACL66031.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 528

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+S+T AE A++++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSVTVAELALAMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  F G E 
Sbjct: 119 AATASVKAGKWEKKRFQGHEL 139


>gi|197123004|ref|YP_002134955.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
 gi|196172853|gb|ACG73826.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
          Length = 528

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+S+T AE A++++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSVTVAELALAMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  F G E 
Sbjct: 119 AATASVKAGKWEKKRFQGHEL 139


>gi|110598440|ref|ZP_01386712.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
 gi|110339974|gb|EAT58477.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
          Length = 526

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK++++GRAG G DN+D+  A+R GI+VMNTP GN+I+ AEH  ++ML+ AR IP
Sbjct: 57  IIEAGKKLQLIGRAGAGVDNIDIEAATRNGIIVMNTPGGNTISAAEHTCAMMLSAARLIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +G W K  F GVE 
Sbjct: 117 QATADLKQGNWNKTKFTGVEL 137


>gi|156047579|ref|XP_001589794.1| hypothetical protein SS1G_09516 [Sclerotinia sclerotiorum 1980]
 gi|154693911|gb|EDN93649.1| hypothetical protein SS1G_09516 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 190

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 53/82 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+  K +KVV RAG+G DN+D+  A+   I+V+N+P GN    AEH I+L++A+AR +P
Sbjct: 74  ILAAGKNLKVVARAGVGVDNIDVESATTHAIIVVNSPSGNIAAAAEHTIALLMAVARNVP 133

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G WE+   +G E G
Sbjct: 134 AGDRSLRGGGWERGKLVGTEVG 155


>gi|258651703|ref|YP_003200859.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258554928|gb|ACV77870.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
          Length = 530

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N IT AEHAI+L+L++AR+IP 
Sbjct: 60  LAAAPQLKVVARAGIGLDNVDVPAATAKGVLVVNAPQSNIITAAEHAIALLLSVARKIPA 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S   G+W++  F GVE 
Sbjct: 120 ADASFRAGEWKRSKFTGVEI 139


>gi|196248715|ref|ZP_03147415.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic region
           [Geobacillus sp. G11MC16]
 gi|196211591|gb|EDY06350.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic region
           [Geobacillus sp. G11MC16]
          Length = 223

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP
Sbjct: 56  LLEKMTNLKIVGRAGVGVDNIDIDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W +  F+G E 
Sbjct: 116 QAHISVKSREWNRSAFVGKEL 136


>gi|147902547|ref|NP_001091250.1| phosphoglycerate dehydrogenase [Xenopus laevis]
 gi|120577618|gb|AAI30205.1| LOC100037051 protein [Xenopus laevis]
          Length = 509

 Score = 92.6 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKNGIIVMNTPTGNSISAAELTCGLVLSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A ES   GKW++  FMG E 
Sbjct: 124 QAAESMRAGKWDRKKFMGSEL 144


>gi|298252299|ref|ZP_06976102.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
 gi|297546891|gb|EFH80759.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
          Length = 575

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K+VGRAG+G DN+D   A+R GI+V+N+P GN +  AEH I++++++AR +P
Sbjct: 76  VLSAGTNLKIVGRAGVGVDNIDTNAATRLGIIVVNSPTGNIMAAAEHTIAMLMSLARHVP 135

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKW++  FMG+E 
Sbjct: 136 AANASIKGGKWDRSRFMGIEV 156


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KV+GRAG+G DN+D+  A+  GI+V+N+P  NSI+ AEH  +++L+I+R+IP
Sbjct: 66  IIDAGKRLKVIGRAGVGVDNIDVERATEKGILVVNSPEANSISAAEHTFAMLLSISRKIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKWE+   MGVE 
Sbjct: 126 AANVSLKSGKWERKKHMGVEV 146


>gi|194336592|ref|YP_002018386.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309069|gb|ACF43769.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 526

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+K++GRAG G DN+DL  A+R GI+VMNTP GN+++ AEH  ++ML+ AR+IP
Sbjct: 57  IIECGTKLKLIGRAGAGVDNIDLEAATRNGIIVMNTPGGNTVSAAEHTCAMMLSAARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +G W K  F GVE 
Sbjct: 117 QATADLKQGNWSKTKFSGVEL 137


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  GIVV+N P  +SI+ AE    +ML+ AR IP
Sbjct: 57  IIEASENLKVIARAGVGIDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  KG+W++ +F G+E 
Sbjct: 117 QATASIKKGEWDRKSFKGMEI 137


>gi|298705972|emb|CBJ29093.1| D-3-phosphoglycerate dehydrogenase [Ectocarpus siliculosus]
          Length = 623

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  MKV+GRAG+G DN+D+  A+R G++VMNTP GN+++TA+ AISL+ + AR+IP
Sbjct: 139 LLAKATNMKVIGRAGVGIDNIDVAEATRKGVLVMNTPGGNTVSTAQLAISLLCSAARRIP 198

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKWE+  FMG E 
Sbjct: 199 EADISMKAGKWERKKFMGQEL 219


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KV+GRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ M A+ R++ 
Sbjct: 59  LLERAEKLKVIGRAGVGVDNVDLEEASRRGILVVNTPGANTIGAAEITMAHMYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S   G+W++  FMG E 
Sbjct: 119 LAHDSVKAGEWKRSKFMGEEL 139


>gi|296140550|ref|YP_003647793.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
 gi|296028684|gb|ADG79454.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
          Length = 528

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVPAATERGVLVVNAPTSNIHTAAEHAVALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  + +W++  F GVE 
Sbjct: 119 AADATLREHEWKRSKFNGVEI 139


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVDL  A+  G+VV+N P  +SI+ AE    LML+ AR IP
Sbjct: 57  IIDASENLKVIARAGVGVDNVDLDAATEKGVVVVNAPDASSISVAELMFGLMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  KG+W++ +F G+E 
Sbjct: 117 QATASLKKGEWDRKSFKGMEV 137


>gi|321477734|gb|EFX88692.1| hypothetical protein DAPPUDRAFT_41785 [Daphnia pulex]
          Length = 374

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+++VGRAG G DNVD+  A+R G++VMNTP GN+++ AEH  +++ A++R IP
Sbjct: 62  VLAAATKLRLVGRAGTGLDNVDISAATRRGVLVMNTPGGNTMSAAEHTCAMIAALSRHIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G W++  +MG E 
Sbjct: 122 QACAALKNGVWDRKTYMGNEL 142


>gi|110645315|gb|AAI18689.1| hypothetical protein LOC548683 [Xenopus (Silurana) tropicalis]
          Length = 509

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A ES   GKW++  FMG E 
Sbjct: 124 QAAESMRAGKWDRKKFMGSEL 144


>gi|62860140|ref|NP_001015929.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
 gi|89268114|emb|CAJ83914.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
          Length = 509

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+VGRAG G DNVD+  A++ GI+VMNTP GNSI+ AE    L+L+++RQIP
Sbjct: 64  VLTAGSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A ES   GKW++  FMG E 
Sbjct: 124 QAAESMRAGKWDRKKFMGSEL 144


>gi|262203115|ref|YP_003274323.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
 gi|262086462|gb|ACY22430.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
          Length = 531

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K++ RAG+G DNVD+  A+  G++V+N P  N  T AEHAI+L+++ ARQIP
Sbjct: 62  VLDAGKKLKIIARAGVGLDNVDVPAATARGVMVVNAPTSNIHTAAEHAIALLMSAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +     W++  F GVE 
Sbjct: 122 AADATLRAHTWKRSAFNGVEI 142


>gi|118471239|ref|YP_886720.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
 gi|118172526|gb|ABK73422.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
          Length = 528

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP
Sbjct: 59  VIAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHAIALLLATARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 119 AADATLRERSWKRSSFSGTEI 139


>gi|323141567|ref|ZP_08076450.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413909|gb|EFY04745.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 528

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 59/79 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  + ++KV+GRAG+G DN+D+  A+  GIVV+NTP GN++   EH +++M+A+ R IP
Sbjct: 56  VIEASTRLKVIGRAGVGVDNIDIPAATAKGIVVLNTPEGNTMAATEHTVAMMMAMTRHIP 115

Query: 61  VANESTHKGKWEKFNFMGV 79
            A++S  +GKW++ +F G+
Sbjct: 116 QAHQSIQEGKWDRKSFDGI 134


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+ RAG+G DNVDL  A+  GI+V+N+P  +S++ AE  I  ML+ AR IP
Sbjct: 57  IIDVAKKLKVIARAGVGVDNVDLQAATEKGIIVVNSPDASSVSVAELTIGFMLSAARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++ +F GVE 
Sbjct: 117 QATASLKRGEWDRKSFKGVEL 137


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMTAGKNLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++  F+GVE 
Sbjct: 119 QAYAKTIGGTWDRKTFLGVEL 139


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 64  IAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 123

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 124 ANTALKNGEWKRSKYTGVEL 143


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 69/81 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AKK+KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANAKKLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|296131563|ref|YP_003638810.1| D-3-phosphoglycerate dehydrogenase [Thermincola sp. JR]
 gi|296030141|gb|ADG80909.1| D-3-phosphoglycerate dehydrogenase [Thermincola potens JR]
          Length = 523

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +K++GRAG+G DN+D+  A+ AGI+V+N P GN+I   E  ++LMLA+AR +P
Sbjct: 58  VIAAGKNLKIIGRAGVGVDNIDIPAATNAGILVVNAPDGNTIAATEQTMALMLALARNLP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++   +G W +  + GVE 
Sbjct: 118 QAHKDLKEGLWNRKLYTGVEL 138


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S AKK++++GRAG+G DNVD+  A+R G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  VISEAKKLRIIGRAGVGVDNVDVPTATRKGVLVVNSPGGNTIAAAEHALAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W++  ++G E 
Sbjct: 117 PANASMFAGGWDRKKYVGNEL 137


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KV+GRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ + A+ R++ 
Sbjct: 59  LLERAEKLKVIGRAGVGVDNVDLEEASRRGILVVNTPGANTIGAAEITMAHLYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S   G+W++  FMG E 
Sbjct: 119 LAHDSVKAGEWKRSKFMGEEL 139


>gi|294056127|ref|YP_003549785.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615460|gb|ADE55615.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 528

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG+G DN+D+  A+  G++VMNTP GN+I TAE   + MLA  R I 
Sbjct: 58  VIAAAPQLKVVGRAGVGVDNIDIEAATDNGVIVMNTPTGNTIATAELTFTHMLAGTRPIV 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +G W++  F G E 
Sbjct: 118 QACARMREGGWDRKKFGGSEL 138


>gi|307196749|gb|EFN78208.1| D-3-phosphoglycerate dehydrogenase [Harpegnathos saltator]
          Length = 512

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    ++V+GRAG G DN+DL  A+R GI+VMNTP GNSI+  E   +L+ A+AR + 
Sbjct: 62  VIAACPNVRVIGRAGTGVDNIDLQAATRKGIIVMNTPGGNSISACELTCALISALARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 122 QAAQSLKEGRWDRKLYSGHEL 142


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++VVGRAG+G DNVD   A+R GIVVMNTP  N++  AE  ++LM+ +AR +P
Sbjct: 56  LMAAAPKLRVVGRAGVGVDNVDAEAATRRGIVVMNTPGANAVAVAELTLALMIGLARNLP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN + H GKWEK +  GVE 
Sbjct: 116 RANATMHAGKWEKKSLQGVEL 136


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA++++LA++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHALAMILALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G W++ +F+G E 
Sbjct: 117 DANASVKRGAWDRNSFVGAEV 137


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMDAGKQLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMAVARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G+W++ +F+GVE 
Sbjct: 119 QAYLKTVGGEWDRKSFLGVEL 139


>gi|159128988|gb|EDP54102.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus A1163]
          Length = 584

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+L++A+AR IP
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALLMAMARNIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  F+GVE 
Sbjct: 124 EACSSLKSGKWERSKFVGVEV 144


>gi|187735211|ref|YP_001877323.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Akkermansia muciniphila ATCC BAA-835]
 gi|187425263|gb|ACD04542.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Akkermansia muciniphila ATCC BAA-835]
          Length = 523

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K+V RAG G DN+D+V A +  + VMNTP  NS   AE  ++++LA  R I 
Sbjct: 57  IMDALPSLKLVVRAGAGYDNIDIVYARKKNVDVMNTPGANSNAVAEEVMAMILAYYRHIV 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +T +G WEK  +MG E 
Sbjct: 117 QADATTREGLWEKKKYMGSEL 137


>gi|54026192|ref|YP_120434.1| D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM 10152]
 gi|54017700|dbj|BAD59070.1| putative D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM
           10152]
          Length = 532

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++L+LA ARQIP
Sbjct: 62  VLEAGKNLKIVARAGVGLDNVDVPAATERGVMVVNAPTSNIHTAAEHAVTLLLAAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++  F GVE 
Sbjct: 122 AADATLREHTWQRSKFNGVEI 142


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI++MLA+AR+IP
Sbjct: 62  ILEKATRLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITMMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|86157688|ref|YP_464473.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774199|gb|ABC81036.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 528

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A +++V+GRAG+G DNVDL  A+R G+VVMNTP G+SIT AE A+S++LA++R +P
Sbjct: 59  LLEKASRLRVIGRAGVGVDNVDLDAATRRGVVVMNTPGGSSITVAELALSMILALSRHVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  F G E 
Sbjct: 119 AATASVKAGKWEKKRFQGHEL 139


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++KV+GRAG+G DN+DL  A++ GI+V+N P GN+ITT EHA ++M+A+AR IP
Sbjct: 59  IMEAGTRLKVIGRAGVGVDNIDLEAATKRGIIVINAPDGNTITTCEHAFAMMMALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T KG+W++  F+GVE 
Sbjct: 119 QAYAKTIKGEWDRK-FLGVEL 138


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LML++AR+IP
Sbjct: 63  ILEKATKLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITLMLSLAREIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 123 AADASTQAGKWEKNRFMGVEI 143


>gi|119963300|ref|YP_948230.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
 gi|119950159|gb|ABM09070.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
          Length = 539

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 70  IAAAKNLKVIARAGVGLDNVDIKSATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPQ 129

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + G+E 
Sbjct: 130 ASSALKNGEWKRSKYTGIEL 149


>gi|322801282|gb|EFZ21969.1| hypothetical protein SINV_07911 [Solenopsis invicta]
          Length = 557

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+ ++AR + 
Sbjct: 108 VFAACPNLRVVGRAGTGVDNIDLQAATRKGVIVLNTPGGNSISACELTCALISSLARNVA 167

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 168 QAAQSLKEGRWDRKLYSGYEL 188


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 59/82 (71%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVVGRAG+G DN+DL  ASR GI+V+N P GN++   EH + +M+A AR IP
Sbjct: 63  LLERAKRLKVVGRAGVGVDNIDLEAASRRGILVVNAPTGNTLAATEHTMGMMIAAARLIP 122

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A++S   + KWE+  FMGVE 
Sbjct: 123 YAHKSLKEERKWERKKFMGVEL 144


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+RAGIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEAGVQLKIIGRAGVGVDNVDVAAATRAGIVVVNSPEGNTIAAAEHALAMMLSLSRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S   GKW++  F+GVE 
Sbjct: 117 EANQSVKSGKWDRKKFIGVEV 137


>gi|307177523|gb|EFN66634.1| D-3-phosphoglycerate dehydrogenase [Camponotus floridanus]
          Length = 511

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+ ++AR + 
Sbjct: 62  VFAACPNLRVVGRAGTGVDNIDLQAATRKGVIVLNTPGGNSISACELTCALISSLARNVA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 122 QAAQSLKEGRWDRKLYSGYEL 142


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 69/81 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++AK++KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 82  ILANAKRLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITLMLALAREIP 141

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 142 AADASTQAGKWEKNRFMGVEI 162


>gi|116202061|ref|XP_001226842.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
 gi|88177433|gb|EAQ84901.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
          Length = 1359

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K++VV RAG+G DN+D+  A++ G++V+N+P GN +  AEH ++L+LA AR + 
Sbjct: 76  VLAAASKLRVVARAGVGVDNIDVEAATQHGVIVVNSPSGNIVAAAEHTVALLLACARNVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+     G+WE+   +GVE G
Sbjct: 136 RADAGMKGGRWERGKLVGVEVG 157


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI+LML++AR+IP
Sbjct: 62  ILEKATRLKVIGRAGIGVDNVEIPAATARGIIVMNTPFGNSITTAEHAITLMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPTATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  KG+W++  F+G E 
Sbjct: 117 DANTSLKKGEWDRKTFVGAEI 137


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 57  IIEAGTQLKIIGRAGVGVDNVDVPTATRKGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  KG+W++  F+G E 
Sbjct: 117 DANTSLKKGEWDRKTFVGAEI 137


>gi|315231333|ref|YP_004071769.1| D-3-phosphoglycerate dehydrogenase [Thermococcus barophilus MP]
 gi|315184361|gb|ADT84546.1| D-3-phosphoglycerate dehydrogenase [Thermococcus barophilus MP]
          Length = 307

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+GRAG+G DN+DL  A   GI V+N+P  +S + AE   +L+LA+AR++ 
Sbjct: 57  VIEAAEKLKVIGRAGVGLDNIDLEAAKEKGIEVVNSPAASSRSVAELTWALILAVARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG+E 
Sbjct: 117 FADRKMREGVWAKKQCMGIEL 137


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKANRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAGIG DNV++  A+  GI+VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKANRLKVIGRAGIGVDNVEIPAATAKGIIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|156553723|ref|XP_001600828.1| PREDICTED: similar to GA19489-PA [Nasonia vitripennis]
          Length = 511

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +  +K+VGRAG G DN+D+  A+R GI+V+NTP GNS++  E   +++ A+AR + 
Sbjct: 62  VIAASPNLKLVGRAGTGVDNIDIPAATRNGILVLNTPGGNSVSACELTCAVISALARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 122 QAGQSMKEGRWDRKLYAGREL 142


>gi|193213940|ref|YP_001995139.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
 gi|193087417|gb|ACF12692.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
          Length = 526

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++GRAG G DN+D+  A+R GI+VMNTP GN+++ AEHA  ++LA AR IP
Sbjct: 57  VIEVADNLKLIGRAGAGVDNIDIEAATRKGIIVMNTPGGNTVSAAEHACGMLLATARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+   H+  W+K  +MG E 
Sbjct: 117 QASAQMHQAVWDKKKWMGAEL 137


>gi|119480099|ref|XP_001260078.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
 gi|119408232|gb|EAW18181.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
          Length = 582

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+L++A+AR IP
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVDVEEATKLGIVVVNSPSGNIGAAAEHTIALLIAMARNIP 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWE+  F+GVE 
Sbjct: 124 EACSSLKSGKWERSKFVGVEV 144


>gi|225165807|ref|ZP_03727591.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
 gi|224799953|gb|EEG18398.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
          Length = 529

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG+G DNVD+  A+  G+VVMNTP GN+I TAE   + +L  +R + 
Sbjct: 58  VIAAAPQLKVVGRAGVGVDNVDVEAATERGVVVMNTPAGNTIATAELTFTHILCGSRPVS 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKW++ +F GVE 
Sbjct: 118 QAAASMREGKWDRKSFSGVEL 138


>gi|68445555|dbj|BAE03264.1| phosphoglycerate dehydrogenase [unclutured Candidatus Nitrosocaldus
           sp.]
          Length = 312

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +K++ R G+G DN+D+  A   GI V+N         AE  I LM+ +AR I 
Sbjct: 61  VIDAAQNLKIIARVGVGLDNIDVEYAKSKGIKVVNAEEAAMSAVAELVIGLMICLARGIV 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W K   MG+E 
Sbjct: 121 RADTTMKQGRWIKSELMGIEL 141


>gi|332018401|gb|EGI58995.1| D-3-phosphoglycerate dehydrogenase [Acromyrmex echinatior]
          Length = 511

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    ++VVGRAG G DN+DL  A+R G+VV+NTP GNSI+  E   +L+ A+AR + 
Sbjct: 62  IFAACPNLRVVGRAGTGVDNIDLQAATRKGVVVLNTPGGNSISACELTCALISALARNVA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 122 QAAQSLKEGRWDRKLYSGYEL 142


>gi|226365951|ref|YP_002783734.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
 gi|226244441|dbj|BAH54789.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
          Length = 531

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++LMLA ARQIP
Sbjct: 62  VLAAGTKLKIVARAGVGLDNVDVPAATERGVMVVNAPTSNIHTAAEHAVALMLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +    +W++  F GVE 
Sbjct: 122 AADATLRDREWKRSKFNGVEI 142


>gi|258574947|ref|XP_002541655.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901921|gb|EEP76322.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 568

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK ++VV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR+IP
Sbjct: 66  VLQAAKNLRVVARAGVGVDNVDVDTATKLGIVVVNSPSGNIGAAAEHTIALMLSMARKIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWE+  F+GVE 
Sbjct: 126 HACSSLKEGKWERSKFVGVEV 146


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAANRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANAALKNGEWKRSKYTGVEL 140


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP 
Sbjct: 61  IAAAKRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|312898434|ref|ZP_07757824.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
 gi|310620353|gb|EFQ03923.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
          Length = 538

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+K+VGRAG+G D++DL  A+  GI+V+N P  N+I   EH  +++LA+ R IP
Sbjct: 61  VIEKAKKLKIVGRAGVGIDSIDLKAATARGIIVVNAPTSNTIAATEHTCAMILAVTRHIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   G+W +  F G++ 
Sbjct: 121 QAHDSLMSGEWNREKFTGIQL 141


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIEAASKLRIIGRAGVGVDNVDVPAATKRGVIVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W++  ++G E 
Sbjct: 117 HAHGSTMAGGWDRKKYVGNEL 137


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+GRAGIG DNVD   AS+ GI+VMNTPFGN+ITTAE  ++L +A AR IP 
Sbjct: 59  IAAASRLKVIGRAGIGVDNVDTPAASQKGIIVMNTPFGNAITTAELGVTLAMAAARHIPA 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A  ST  GKWEK  FMG E 
Sbjct: 119 ATASTKAGKWEKSRFMGREL 138


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVVGRAGIG DNVD+  AS+ G++VMNTP+GN++TTAEHAI+LM+A AR IP
Sbjct: 58  VLAAASRLKVVGRAGIGVDNVDIHAASKRGVIVMNTPYGNTVTTAEHAIALMMAAARMIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   G+WEK  F GVE 
Sbjct: 118 QATMSLKAGQWEKSRFQGVEL 138


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 62  AAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQA 121

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 122 NAALKNGEWKRSKYTGVEL 140


>gi|222056517|ref|YP_002538879.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
 gi|221565806|gb|ACM21778.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
          Length = 540

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   + +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+LA  R I 
Sbjct: 58  LLDAGRNLKMVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHAMALLLAFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F GVE 
Sbjct: 118 KANASLKNGEWKRAPFTGVEL 138


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP
Sbjct: 59  IMNAGTNLKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++ +F+GVE 
Sbjct: 119 QAYAKTIGGSWDRKSFLGVEL 139


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIEAAGKLRIIGRAGVGVDNVDVPAATKRGVIVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W++  ++G E 
Sbjct: 117 HAHVSTMAGGWDRKKYVGNEL 137


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  ++K+K + RAG+G DN+D+  A++ GIVVMNTP GN I+TAEH I+L+ +++R +P
Sbjct: 66  VLEKSEKLKAICRAGVGVDNIDVPAATKKGIVVMNTPAGNIISTAEHTIALLCSLSRFVP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK  F G + 
Sbjct: 126 QACASVKEGKWEKKKFTGQQL 146


>gi|148263798|ref|YP_001230504.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146397298|gb|ABQ25931.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 541

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAGKKLKMVARAGVGIDNVDIDYASSKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F GVE 
Sbjct: 118 KANASLKSGEWKRAPFTGVEL 138


>gi|290967984|ref|ZP_06559533.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781890|gb|EFD94469.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
          Length = 530

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G D++D+  A++ GI+V+N P  N++   EH  ++++AI R IP
Sbjct: 57  VIEAAGKLKVIGRAGVGVDSIDIKTATQRGIIVVNAPTANTVAATEHTCAMIMAITRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++  F G++ 
Sbjct: 117 QAHNSLMAGEWQRERFTGIQL 137


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++M+A+AR IP
Sbjct: 85  IIQAGSQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMMALARHIP 144

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S  + KWE+  F+G E 
Sbjct: 145 DANKSVKESKWERKQFIGTEV 165


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++KVVGRAG G DNVD   A+R GIVVMNTP GN++TTAEH ++++ +++R+IP
Sbjct: 57  VIAAASQLKVVGRAGSGLDNVDTPAATRRGIVVMNTPGGNTVTTAEHTMAMIFSMSRRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  ST  GKWEK  FMGVE 
Sbjct: 117 QATASTKGGKWEKEKFMGVEL 137


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S AKK++++GRAG+G DNVD+  A+R G++V+N+P GN+I  AEHA+++MLA++R IP
Sbjct: 57  VISEAKKLRIIGRAGVGVDNVDVPTATRKGVLVVNSPGGNTIAAAEHALAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W++  ++G E 
Sbjct: 117 QANGSMFAGGWDRKKYVGNEL 137


>gi|114775665|ref|ZP_01451233.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
 gi|114553776|gb|EAU56157.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
          Length = 529

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KV+GRAGIG DNVD+   SR G VVMNTPFGN+ITTAE A++ ++A AR IP
Sbjct: 58  LLDAAKRVKVIGRAGIGVDNVDVETCSRRGTVVMNTPFGNTITTAELAVAHIVAAARMIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G WEK  FMG+E 
Sbjct: 118 QASASTRAGLWEKNRFMGMEL 138


>gi|242398998|ref|YP_002994422.1| SerA D-3-phosphoglycerate dehydrogenase [Thermococcus sibiricus MM
           739]
 gi|242265391|gb|ACS90073.1| SerA D-3-phosphoglycerate dehydrogenase [Thermococcus sibiricus MM
           739]
          Length = 304

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ RAG+G DNVD+  A   GI V+N P  +S + AE A++LM  IAR++ 
Sbjct: 57  IIDAAPSLKVIARAGVGLDNVDVEYAKSKGIEVVNAPTASSRSVAELAVALMFNIARKVA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   MG E 
Sbjct: 117 FADRKIREGAWPKKQCMGFEL 137


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP A
Sbjct: 62  AAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQA 121

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 122 NAALKNGEWKRSKYTGVEL 140


>gi|218781218|ref|YP_002432536.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762602|gb|ACL05068.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 526

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 45/81 (55%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A++ G+VVMNTP GN +TTAEHAIS+ML++ R IP
Sbjct: 58  LLEAAPNLKVVGRAGIGLDNVDIPAATKRGVVVMNTPGGNVVTTAEHAISMMLSLTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKW+K    G E 
Sbjct: 118 RGTASLKAGKWDKKLLQGKEI 138


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+ RAG G DN+D+  AS+ GI+V+NTP  N+I+ AE  ++LML ++R +P
Sbjct: 57  VLSQADNLKVIARAGSGYDNIDVEAASKRGIIVLNTPGQNTISAAEQTMALMLGLSRNLP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ANE+ H+G W++  + GVE 
Sbjct: 117 QANEALHEGIWDRNKYQGVEI 137


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++KVVGRAG+G DNVDL  ASR GI+V+NTP  N++  AE  I+ M A+ R++ 
Sbjct: 59  LLERAKRLKVVGRAGVGVDNVDLEAASRRGILVVNTPGANTVGAAELTIAHMYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+ES  +G+W +  FMG E 
Sbjct: 119 LAHESMLQGEWNRKKFMGEEL 139


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  LAAAKQLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++V+GRAG+G DNVDL  A+R GI V+N P GN++  AEH ++LMLA+ R IP
Sbjct: 23  LIEAGGHLQVIGRAGVGVDNVDLDAATRQGIPVVNAPTGNTVAAAEHTLALMLAMVRHIP 82

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W +  FMGVE 
Sbjct: 83  QADASVRMGEWRRSAFMGVEV 103


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  VVEAGTNLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  + KW++  F+G E 
Sbjct: 117 DANLSIKENKWDRKRFIGTEV 137


>gi|167041185|gb|ABZ05943.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_001L24]
          Length = 311

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+ RAG G DN+D+  A    ++VMNTP GN+  TAEHA++L++++ R+IP
Sbjct: 58  IILAAKKLKVIARAGAGVDNIDVPTAKENNMLVMNTPGGNANATAEHALALIMSVLRKIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN++THKGKWEK N  G E 
Sbjct: 118 YANDTTHKGKWEKKNIKGAEL 138


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score = 90.7 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|77920705|ref|YP_358520.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77546788|gb|ABA90350.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 535

 Score = 90.7 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L H + +K+V RAG+G DNVD+  AS  GI+V+N P+GN  + AEH +++ML++ R +P
Sbjct: 58  LLEHCRNLKIVARAGVGIDNVDVDAASSRGIIVVNAPYGNVNSAAEHTMAVMLSLCRNVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           VAN S  +G+W++  F G E 
Sbjct: 118 VANTSLKQGEWQRAPFTGCEL 138


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKQLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|111023450|ref|YP_706422.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110822980|gb|ABG98264.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 531

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  T AEHA++LMLA ARQIP
Sbjct: 62  VLAAGTKLKIVARAGVGLDNVDVAAATERGVMVVNAPTSNIHTAAEHAVALMLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +    +W++  F GVE 
Sbjct: 122 AADATLRDREWKRSKFNGVEI 142


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+KV+GRAGIG DN+DL  A+  G VVMNTPFGNSITTAEHAI+L+L+ ARQIP
Sbjct: 58  VIESCKKLKVIGRAGIGVDNIDLEAATNNGKVVMNTPFGNSITTAEHAITLLLSTARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++TH GKWEK +  G+E 
Sbjct: 118 FASQTTHAGKWEKSSIKGIEV 138


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 67/81 (82%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +K++KV+GRAGIG DN+DL  A+  G VVMNTPFGNSITTAEHAI+L+L+ ARQIP
Sbjct: 58  IIEKSKRLKVIGRAGIGVDNIDLEAATNNGKVVMNTPFGNSITTAEHAITLILSTARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++TH+GKWEK +  GVE 
Sbjct: 118 FADKTTHEGKWEKSSIKGVEV 138


>gi|148654451|ref|YP_001274656.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
 gi|148566561|gb|ABQ88706.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
          Length = 524

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++VVGRAG G DN+DL  A+R GI+V+N P  NS+  AE  I+L+L++AR IP
Sbjct: 57  VLAAGTRLRVVGRAGTGVDNIDLEAATRQGIMVVNAPASNSVAVAELTIALILSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKWE+  FMG E 
Sbjct: 117 QAHSSVVAGKWERNRFMGFEV 137


>gi|38233698|ref|NP_939465.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38199959|emb|CAE49627.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae]
          Length = 531

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L+ ARQIP
Sbjct: 62  VLNAATNLKIVGRAGVGLDNVDIATATDKGVMVANAPTSNIHSACEHAISLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++ +F GVE 
Sbjct: 122 AADKTLRVGEWKRSSFKGVEI 142


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAHKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARHIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANAALKNGEWKRSKYTGVEL 140


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 55/82 (67%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AK +KVVGRAG+G DN+DL  ASR GI+V+N P GN++   EH + +M+  AR IP
Sbjct: 61  LFERAKNLKVVGRAGVGVDNIDLDEASRRGILVVNAPTGNTLAATEHTMGMMICAARAIP 120

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+ S   + +W++  FMGVE 
Sbjct: 121 YAHNSLKEERRWDRKKFMGVEL 142


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++KVVGRAG+G DN+DL  A++ GI+V+N P GN+ITT EH  ++M+A+AR IP
Sbjct: 59  IMEAGKQLKVVGRAGVGVDNIDLEAATQRGIIVINAPDGNTITTCEHTFAMMMAVARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++ +F+GVE 
Sbjct: 119 QAYLKTVGGVWDRKSFLGVEL 139


>gi|91083881|ref|XP_967558.1| PREDICTED: similar to AGAP008849-PA isoform 1 [Tribolium castaneum]
 gi|270006715|gb|EFA03163.1| hypothetical protein TcasGA2_TC013082 [Tribolium castaneum]
          Length = 329

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KV+GRAG G DN+DL  A+   I+V+NTP GN+I+  E   +L+  +AR + 
Sbjct: 60  VIAAGKNLKVIGRAGAGVDNIDLNAATAKNILVLNTPGGNAISACELTCALITNLARNVT 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   G+W++  + G E 
Sbjct: 120 PAAASLKAGRWDRKLYAGHEL 140


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KV+GRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI++ML++AR+IP
Sbjct: 62  ILEKAAKLKVIGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITMMLSLAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R +P
Sbjct: 57  IIEAADKLKIIGRAGVGVDNVDVQAATRKGIVVVNSPEGNTIAAAEHALAMMLSMSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    +W++  F+GVE 
Sbjct: 117 EANQSIINAQWDRKKFVGVEV 137


>gi|305682015|ref|ZP_07404819.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
 gi|305658488|gb|EFM47991.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
          Length = 531

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L  ARQIP
Sbjct: 62  VLEAAPHLKIVGRAGVGLDNVDIATATERGVMVANAPTSNIHSACEHAISLLLTTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++  F GVE 
Sbjct: 122 AADATLRQHTWKRSEFTGVEI 142


>gi|225022672|ref|ZP_03711864.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224944580|gb|EEG25789.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 558

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+VGRAG+G DNVD+  A+  G++V N P  N  +  EHAISL+L  ARQIP
Sbjct: 89  VLEAAPHLKIVGRAGVGLDNVDIATATERGVMVANAPTSNIHSACEHAISLLLTTARQIP 148

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++  F GVE 
Sbjct: 149 AADATLRQHTWKRSEFTGVEI 169


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A K+KVVGRAGIG DN+D+  A+  G+ VMNTPFGN++TTAEHAI+++ A ARQIP
Sbjct: 59  VFAKADKLKVVGRAGIGVDNIDIPAATAKGVAVMNTPFGNAVTTAEHAIAMLFAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+  T  G+W K +++G E 
Sbjct: 119 AASARTQNGEWPKKDYVGTEL 139


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIVAGTQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    KWE+  F+G E 
Sbjct: 117 EANQSVKNNKWERKRFIGAEV 137


>gi|320105785|ref|YP_004181375.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
 gi|319924306|gb|ADV81381.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
          Length = 537

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K++V+GRAG+G DN+D   A+  GIVVMNTP  N++  AE  + LM+ +AR IP
Sbjct: 57  LLESAPKLRVIGRAGVGVDNIDAPAATHKGIVVMNTPGANAVAVAELTLGLMITMARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN + H G W+K +  G E 
Sbjct: 117 RANATMHAGVWDKKSLQGQEL 137


>gi|158312947|ref|YP_001505455.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
 gi|158108352|gb|ABW10549.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
          Length = 529

 Score = 90.3 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 60/80 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAAPRLKVVARAGIGLDNVDVPAATNRGVMVVNAPQSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ES   G+W++  ++GVE 
Sbjct: 118 AHESLVGGEWKRSKYVGVEL 137


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLKVVARAGVGLDNVDVSSATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRNKYTGVEL 140


>gi|300087849|ref|YP_003758371.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527582|gb|ADJ26050.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 526

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK++++GRAG+G DNVD+  AS  GI+V+N P GN+I+ AEHA +LML++AR IP
Sbjct: 59  VIAAGKKLQIIGRAGVGVDNVDINSASERGIIVVNAPTGNTISAAEHAFALMLSLARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W++ +F+G E 
Sbjct: 119 QANASLKSCQWKRSDFLGTEL 139


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP
Sbjct: 59  IMNAGTNLKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++ +F+GVE 
Sbjct: 119 QAYAKTVGGTWDRKSFLGVEL 139


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +KVVGRAG+G DN+DL  A++ GIVV+N P GN+ITTAEH  ++M+A+AR IP
Sbjct: 59  IMNAGTNLKVVGRAGVGVDNIDLEAATKRGIVVINAPDGNTITTAEHTFAMMIALARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A   T  G W++ +F+GVE 
Sbjct: 119 QAYAKTVGGTWDRKSFLGVEL 139


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus
          thermodenitrificans NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus
          thermodenitrificans NG80-2]
          Length = 465

 Score = 89.9 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 52/77 (67%)

Query: 5  AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANE 64
           K +K+VGRAG+G DN+D+  A++ GIVV+N P GN+I+ AEH  ++M A+ R IP A+ 
Sbjct: 1  MKNLKIVGRAGVGVDNIDIDAATKRGIVVINAPNGNTISAAEHTFAMMAALVRHIPQAHI 60

Query: 65 STHKGKWEKFNFMGVEA 81
          S    +W +  F+G E 
Sbjct: 61 SVKSREWNRSAFVGKEL 77


>gi|118580120|ref|YP_901370.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
 gi|118502830|gb|ABK99312.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 539

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K++K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L++   R+I 
Sbjct: 58  VLDAGKRLKIVARAGVGIDNVDVDYASSKGVIVINAPFGNTNSAAEHALALLMTFCRKIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN S   G+W++  F G E 
Sbjct: 118 IANASLKSGEWKRAPFTGYEL 138


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AK +KVVGRAGIG DNVD+  A++ G++VMNTP GN ITTAEHA+++M+++ R IP
Sbjct: 58  LLSTAKNLKVVGRAGIGLDNVDIPAATKHGVIVMNTPGGNVITTAEHAVAMMMSMTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKWEK N  G E 
Sbjct: 118 WGTASLKAGKWEKKNLEGREL 138


>gi|111225204|ref|YP_715998.1| D-3-phosphoglycerate dehydrogenase [Frankia alni ACN14a]
 gi|111152736|emb|CAJ64480.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Frankia alni ACN14a]
          Length = 530

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 60/80 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A++ G++V+N P  N ++ AEHAI+L+LA+AR++P 
Sbjct: 58  LAAASRLKVVARAGIGLDNVDVAAATQRGVMVVNAPTSNIVSAAEHAIALLLAVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN+S   G+W++  F GVE 
Sbjct: 118 ANQSLRGGEWKRSKFSGVEL 137


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS  K++K VGRAG+G DN+D+  A++AGI V+N P GN+I+TAEH+ ++++A+AR IP
Sbjct: 59  VLSAGKRLKAVGRAGVGVDNIDINAATQAGIPVINAPDGNTISTAEHSFAMLMAVARNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G W++ +F GVE 
Sbjct: 119 QAHKKLVDGTWDRKSFQGVEL 139


>gi|182415332|ref|YP_001820398.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
 gi|177842546|gb|ACB76798.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
          Length = 529

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KVVGRAG+G DNVD+  A+  G++VMNTP GN+I TAE   + +L  AR +P
Sbjct: 58  VIAAAPLLKVVGRAGVGVDNVDVDAATERGVIVMNTPSGNTIATAELTFTHLLCGARPVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   G W++ +F G+E 
Sbjct: 118 QAAASMRAGNWDRKSFSGIEL 138


>gi|312140491|ref|YP_004007827.1| d-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
 gi|311889830|emb|CBH49147.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
          Length = 530

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  + AEHA+SL+L+ ARQIP
Sbjct: 62  VLAAATKLKIVGRAGVGLDNVDIPAATDRGVMVVNAPTSNIHSAAEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 122 AADRTLREKTWKRSSFNGTEI 142


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAATNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W++  F G E 
Sbjct: 118 KANSSLKGGAWKRAPFTGYEL 138


>gi|325675891|ref|ZP_08155575.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
 gi|325553862|gb|EGD23540.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
          Length = 530

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  + AEHA+SL+L+ ARQIP
Sbjct: 62  VLAAATKLKIVGRAGVGLDNVDIPAATERGVMVVNAPTSNIHSAAEHAVSLLLSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 122 AADRTLREKTWKRSSFNGTEI 142


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L+LA AR IP A
Sbjct: 62  AAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLLATARNIPQA 121

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 122 NSALKNGEWKRSKYTGVEL 140


>gi|319441148|ref|ZP_07990304.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium variabile DSM
           44702]
          Length = 531

 Score = 89.9 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+++VGRAG+G DNVD+  A+  G++V N P  N  +  EHAI+L+L+ ARQIP
Sbjct: 62  VLAAAPKLQIVGRAGVGLDNVDIETATAKGVMVANAPTSNIHSACEHAIALLLSAARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++    +W++ +F GVE 
Sbjct: 122 AADKTLRDAEWKRSSFKGVEI 142


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R I 
Sbjct: 58  LLDAATNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W++  F G E 
Sbjct: 118 KANSSLKGGAWKRAPFTGYEL 138


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 59/82 (71%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++KVVGRAG+G DN+D+  A+  G+VV+N P  N+ +TAEHA  L++A+AR IP
Sbjct: 55  VLARGTRLKVVGRAGVGVDNIDVAAATERGVVVVNVPGANTYSTAEHAFGLLIAVARNIP 114

Query: 61  VANEST-HKGKWEKFNFMGVEA 81
            A+ +   +G+W++ +F+G E 
Sbjct: 115 QAHHALAREGRWDRMSFVGTEL 136


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K +GRAG+G DN+D+  A+R GIVV+N P GN+I  AE  ++ +LAIAR + 
Sbjct: 58  IIEAADRLKAIGRAGVGVDNIDVEAATRKGIVVVNAPEGNTIAAAELTVAHILAIARNVG 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   GKW++  + G+E 
Sbjct: 118 SANLSLKGGKWDRSKYTGIEL 138


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++++ RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R +P
Sbjct: 58  LLDAGTKLRLIARAGVGIDNVDVDYASSRGVIVVNAPFGNTNSAAEHAMALLLSFCRNVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F G E 
Sbjct: 118 RANGSLKSGEWKRAPFTGYEL 138


>gi|284035257|ref|YP_003385187.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirosoma linguale DSM 74]
 gi|283814550|gb|ADB36388.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirosoma linguale DSM 74]
          Length = 311

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 42/82 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K++ + RAG G D +DL    +  I V +   GN     EHA+ ++LA+   I 
Sbjct: 62  LLNQAPKLRFIARAGAGLDLIDLAATEQRHIRVFHAGEGNRDAVGEHAVGMLLALLANIL 121

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+    +G W++    G E G
Sbjct: 122 KADREVRQGIWDREGNRGYELG 143


>gi|312216238|emb|CBX96189.1| similar to d-3-phosphoglycerate dehydrogenase [Leptosphaeria
           maculans]
          Length = 620

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 58/80 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AKK+KVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 99  LLSQAKKLKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTIALLMAVARNVA 158

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKWE+   +GVE
Sbjct: 159 DASQSIKAGKWERSRLVGVE 178


>gi|322437164|ref|YP_004219376.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
 gi|321164891|gb|ADW70596.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
          Length = 570

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K++V+GRAG+G DN+D   A+  GIVVMNTP  N++  AE  + LM+++ R IP
Sbjct: 76  LLESAPKLRVIGRAGVGVDNIDTAAATHRGIVVMNTPGANAVAVAELTLGLMISMGRSIP 135

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN++ H+G W+K +  G E 
Sbjct: 136 RANKTMHEGVWDKKSLQGSEL 156


>gi|326777649|ref|ZP_08236914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657982|gb|EGE42828.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+GRAG+G DNVD+  ASRAG++V+N P  N ++ AEH + L+LA+AR IP 
Sbjct: 60  IAAGRRLKVIGRAGVGLDNVDVAAASRAGVMVVNAPTSNIVSAAEHTVGLLLAVARNIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +  +G+WE+  F GVE 
Sbjct: 120 AHGALKEGRWERSRFTGVEL 139


>gi|182437034|ref|YP_001824753.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465550|dbj|BAG20070.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 530

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+GRAG+G DNVD+  ASRAG++V+N P  N ++ AEH + L+LA+AR IP 
Sbjct: 60  IAAGRRLKVIGRAGVGLDNVDVAAASRAGVMVVNAPTSNIVSAAEHTVGLLLAVARNIPQ 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +  +G+WE+  F GVE 
Sbjct: 120 AHGALKEGRWERSRFTGVEL 139


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAARKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRNKYTGVEL 140


>gi|225619505|ref|YP_002720762.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
 gi|225214324|gb|ACN83058.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I  +EH I+LMLA++R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGIIVVNSPDGNTIAASEHTIALMLAVSRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  ST + KW +  F G E 
Sbjct: 116 PAAVSTKEAKWNRDKFTGNEL 136


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|296127708|ref|YP_003634960.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
 gi|296019524|gb|ADG72761.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  G++V+N+P GN+I  +EH I+LMLA++R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGVIVVNSPDGNTIAASEHTIALMLAVSRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  ST + KWE+  F G E 
Sbjct: 116 PAAVSTKEAKWERDKFTGNEL 136


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASSAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN ST   KWEK  FMGVE 
Sbjct: 118 EANASTQASKWEKNRFMGVEV 138


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score = 89.5 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNINIDAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN ST   KWEK  FMGVE 
Sbjct: 118 EANASTQASKWEKNRFMGVEV 138


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 65/81 (80%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK +KV+GRAGIG DN+D+  AS AGIVVMNTPFGNSITTAE AI+LM A+ARQIP
Sbjct: 58  IIAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTPFGNSITTAEQAIALMFALARQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN ST   KWEK  FMGVE 
Sbjct: 118 EANASTQASKWEKNRFMGVEV 138


>gi|84498265|ref|ZP_00997062.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
 gi|84381765|gb|EAP97648.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
          Length = 528

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AK +KV+ RAG+G DNVD+  A++AG++V+N P  N  + AE A+ L+LA AR I  
Sbjct: 60  IAAAKNLKVIARAGVGLDNVDVPAATQAGVMVVNAPTSNITSAAELAVGLLLATARNIAP 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN++   G W++  + GVE 
Sbjct: 120 ANQALKAGAWKRSKYGGVEL 139


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAKKLRVVARAGVGLDNVDVSSATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++ +KV+ RAG+G DNVD+  A+  GI+V+N P  +SI+ AE    +ML+  R IP
Sbjct: 59  IIDASENLKVIARAGVGVDNVDINAATEKGIIVLNAPDASSISVAELLFGMMLSAVRNIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++ +F G+E 
Sbjct: 119 QATASLKRGEWDRKSFKGLEV 139


>gi|300870001|ref|YP_003784872.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
 gi|300687700|gb|ADK30371.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
          Length = 534

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I  +EH I+LMLAI+R I 
Sbjct: 56  IIEAGKNLKIIGRAGVGVDNIDVEAATEKGIIVVNSPDGNTIAASEHTIALMLAISRNIV 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  ST + KW +  F G E 
Sbjct: 116 PAVVSTKEAKWNRDKFTGNEL 136


>gi|126465460|ref|YP_001040569.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Staphylothermus marinus F1]
 gi|126014283|gb|ABN69661.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Staphylothermus marinus F1]
          Length = 311

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+ RAG+G DN+DL  A+  GI V N P   + + AE AI LM+ + R+I 
Sbjct: 58  VIEAAEKLKVIARAGVGLDNIDLDAANEKGIQVFNAPAAPTQSVAELAIGLMIDVLRKIA 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   +G E 
Sbjct: 118 FADRKMREGVWAKKQCLGHEL 138


>gi|156740285|ref|YP_001430414.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
 gi|156231613|gb|ABU56396.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
          Length = 524

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++VVGRAG G DN+DL  A+R GI+V+N P  NS+  AE  I L+L++AR IP
Sbjct: 57  VLAAGTRLRVVGRAGTGVDNIDLDAATRQGIMVVNAPASNSVAVAELTIGLILSLARHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   GKWE+  FMG E 
Sbjct: 117 QAHSTVVAGKWERNRFMGFEV 137


>gi|149174372|ref|ZP_01852999.1| phosphoglycerate dehydrogenase (serA) [Planctomyces maris DSM 8797]
 gi|148846917|gb|EDL61253.1| phosphoglycerate dehydrogenase (serA) [Planctomyces maris DSM 8797]
          Length = 316

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG G DNVD   A   GIVV  TP  NS++ AE  I LMLA+ R+IP
Sbjct: 59  LIDAAPELKIIARAGAGLDNVDTEYAHEKGIVVCFTPDANSLSVAELTIGLMLALMRKIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A + T  G W +  F G E 
Sbjct: 119 EARQDTLTGGWNRLKFTGTEL 139


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+K++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  IAAAEKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|307298969|ref|ZP_07578771.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915394|gb|EFN45779.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 307

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   KK+K++ RAG+G DNVD+  A R  I+V NTP  N+I+ AE    L+L++ R IP
Sbjct: 58  VIDAGKKLKLIARAGVGLDNVDVEAAKRHNIMVRNTPGANAISVAELTFGLLLSLVRHIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                  +GKWEK    G E 
Sbjct: 118 RGTYGIKEGKWEKKELKGTEI 138


>gi|986918|gb|AAB67986.1| A10 [Mus musculus]
          Length = 485

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
          +++ A+K++VVGRA  G DNVDL   +R GI+VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 15 VINAAEKLQVVGRAVTGVDNVDLEPPTRKGILVMNTPNGNSLSAAELTCGMIMCLARQIP 74

Query: 61 VANESTHKGKWEKFNFMGVEA 81
              S   GKW++  FMG E 
Sbjct: 75 QTTASMKDGKWDRKKFMGTEL 95


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 64  AAAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQA 123

Query: 63  NESTHKGKWEKFNFMGVEA 81
           +++   G+W++  + GVE 
Sbjct: 124 SQALKGGEWKRSKYTGVEL 142


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  ++++V+GRAG G DN+D+  A+R GI+V+N P  N++  AE  I L++++AR+IP
Sbjct: 57  VIAAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAELTIGLLISLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W + +F+G E 
Sbjct: 117 QAHASLQSGRWARNDFVGWEV 137


>gi|325003700|ref|ZP_08124812.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia sp. P1]
          Length = 536

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 58/80 (72%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ + ++KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+L+ AR +P 
Sbjct: 66  LAASTRLKVVARAGVGLDNVDVDAATSRGVMVVNAPTSNIVSAAEHAIALLLSAARHVPA 125

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S  +G+W++ ++ GVE 
Sbjct: 126 ADASLRQGQWKRSSYGGVEL 145


>gi|312880178|ref|ZP_07739978.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
 gi|310783469|gb|EFQ23867.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
          Length = 549

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAG+G DNVDL  ASR G+VV+N P GN+++ AE  ++LML + R+ P
Sbjct: 59  LLEAAPVLKVVGRAGVGVDNVDLPEASRRGVVVINAPTGNTLSAAEQTLALMLGLIRRTP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S  +G+W++  FMG + 
Sbjct: 119 QANASMRRGEWDRKRFMGHQL 139


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+GRAG+G DN+D   A+  GI+V+N P GN+I  AE  +++MLA+AR++P
Sbjct: 59  VIEAATKLKVIGRAGVGVDNIDRTAATNKGILVVNAPDGNTIAAAELTMAMMLALARKVP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A      G W+K  F+GVE 
Sbjct: 119 MACSKLKNGVWDKKAFLGVEL 139


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 69/81 (85%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L++A+K+KVVGRAGIG DNV++  A+  G++VMNTPFGNSITTAEHAI+LMLA+AR+IP
Sbjct: 62  ILANARKLKVVGRAGIGVDNVEIPAATAKGVIVMNTPFGNSITTAEHAITLMLALAREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKWEK  FMGVE 
Sbjct: 122 AADASTQAGKWEKNRFMGVEI 142


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 54/79 (68%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 64  AAAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQA 123

Query: 63  NESTHKGKWEKFNFMGVEA 81
            ++   G+W++  + GVE 
Sbjct: 124 GQALKAGEWKRSKYTGVEL 142


>gi|50954968|ref|YP_062256.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951450|gb|AAT89151.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 530

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++V+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR IP
Sbjct: 59  VIGAAPKLRVIARAGVGLDNVDIKTATSAGVMVVNAPTSNIISAAELTVGHILSLARHIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++  + GVE 
Sbjct: 119 AAHSALAQGQWKRSKYTGVEL 139


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +VGRAGIG DN+D+  A++ G++V N P GN    AEH +++  A AR IP
Sbjct: 57  VFEAAPDLVIVGRAGIGVDNIDIDAATQHGVIVANAPEGNVRAAAEHTVAMGFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K +++G E 
Sbjct: 117 QAHARLKDGEWAKSDYLGNEV 137


>gi|158522823|ref|YP_001530693.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511649|gb|ABW68616.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 532

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   A K+K V RAGIG DNVD+  A++ G+ VMNTP GN +TTAEH I++M+A+ R I
Sbjct: 60  ILEAGAPKLKAVARAGIGLDNVDIPAATKHGVAVMNTPEGNVVTTAEHTIAMMMALTRNI 119

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P    S   G+WEK    G E 
Sbjct: 120 PQGTLSLRSGQWEKKKLQGREV 141


>gi|242004086|ref|XP_002422968.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
 gi|212505884|gb|EEB10230.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
          Length = 365

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    +KV+GRAG G DN+DL  A++ GI V+NTP GNSI+  E   +L+  +AR + 
Sbjct: 62  VINSVSNLKVIGRAGTGVDNIDLEAATKKGITVLNTPGGNSISACEMTCALITNLARNVV 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S  +G+W++  + G E 
Sbjct: 122 QACQSLKEGRWDRKLYTGNEL 142


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++K++GRAG+G DNVD+  A+R GIVV+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IIEVGKQLKIIGRAGVGVDNVDVPAATRQGIVVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    +W++  F+G E 
Sbjct: 117 EANQSVKNSQWDRKRFIGAEV 137


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH ++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHTLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|296242880|ref|YP_003650367.1| phosphoglycerate dehydrogenase [Thermosphaera aggregans DSM 11486]
 gi|296095464|gb|ADG91415.1| Phosphoglycerate dehydrogenase [Thermosphaera aggregans DSM 11486]
          Length = 305

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ RAG+G DN+D+  A + GI ++N P  ++ + AE AI LMLA+AR+I 
Sbjct: 57  VIESADRLKVIARAGVGLDNIDVKAAEQRGIALINAPESSTQSVAELAIGLMLAVARKIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++    +G W K   MGVE 
Sbjct: 117 FSDRRMREGYWAKKEAMGVEL 137


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A+K++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 61  LAAARKLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +   G+W++  + GVE 
Sbjct: 121 ANTALKNGEWKRSKYTGVEL 140


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+ RAG+G DN+++  A+  GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 61  IINAADSLKVIARAGVGVDNININAATLKGILVINAPDGNTISATEHSLAMLLSMARNIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S    +W +  F G E 
Sbjct: 121 QAHQSLTNKEWNRNAFKGTEL 141


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KVVGRAG G DNV++  A++ GIVVMNTP GN++TT EHAIS+MLA+AR IP
Sbjct: 58  VLEVASRLKVVGRAGTGLDNVNIPEATKRGIVVMNTPGGNTVTTGEHAISMMLALARNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+WEK  F G E 
Sbjct: 118 QAAHSMREGRWEKKRFQGREV 138


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           VAN ST  GKWE+  F+G E 
Sbjct: 117 VANSSTLSGKWERKKFVGNEL 137


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+V RAG+G DN+D+  A++ G++V+N P GN+I+TAEH  ++  A+ R IP
Sbjct: 56  LFKKMTSLKIVARAGVGVDNIDIDEATKHGVIVVNAPNGNTISTAEHTFAMFSALMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRSAYVGSEL 136


>gi|322710973|gb|EFZ02547.1| d-3-phosphoglycerate dehydrogenase [Metarhizium anisopliae ARSEF
           23]
          Length = 572

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV RAG+G DN+++  A+  GI+V+N+P GN +  AEH I+L+LA AR + 
Sbjct: 73  VLQAGKKLKVVARAGVGVDNINVPAATTQGIIVINSPAGNILAAAEHTIALLLATARNVG 132

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 133 RADGTIKEGKWERSKLVGVEVG 154


>gi|322699487|gb|EFY91248.1| d-3-phosphoglycerate dehydrogenase [Metarhizium acridum CQMa 102]
          Length = 1253

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV RAG+G DN+++  A+  GI+V+N+P GN +  AEH I+L+LA AR + 
Sbjct: 73  VLQAGKKLKVVARAGVGVDNINVPAATTQGIIVINSPAGNILAAAEHTIALLLATARNVG 132

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +GKWE+   +GVE G
Sbjct: 133 RADGTIKEGKWERSKLVGVEVG 154


>gi|326381545|ref|ZP_08203239.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326199792|gb|EGD56972.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 531

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +K++ RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+++ ARQ+P
Sbjct: 62  VLDAGKNLKIIARAGVGLDNVDVPSATERGVMVVNAPTSNIHSAAEHAIALLMSTARQVP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F GVE 
Sbjct: 122 AADVTLKEHTWKRSSFSGVEL 142


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 54/79 (68%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A K++VV RAG+G DNVD+  A++AG++V+N P  N  + AEH ++L+LA AR +  A
Sbjct: 61  AAAPKLRVVARAGVGLDNVDVEAATKAGVMVVNAPTSNITSAAEHTVALILASARNVAQA 120

Query: 63  NESTHKGKWEKFNFMGVEA 81
           + +   G+W++  + GVE 
Sbjct: 121 HSALKGGEWKRSKYTGVEL 139


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFEKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  F+G E 
Sbjct: 116 QANISVKSREWNRTAFVGAEL 136


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFEKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  F+G E 
Sbjct: 116 QANISVKSREWNRTAFVGAEL 136


>gi|300858316|ref|YP_003783299.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685770|gb|ADK28692.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206033|gb|ADL10375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis C231]
 gi|302330586|gb|ADL20780.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276270|gb|ADO26169.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis I19]
          Length = 531

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A K+K+VGRAG+G DNVD+  A+  G++V+N P  N  +  EHAISL+LA ARQIP
Sbjct: 62  VFDAAAKLKIVGRAGVGLDNVDIAAATERGVMVVNAPTSNIHSACEHAISLLLATARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S    +W++ +F GVE 
Sbjct: 122 AADASLRGQEWKRSSFTGVEI 142


>gi|326481542|gb|EGE05552.1| phosphoglycerate dehydrogenase [Trichophyton equinum CBS 127.97]
          Length = 571

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLRAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+   +GVE 
Sbjct: 128 DACSSLKSNKWERSRLVGVEV 148


>gi|326474476|gb|EGD98485.1| D-3-phosphoglycerate dehydrogenase [Trichophyton tonsurans CBS
           112818]
          Length = 570

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLRAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+   +GVE 
Sbjct: 128 DACSSLKSNKWERSRLVGVEV 148


>gi|315039759|ref|XP_003169257.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
 gi|311337678|gb|EFQ96880.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
          Length = 562

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GI+V+N+P GN++  AEH I+L++ +AR IP
Sbjct: 60  LLQAATKLKVVARAGVGVDNIDVDAATKQGIIVVNSPSGNNVAAAEHTIALLMCMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+   +GVE 
Sbjct: 120 DACSSLKSNKWERSRLVGVEV 140


>gi|289597094|ref|YP_003483790.1| Phosphoglycerate dehydrogenase [Aciduliprofundum boonei T469]
 gi|289534881|gb|ADD09228.1| Phosphoglycerate dehydrogenase [Aciduliprofundum boonei T469]
          Length = 304

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 49/80 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A+K+K +GRAG+G DN+D+  A   GI V+NTP   SI+ AE  I L+LA+ R+I 
Sbjct: 57  MIDAAEKLKAIGRAGVGLDNIDVEYAKSKGIKVINTPGATSISVAELTIGLILAVMRKIA 116

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+     G W K    G+E
Sbjct: 117 YADREMRNGAWPKKKCKGIE 136


>gi|240277875|gb|EER41382.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H143]
 gi|325095932|gb|EGC49242.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H88]
          Length = 598

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKWE+   +GVE 
Sbjct: 126 DGCSSLKNGKWERSRLVGVEI 146


>gi|225561271|gb|EEH09552.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus G186AR]
          Length = 598

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKWE+   +GVE 
Sbjct: 126 DGCSSLKNGKWERSRLVGVEI 146


>gi|171681876|ref|XP_001905881.1| hypothetical protein [Podospora anserina S mat+]
 gi|170940897|emb|CAP66547.1| unnamed protein product [Podospora anserina S mat+]
          Length = 588

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+KVV RAG+G DN+D+  A+  GI+V+N+P GN +  AEH I+L++A AR +P
Sbjct: 76  LLAAGSKLKVVARAGVGVDNIDVKAATEQGIIVVNSPSGNILAAAEHTIALLMATARNVP 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + +  +GKWE+   +GVE G
Sbjct: 136 RGDGTLKQGKWERGKLVGVEVG 157


>gi|153005366|ref|YP_001379691.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
 gi|152028939|gb|ABS26707.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
          Length = 528

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+GRAG+G DNVDL  A+R G+VVMNTP G+SIT AE A+S++LA++R + 
Sbjct: 59  LLDKAARLKVIGRAGVGVDNVDLAAATRRGVVVMNTPGGSSITVAELALSMILALSRHVA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKWEK  F G E 
Sbjct: 119 AATGSVKAGKWEKKRFQGHEL 139


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML HA +++V+GRAG+G DN++L  A+R GI VMNTP  N+I  AEH I LMLA+AR IP
Sbjct: 59  MLEHADQLRVIGRAGVGVDNIELEAATRKGIAVMNTPGANAIAVAEHTIGLMLALARFIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A E+ H GKWEK +  G E 
Sbjct: 119 RATETMHAGKWEKKSLQGTEL 139


>gi|302894595|ref|XP_003046178.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727105|gb|EEU40465.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 568

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   +K++VV RAG+G DN+D+  A+  GI+V+N+P GN I  AEH I+L+LA AR I 
Sbjct: 73  VLQAGRKLRVVARAGVGVDNIDVPAATTQGIIVVNSPSGNIIAAAEHTIALLLATARNIG 132

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A+ S   G+W++   +G E
Sbjct: 133 QADSSVKAGRWDRSKLVGSE 152


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  ++++V+GRAG G DN+D+  A+R GI+V+N P  N++  AE  I L+L +AR+IP
Sbjct: 57  VITAGERLRVIGRAGTGVDNIDVEAATRRGIIVVNAPASNNVAVAELTIGLLLCLARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W + +F+G E 
Sbjct: 117 QAHASVQSGRWARNDFIGWEV 137


>gi|254430175|ref|ZP_05043878.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
 gi|197624628|gb|EDY37187.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
          Length = 528

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++LML+++R +P
Sbjct: 57  IIAAAGKLRIIGRAGVGVDNVDVPAATKRGVLVVNSPEGNTIAAAEHALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W++  ++G E 
Sbjct: 117 HAHGSTMAGGWDRKTYVGNEL 137


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K++++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IVEAGSKLQIIGRAGVGVDNIDVPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    KWE+  F+G E 
Sbjct: 117 DANQSVKANKWERNRFIGTEV 137


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K++++GRAG+G DN+D+  A+R GI+V+N+P GN+I  AEHA+++ML+++R IP
Sbjct: 57  IVEAGSKLQIIGRAGVGVDNIDVPAATRQGIIVVNSPEGNTIAAAEHALAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S    KWE+  F+G E 
Sbjct: 117 DANQSVKANKWERNRFIGTEV 137


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AKK+KV+GRAG+G DN+D   A+  GIVV+N P GN+I  AEH +++ML +AR++P
Sbjct: 58  VVEAAKKLKVIGRAGVGVDNIDRNAATNKGIVVVNAPDGNTIAAAEHTMAMMLGLARKVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G W+K  F+GVE 
Sbjct: 118 AACGKLKNGIWDKKAFLGVEL 138


>gi|295401440|ref|ZP_06811410.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976490|gb|EFG52098.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 326

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+ AEH  +++ ++ R IP
Sbjct: 56  LLKKMTSLKIVGRAGVGVDNIDVDEATKQGVIVINAPNGNTISVAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  F+G E 
Sbjct: 116 QANISVKSKEWNRTAFVGSEL 136


>gi|296803933|ref|XP_002842819.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
 gi|238846169|gb|EEQ35831.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
          Length = 571

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  LLQAARKLKVVARAGVGVDNIDIDAATKQGIVVVNSPSGNNMAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    +WE+   +GVE 
Sbjct: 128 DACSSLKSNRWERSRLVGVEV 148


>gi|281356516|ref|ZP_06243008.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Victivallis vadensis ATCC BAA-548]
 gi|281317208|gb|EFB01230.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Victivallis vadensis ATCC BAA-548]
          Length = 524

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K++ RAG G + +D+  A +  I VMNTP  NS   AE  +++MLA +R + 
Sbjct: 57  IIDLLPQLKLIVRAGAGFNTIDIKYARKHDIDVMNTPGANSNAVAEEVVAMMLAASRHLI 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST KG WEK  FMG E 
Sbjct: 117 PADISTRKGDWEKSKFMGREL 137


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 54/79 (68%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A ++KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 62  AAAGRLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQA 121

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 122 NAALKNGEWKRSKYTGVEL 140


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +KK++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSKKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN ST  GKWE+  F+G E 
Sbjct: 117 IANSSTFLGKWERKKFVGNEL 137


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 64/81 (79%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ +KK++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSKKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN ST  GKWE+  F+G E 
Sbjct: 117 IANSSTFLGKWERKKFVGNEL 137


>gi|169619920|ref|XP_001803372.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
 gi|111058367|gb|EAT79487.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
          Length = 571

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 56/80 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+KVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKLKVVARAGVGVDNVDVASATTHGIIVVNSPSGNINAAAEHTIALLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A +S   GKWE+   +GVE
Sbjct: 125 DAAQSIKAGKWERSRLVGVE 144


>gi|170289217|ref|YP_001739455.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
 gi|170176720|gb|ACB09772.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
          Length = 306

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI V+NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKVLNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK    G E 
Sbjct: 120 RATISLKEGKWEKKALKGKEL 140


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAG+G DN+D+  A+  G++VMN P GN++ TAEH  SL+L++A+ IP
Sbjct: 58  ILRAAHHLKVVGRAGVGVDNIDVEAATARGVLVMNAPSGNTLATAEHTFSLLLSLAKNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A  S   G+WEK  F+ VE G
Sbjct: 118 QATASMKGGRWEKGAFLSVELG 139


>gi|309791398|ref|ZP_07685905.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
 gi|308226531|gb|EFO80252.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
          Length = 525

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K++V+GRAG G DN+D+  A+R GIVV+N P  N++  AE  I L+L++AR IP
Sbjct: 57  VIEAGTKLRVIGRAGTGVDNIDVEAATRQGIVVVNAPASNNVAVAELTIGLILSMARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   GKWE+  F G E 
Sbjct: 117 QAHASLQGGKWERTKFSGWEV 137


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+++V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R + 
Sbjct: 58  LLDAGKKLRLVARAGVGIDNVDVDYASSRGVIVVNAPFGNTNSAAEHAMALLLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F G E 
Sbjct: 118 RANGSLKSGEWKRAPFTGYEL 138


>gi|288919125|ref|ZP_06413464.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
 gi|288349469|gb|EFC83707.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
          Length = 529

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHA++L+L++AR++P 
Sbjct: 58  LAAAPRLKVVARAGIGLDNVDVPAATSRGVMVVNAPQSNIVSAAEHAVALLLSVARRVPA 117

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  ++GVE 
Sbjct: 118 AHGALVGGEWKRSKYVGVEL 137


>gi|86742318|ref|YP_482718.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
 gi|86569180|gb|ABD12989.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
          Length = 529

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+KVV RAGIG DNVD+  A++ G++V+N P  N ++ AEHAI+L+LA+AR++P
Sbjct: 57  VLATAGKLKVVARAGIGLDNVDVAAATQRGVMVVNAPQSNIVSAAEHAIALLLAVARRVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E+   G+W++  ++GVE 
Sbjct: 117 AASEALRGGEWKRSKYVGVEL 137


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   +K+KVV RAG+G DN+D   A++ GI+V+N P GN+I+  EH+++++L++AR IP
Sbjct: 60  ILKAGQKLKVVARAGVGVDNIDTETATKEGIIVINAPDGNTISATEHSVAMILSMARNIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++  F G E 
Sbjct: 120 QAHASLSHGEWDRKTFRGTEL 140


>gi|15644153|ref|NP_229202.1| D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
 gi|4981965|gb|AAD36472.1|AE001793_2 D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
          Length = 306

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI V+NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKVLNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK    G E 
Sbjct: 120 RATVSLKEGKWEKKALKGKEL 140


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A K+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 64  ASAPKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLIATARNIPQA 123

Query: 63  NESTHKGKWEKFNFMGVEA 81
           +++   G+W++  + GVE 
Sbjct: 124 SQALKGGEWKRSKYTGVEL 142


>gi|307326525|ref|ZP_07605720.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
 gi|306887933|gb|EFN18924.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
          Length = 533

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK+KVV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP 
Sbjct: 65  IALAKKLKVVARAGVGLDNVDVSTATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQ 124

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 125 ASAALKNGEWKRSKYTGVEL 144


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA  M VVGRAG+G DN+DL  A+  G++V+N P GN+I  AE  ++++L ++R +P
Sbjct: 58  VLDHANNMIVVGRAGVGVDNIDLAAATNKGVLVVNAPDGNTIAAAELTMAMILGLSRSVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +   GKW+K  FMGVE 
Sbjct: 118 QANATLRSGKWDKKAFMGVEL 138


>gi|328778535|ref|XP_001121753.2| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Apis mellifera]
          Length = 513

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    ++VVGRAG G DN+DL  A+R G++V+NTP GNSI+  E   +L+  +AR + 
Sbjct: 62  VFACCPNLRVVGRAGTGVDNIDLEAATRKGVIVLNTPGGNSISACELTCALISNLARNVT 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A +S   G+W++  + G E 
Sbjct: 122 QAVQSLKDGRWDRKLYSGFEL 142


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG G DN+D+  A++ GI+V NTP  N+I+  E AI+ MLA AR   
Sbjct: 59  LMEKAPNLKIVGRAGNGVDNIDIEEATKRGIIVANTPDSNTISACEIAIAHMLAGARNFT 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKWE+  FMG E 
Sbjct: 119 YADSYLKSGKWERDLFMGSEL 139


>gi|46135935|ref|XP_389659.1| hypothetical protein FG09483.1 [Gibberella zeae PH-1]
          Length = 591

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 57/82 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K++VV RAG+G DN+D+  AS  G++V+N+P GN +  AEH I+L+L+ AR + 
Sbjct: 73  VVQAGRKLRVVARAGVGVDNIDVPAASTQGVIVVNSPSGNILAAAEHTIALLLSAARNVG 132

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ S  +G+WE+   +GVE G
Sbjct: 133 QADGSVKEGRWERSKLVGVEVG 154


>gi|327301994|ref|XP_003235689.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
 gi|326461031|gb|EGD86484.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
          Length = 571

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D+  A++ GIVV+N+P GN++  AEH I+L++ +AR I 
Sbjct: 68  VLQAATKLKVVARAGVGVDNIDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIS 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+   +GVE 
Sbjct: 128 DACSSLKSNKWERSRLVGVEV 148


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFKKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  F+G E 
Sbjct: 116 QANISVKSREWNRTAFVGAEL 136


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D+  A+R GIVVMNTP GN+I+TAEH I++M++++R I 
Sbjct: 62  VLEGQSRLKAIVRAGVGVDNIDIPAATRQGIVVMNTPGGNTISTAEHTIAMMMSLSRNIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWE+  F G + 
Sbjct: 122 PAAASMREGKWERKLFTGTQL 142


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           VAN ST  GKWE+  F+G E 
Sbjct: 117 VANNSTLLGKWERKKFVGNEL 137


>gi|281412819|ref|YP_003346898.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
 gi|281373922|gb|ADA67484.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
          Length = 306

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE A+ LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAMGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK    G E 
Sbjct: 120 RATISLKEGKWEKKALNGKEL 140


>gi|78189340|ref|YP_379678.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
 gi|78171539|gb|ABB28635.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
          Length = 538

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++++GRAG G DN+DL  A+R GIVVM+TP GN+++ AEH  +++LA AR IP
Sbjct: 69  VLAKATQLELIGRAGTGVDNIDLEAATRQGIVVMSTPGGNAVSAAEHTCAMLLAAARHIP 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +G W K  + G+E 
Sbjct: 129 QAMADLKQGNWNKHLYAGIEL 149


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++GRAG+G DN+D+  A+R GIVV+N+P GN+I  AEH +++ML+++R IP
Sbjct: 57  VITAGSQLKIIGRAGVGVDNIDIPSATRQGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+S  + +W++ +F+G E 
Sbjct: 117 QANQSIKEHRWDRKSFIGAEV 137


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVVGRAG+G DNVDL  ASR GI+V+NTP  N+I  AE  ++ + A+ R++ 
Sbjct: 59  LLERAEKLKVVGRAGVGVDNVDLEEASRRGILVINTPGANTIGAAEITMAHLYAVLRKLH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +G+W++  FMG E 
Sbjct: 119 LAHKSMLEGQWDRKRFMGEEL 139


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEHA++L+L+  R + 
Sbjct: 58  LLDAAHNLKMVARAGVGVDNVDVDYASAKGVIVVNAPFGNTNSAAEHAMALLLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G W++  F G E 
Sbjct: 118 KANSSLKGGAWKRAPFTGYEL 138


>gi|148270512|ref|YP_001244972.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
 gi|147736056|gb|ABQ47396.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
          Length = 308

 Score = 87.2 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE A+ LMLA AR I 
Sbjct: 62  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAMGLMLACARHIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK    G E 
Sbjct: 122 RATISLKEGKWEKKALNGKEL 142


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AK M++VGRAG G DN+++  A+  G++VMNTP GN+++TAE  +S +LA+AR IP
Sbjct: 98  LITAAKNMRIVGRAGTGVDNINVPAATSKGVLVMNTPGGNTVSTAELTMSHILALARNIP 157

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+W++  + G E 
Sbjct: 158 QAVSSMKEGRWDRKKYTGTEL 178


>gi|95930938|ref|ZP_01313668.1| hypothetical protein Dace_0698 [Desulfuromonas acetoxidans DSM 684]
 gi|95133064|gb|EAT14733.1| hypothetical protein Dace_0698 [Desulfuromonas acetoxidans DSM 684]
          Length = 147

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K+V RAG+G DNVD+  AS  G++V+N PFGN+ + AEH ++++L+  R + 
Sbjct: 58  LLDCATNLKIVARAGVGIDNVDVDYASSKGVIVVNAPFGNTNSAAEHTMAILLSFCRNVT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN S   G+W++  F G E 
Sbjct: 118 IANASLKSGEWKRAPFTGHEL 138


>gi|227541455|ref|ZP_03971504.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227182737|gb|EEI63709.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 531

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  GI+V N P  N  +  EHA++L+LA ARQIP
Sbjct: 61  VLDAAANLQIVGRAGVGLDNVDVETATEKGIMVANAPTSNIHSACEHALALLLATARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++  F GVE 
Sbjct: 121 AADKTLRDGEWKRSKFKGVEI 141


>gi|158522862|ref|YP_001530732.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511688|gb|ABW68655.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 527

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 60/80 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +KV+GRAGIG DNV++  A++ GIVVMNTP GN+ITTAEHAI++M+A++R IP
Sbjct: 58  VITAATNLKVIGRAGIGLDNVNVPAATQKGIVVMNTPTGNTITTAEHAIAMMMALSRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A  S   G+WEK    G E
Sbjct: 118 QATISLKAGRWEKKKLQGQE 137


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSNKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN ST  GKWE+  F+G E 
Sbjct: 117 IANSSTLLGKWERKKFVGNEL 137


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +  K+K++GRAG+G DNVD+  AS+ GI+VMN P GN++   E  + +MLA AR+IP
Sbjct: 61  LLENPGKLKIIGRAGVGLDNVDIEAASKKGIIVMNAPTGNTLAATELTMGMMLAAARKIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W +  FMG++ 
Sbjct: 121 AAHISLKNGEWNRKKFMGIQL 141


>gi|308480441|ref|XP_003102427.1| hypothetical protein CRE_04013 [Caenorhabditis remanei]
 gi|308261159|gb|EFP05112.1| hypothetical protein CRE_04013 [Caenorhabditis remanei]
          Length = 322

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 54/82 (65%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A K+K+VGRAG G DN+D+  A+   I+VMNTP  NS + AE   +L+L+++R +
Sbjct: 62  LLAASAGKLKLVGRAGTGVDNIDVPAATANKILVMNTPQANSRSAAELTCTLILSLSRHV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P A  S   GKW + +FMG E 
Sbjct: 122 PQAAASMKAGKWARKDFMGEEV 143


>gi|268532864|ref|XP_002631560.1| Hypothetical protein CBG20736 [Caenorhabditis briggsae]
 gi|187023013|emb|CAP37692.1| hypothetical protein CBG_20736 [Caenorhabditis briggsae AF16]
          Length = 322

 Score = 87.2 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 54/82 (65%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A K+K+VGRAG G DN+D+  A+   I+VMNTP  NS + AE   +L+L+++R +
Sbjct: 62  LLAASAGKLKLVGRAGTGVDNIDVPAATANKILVMNTPQANSRSAAELTCTLILSLSRHV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P A  S   GKW + +FMG E 
Sbjct: 122 PQAAASMKAGKWARKDFMGEEV 143


>gi|301165854|emb|CBW25427.1| putative D-3-phosphoglycerate dehydrogenase [Bacteriovorax marinus
           SJ]
          Length = 315

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A  +K V RAG GTDN+D       G+ V NTP  N+ + AEHA++LM+ + R+   
Sbjct: 61  LDLAPNLKYVIRAGAGTDNIDKASCQEVGVRVSNTPGANNNSAAEHAVALMMTVLRKTAW 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G W+K  F G E 
Sbjct: 121 AHSTMKSGGWDKSKFTGNEL 140


>gi|134102592|ref|YP_001108253.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004723|ref|ZP_06562696.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133915215|emb|CAM05328.1| D-3-phosphoglycerate dehydrogenase (PgdH) [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 531

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR + 
Sbjct: 62  VLAATTRLKVVARAGVGLDNVEVPAATERGVMVVNAPTSNIVSAAEHAVALLLAVARNVA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++ +F GVE 
Sbjct: 122 AADASLRAGEWKRSSFSGVEL 142


>gi|302342159|ref|YP_003806688.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfarculus baarsii DSM 2075]
 gi|301638772|gb|ADK84094.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfarculus baarsii DSM 2075]
          Length = 316

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVVGRAG G DNVD+   +  G++VMNTP  NS   AE A+  + A++R I 
Sbjct: 57  LLAAADSLKVVGRAGTGLDNVDIPACTAKGVIVMNTPGQNSNAAAELAMGHIFAVSRHIG 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             N    +GKWEK    G E 
Sbjct: 117 RGNAGVKQGKWEKKQLRGREL 137


>gi|17532191|ref|NP_496868.1| hypothetical protein C31C9.2 [Caenorhabditis elegans]
 gi|3874647|emb|CAB05694.1| C. elegans protein C31C9.2, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 322

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 54/82 (65%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A K+K+VGRAG G DN+D+  AS   I+VMNTP  NS + AE   +L+L+++R +
Sbjct: 62  LLAASAGKLKLVGRAGTGVDNIDVPAASANKILVMNTPQANSRSAAELTCTLILSLSRHV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P A  S   GKW + +FMG E 
Sbjct: 122 PQAAASMKAGKWARKDFMGEEV 143


>gi|126728443|ref|ZP_01744259.1| phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126711408|gb|EBA10458.1| phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 336

 Score = 86.8 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+D+  A+  GI V+     N+++ AEHAI+L+L+ A++I 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDIQAAADRGIPVLVATGANAVSVAEHAIALLLSCAKRIL 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G+WEK  F G E 
Sbjct: 122 PLDAGLRDGRWEKPGFAGREI 142


>gi|323359647|ref|YP_004226043.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
 gi|323276018|dbj|BAJ76163.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
          Length = 534

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A  +KVV RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR+IP 
Sbjct: 60  LAAAPSLKVVARAGVGLDNVDIKSATAAGVMVVNAPTSNIISAAELTVGHVLSLARRIPA 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S  +G W++ +F G E 
Sbjct: 120 AHASLAQGLWKRSSFTGTEL 139


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A+ +KVVGRAG+G DNVD+  ASR GI+V+NTP  N+I   E  +  ML + R   
Sbjct: 59  LLSRAENLKVVGRAGVGVDNVDIEEASRRGILVVNTPGANTIGATELTLCHMLNVLRNAH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++  +G+W++  FMG E 
Sbjct: 119 QAHKTLTEGRWDRNKFMGREL 139


>gi|224370615|ref|YP_002604779.1| D-3-phosphoglycerate dehydrogenase [Desulfobacterium autotrophicum
           HRM2]
 gi|223693332|gb|ACN16615.1| SerA1 [Desulfobacterium autotrophicum HRM2]
          Length = 526

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVVGRAGIG DNVD+  A+R G+ VMNTP GN++TTAEHAIS+M+A+ R IP
Sbjct: 58  ILDAATHLKVVGRAGIGLDNVDIPEATRHGVAVMNTPGGNTVTTAEHAISMMMALTRNIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               +  KG WEK N  G E 
Sbjct: 118 RGTATLKKGLWEKKNLQGREL 138


>gi|261198128|ref|XP_002625466.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239595429|gb|EEQ78010.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239615717|gb|EEQ92704.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ER-3]
 gi|327356769|gb|EGE85626.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 602

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 66  VLQAGKNLKVVGRAGVGVDNVDVAAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKWE+   +GVE 
Sbjct: 126 NGCSSLKDGKWERSRLVGVEV 146


>gi|226305887|ref|YP_002765847.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229493419|ref|ZP_04387208.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
 gi|226185004|dbj|BAH33108.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229319735|gb|EEN85567.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
          Length = 530

 Score = 86.8 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K++GRAG+G DNV++  A+  G++V+N P  N  + AEHA++L+++ ARQIP
Sbjct: 62  VLAAGTKLKIIGRAGVGLDNVEIPAATERGVMVVNAPTSNIHSAAEHAVALLMSTARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++  +  W++  F GVE 
Sbjct: 122 AADKTLRENTWKRSKFNGVEI 142


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score = 86.8 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFKKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score = 86.8 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFKKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score = 86.8 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFKKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN ST  GKWE+  F+G E 
Sbjct: 117 FANSSTLLGKWERKKFVGNEL 137


>gi|227488059|ref|ZP_03918375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227091921|gb|EEI27233.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 531

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +++VGRAG+G DNVD+  A+  GI+V N P  N  +  EHA++L+LA ARQIP
Sbjct: 61  ILDAAANLQIVGRAGVGLDNVDVETATEKGIMVANAPTSNIHSACEHALALLLATARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+++   G+W++  F GVE 
Sbjct: 121 AADKTLRDGEWKRSKFKGVEI 141


>gi|325106004|ref|YP_004275658.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pedobacter saltans DSM 12145]
 gi|324974852|gb|ADY53836.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pedobacter saltans DSM 12145]
          Length = 308

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K + RAG G DN+D   A    I ++N P GN    AEHA+ ++L +   + 
Sbjct: 58  VIDKGPNLKFIARAGAGMDNIDEAYAVAKNIALINAPEGNRDAVAEHAMGMLLNLMNNLQ 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W++    G E 
Sbjct: 118 QADMQVRNGIWDREANRGYEL 138


>gi|237834647|ref|XP_002366621.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|211964285|gb|EEA99480.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|221486089|gb|EEE24359.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           GT1]
 gi|221503586|gb|EEE29277.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           VEG]
          Length = 604

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ H +K+K++GRAG+G DNV +  A+  GI V+N+P GN++  AE  + LM+A+AR+IP
Sbjct: 71  IIKHGQKLKIIGRAGVGVDNVCVDAATAQGIFVVNSPNGNTMAAAELTLGLMMALARKIP 130

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W +  FMG + 
Sbjct: 131 QADASVSRGEWTRSKFMGRQL 151


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFNKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFNKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +    +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LFNKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSREWNRTAYVGSEL 136


>gi|295132337|ref|YP_003583013.1| D-3-phosphoglycerate dehydrogenase [Zunongwangia profunda SM-A87]
 gi|294980352|gb|ADF50817.1| D-3-phosphoglycerate dehydrogenase [Zunongwangia profunda SM-A87]
          Length = 313

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K + R G G +N+D+  A  +G+ + + P GN     EH + ++L++  ++ 
Sbjct: 45  FLDAAPNLKFIARVGAGLENIDVAYAKESGVQLFSAPEGNRNAVGEHTLGMLLSLFNKLN 104

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W + +  G+E 
Sbjct: 105 KADREVREGLWNREDNRGIEL 125


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 63/81 (77%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEH I++MLA++R IP
Sbjct: 57  IINSSSKLRIIGRAGVGVDNVDVKAATQKGVLVVNSPGGNTIAAAEHTIAMMLALSRHIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN ST  GKWE+  F+G E 
Sbjct: 117 IANSSTLLGKWERKKFVGNEL 137


>gi|257052425|ref|YP_003130258.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691188|gb|ACV11525.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 520

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A  +K+V RAGIG DN+D+  A+  G++V N P GN    AEH I L    A+QIP
Sbjct: 56  VFENAPNLKIVSRAGIGVDNIDIPAATDHGVIVANAPRGNVYAAAEHTIGLAFNAAKQIP 115

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+     G W+  +F  +E G
Sbjct: 116 QAHMQVQAGGWDGASFDALELG 137


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH++++  A AR IP
Sbjct: 57  VFAAAPDLIIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHSVAMAFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G+W K  F+G E 
Sbjct: 117 QAHDRLKSGEWAKGEFLGTEV 137


>gi|222100164|ref|YP_002534732.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
 gi|221572554|gb|ACM23366.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
          Length = 306

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAGIG DN+D+  A   GI ++NTP  ++ + AE AI LMLA AR I 
Sbjct: 60  IIEAGKNLKIIARAGIGLDNIDVQKAKEKGIKILNTPGASAPSVAELAIGLMLACARHIA 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +GKWEK    G E 
Sbjct: 120 KATISLKEGKWEKKILKGKEL 140


>gi|169630385|ref|YP_001704034.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium abscessus ATCC
           19977]
 gi|169242352|emb|CAM63380.1| D-3-phosphoglycerate dehydrogenase (SerA) [Mycobacterium abscessus]
          Length = 523

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 54  VLAAGTKLKIVARAGVGLDNVDVKAATARGVLVVNAPTSNIHSAAEHAVTLLLATARQIP 113

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S     W++ +F G E 
Sbjct: 114 AADASLKAHTWKRSSFNGTEI 134


>gi|163839793|ref|YP_001624198.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953269|gb|ABY22784.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 530

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 53/80 (66%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  AKK+KV+ RAG G DNVD+  A++AG++V+N P  N ++ AE  +  +L++AR IP 
Sbjct: 61  IVAAKKLKVIARAGFGLDNVDIKAATQAGVMVVNAPTSNIVSAAELTVGHILSLARHIPA 120

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + G E 
Sbjct: 121 ASAALKAGEWKRSKYTGTEL 140


>gi|225443272|ref|XP_002273552.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 624

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +
Sbjct: 138 VFEAAKGRLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNV 197

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 198 AQADASMKAGKWQRNKYVGV 217


>gi|18394525|ref|NP_564034.1| PGDH (3-PHOSPHOGLYCERATE DEHYDROGENASE); phosphoglycerate
           dehydrogenase [Arabidopsis thaliana]
 gi|3122858|sp|O04130|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic;
           Short=3-PGDH; Flags: Precursor
 gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 624

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 138 VFEAAKGRLKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLASMARNV 197

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKWE+  ++GV
Sbjct: 198 AQADASIKAGKWERSKYVGV 217


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 70  AAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQA 129

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 130 NTALKNGEWKRSKYTGVEL 148


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 57  AAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQA 116

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 117 NTALKNGEWKRSKYTGVEL 135


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 55/79 (69%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
           + A++++VV RAG+G DNVD+  A++AG++V+N P  N +T AE A  L++A AR IP A
Sbjct: 64  AAARRLRVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLLVATARNIPQA 123

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W++  + GVE 
Sbjct: 124 NTALKNGEWKRSKYTGVEL 142


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K++VVGRAG G DN+DL  A++ GI+V+N P  NSI  AE  I LM+ +AR IP
Sbjct: 57  VLAAGTKLRVVGRAGTGVDNIDLAAANQQGILVVNAPASNSIAVAELTIGLMIGLARNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   GKWE+  + G E 
Sbjct: 117 QAHTALQNGKWERSKYGGWEV 137


>gi|307265934|ref|ZP_07547482.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918998|gb|EFN49224.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 324

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+K++ R G G DNVD+  A+  GI+V N P  N+I+  EH I+L++ +A+Q+ 
Sbjct: 57  VIENAPKLKIISRTGAGVDNVDVEAATERGILVCNLPAVNNISVCEHTIALIMHLAKQLS 116

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
             +++   G W+ + + + VE 
Sbjct: 117 FMDKAVRTGNWKARNSNVSVEL 138


>gi|258645797|ref|ZP_05733266.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
 gi|260403167|gb|EEW96714.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
          Length = 530

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+GRAG+G D +D+  A+  GI V+NTP  N+I   EH ++LML+I R IP
Sbjct: 57  VIHAATNLKVIGRAGVGIDGIDIPEATAKGITVVNTPESNTIAACEHTLALMLSITRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S  +G+W++ +F G++ 
Sbjct: 117 QAHQSIMEGRWDRKSFTGIQL 137


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+++VGRAG GTDN+D+  A++ G++V NTP  NSI+  E  I+LM+A AR + 
Sbjct: 59  LLEKATKLRIVGRAGNGTDNIDIHAATKKGVIVANTPESNSISACELGIALMMACARDVS 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           VA++    GKW + +F GVE 
Sbjct: 119 VADKDMKAGKWSRNSFEGVEL 139


>gi|114762720|ref|ZP_01442154.1| phosphoglycerate dehydrogenase [Pelagibaca bermudensis HTCC2601]
 gi|114544630|gb|EAU47636.1| phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 335

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+DL  A+  GI V+     N+++ AEHAI+LMLA  +++ 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDLTAAAERGIPVLVATGANAVSVAEHAIALMLAAVKRVL 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G+WEK  F G E 
Sbjct: 122 PLDAGLRAGRWEKPGFAGREL 142


>gi|302837628|ref|XP_002950373.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
 gi|300264378|gb|EFJ48574.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
          Length = 539

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G D+VDL  A+  G +V+N P  N++  AEH I+L+ A+AR IP A+ + 
Sbjct: 56  RLKVVGRAGVGVDHVDLTAATEYGCLVVNAPTANTLAAAEHGIALLCAMARNIPQADAAM 115

Query: 67  HKGKWEKFNFMGV 79
             G+W++ +F+G 
Sbjct: 116 KSGRWDRSSFLGT 128


>gi|320160110|ref|YP_004173334.1| D-3-phosphoglycerate dehydrogenase [Anaerolinea thermophila UNI-1]
 gi|319993963|dbj|BAJ62734.1| D-3-phosphoglycerate dehydrogenase [Anaerolinea thermophila UNI-1]
          Length = 314

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +    K++KVVGRAGIG DN+DL  A  AG+ V+N+P   +++ AE A+ LMLA+ R+IP
Sbjct: 59  VFEAGKRLKVVGRAGIGVDNIDLNAARAAGVTVVNSPLATTVSVAELAMGLMLALVREIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  + KW K  F G E 
Sbjct: 119 RADASMKQNKWLKKEFEGHEL 139


>gi|302666561|ref|XP_003024878.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
 gi|291188954|gb|EFE44267.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
          Length = 571

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+KVV RAG+G DN+D   A++ GIVV+N+P GN++  AEH I+L++ +AR IP
Sbjct: 68  VLQAASKLKVVARAGVGVDNIDADAATKQGIVVVNSPSGNNVAAAEHTIALLMCMARNIP 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+   +GVE 
Sbjct: 128 DACSSLKSNKWERSRLVGVEV 148


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+ + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 57  VLEAAEDLVIVGRAGIGVDNIDIEAATDNGVIVANAPEGNVRAAAEHTVAMTFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K  ++G E 
Sbjct: 117 QAHIRLKDGEWAKSEYLGAEL 137


>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa]
 gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa]
          Length = 637

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 151 VFEAAKGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLAAMARNV 210

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   G+W++  ++GV
Sbjct: 211 AQADASMKAGQWQRNKYVGV 230


>gi|119872080|ref|YP_930087.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pyrobaculum islandicum DSM 4184]
 gi|119673488|gb|ABL87744.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum islandicum DSM
           4184]
          Length = 307

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ R G+G DNVD+  A + GI V++ P   + + AE  I LMLA+AR+IP
Sbjct: 57  IIDAGTNLKILARYGVGLDNVDVEYAVKRGIAVVSAPRAPTQSVAELTIGLMLAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + N    +G+W K  ++G+E 
Sbjct: 117 LLNAKVKEGEWPKGKYIGIEL 137


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ AKK+KVVGRAG G DN+D+  A++ GI+V NTP  N+I+  E  I L+LA +R I 
Sbjct: 61  LMNMAKKLKVVGRAGNGVDNIDIPEATKRGIIVANTPDSNTISACELTIGLLLAQSRNIA 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +    +G W++ +FMG E 
Sbjct: 121 KTDRFLKEGNWDRDSFMGTEL 141


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  ++K++GRAG+G DNVD+  ASR GI+VMN P GN++   E  ++LMLA AR++P
Sbjct: 61  LIENPGRLKIIGRAGVGLDNVDIEAASRKGIIVMNAPTGNTLAATELTMALMLAAARKVP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN+S   G+W++  FMG++ 
Sbjct: 121 LANQSLKAGEWDRKRFMGIQL 141


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A+ AGI+V+N P  N I+ AE AI  +L++AR IP 
Sbjct: 60  IAAAPRLQVVARAGVGLDNVDIKAATTAGIMVVNAPTSNVISAAELAIGHILSLARFIPD 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S  +G W++ +F GVE 
Sbjct: 120 ASASLKQGLWKRSSFTGVEL 139


>gi|170781815|ref|YP_001710147.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156383|emb|CAQ01531.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 529

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A+ AG++V+N P  N I+ AE AI  +L++AR IP 
Sbjct: 60  IAAAPRLQVVARAGVGLDNVDIKAATTAGVMVVNAPTSNVISAAELAIGHILSLARFIPD 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S  +G W++ +F GVE 
Sbjct: 120 ASASLKQGLWKRSSFTGVEL 139


>gi|260428767|ref|ZP_05782744.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
 gi|260419390|gb|EEX12643.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
          Length = 336

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G DN+D+  A+  GI V+     N+++ AEHAI+L+LA  ++I 
Sbjct: 62  VMDAAPQLKVISKHGVGVDNIDIQAAAERGIPVLVATGANAVSVAEHAIALLLAAVKRIL 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G+WEK  F G E 
Sbjct: 122 PLDAGLRAGRWEKPGFSGHEI 142


>gi|257125820|ref|YP_003163934.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
 gi|257049759|gb|ACV38943.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
          Length = 530

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG GTDN+++  A+  G++V NTP  N+++  E AI LM+A +R I 
Sbjct: 59  LLDKAKNLKIVGRAGNGTDNINIPEATAHGVIVANTPDSNTVSACEIAIGLMIATSRNIV 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKWE+  F+G E 
Sbjct: 119 AANNFIRSGKWEREIFVGNEL 139


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+VGRAG G DN+D+  A+  G++V NTP  N+++  E AI+L+LA AR I 
Sbjct: 59  LLDKGKKLKIVGRAGNGIDNIDVKEATNHGVIVANTPDSNTVSACELAITLLLATARNIL 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW++  F+G E 
Sbjct: 119 PADRYLKSGKWDREIFVGNEV 139


>gi|302142267|emb|CBI19470.3| unnamed protein product [Vitis vinifera]
          Length = 532

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A +++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH ++L+ A+AR I
Sbjct: 61  VFESAGRRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGVALLTAMARNI 120

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKWE+  ++GV
Sbjct: 121 AQADASVKAGKWERSKYVGV 140


>gi|225458719|ref|XP_002283022.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 605

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A +++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH ++L+ A+AR I
Sbjct: 119 VFESAGRRLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGVALLTAMARNI 178

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKWE+  ++GV
Sbjct: 179 AQADASVKAGKWERSKYVGV 198


>gi|330934580|ref|XP_003304604.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
 gi|311318673|gb|EFQ87289.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
          Length = 586

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKKMKVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTIALLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKWE+   +GVE
Sbjct: 125 DASQSIKAGKWERSRLVGVE 144


>gi|240991833|ref|XP_002404432.1| D-3-phosphoglycerate dehydrogenase, putative [Ixodes scapularis]
 gi|215491559|gb|EEC01200.1| D-3-phosphoglycerate dehydrogenase, putative [Ixodes scapularis]
          Length = 473

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+GRAG G DN+D   A+R GI+V+N P GN+++ AE   ++++ ++R+IP
Sbjct: 62  VIKAGQALKVIGRAGTGVDNIDCDAATRQGILVINAPGGNTLSAAELTCAMIVTLSREIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   GKW++  FMG E 
Sbjct: 122 AATMSLKAGKWDRKTFMGNEL 142


>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa]
 gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 147 VFEAAKGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLASMARNV 206

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   G+W++  ++GV
Sbjct: 207 AQADASMKAGQWQRNKYVGV 226


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+KVV R G+G DN+DL  AS+ GI+V+N+P GN++   E  + ++ +IAR+IP
Sbjct: 59  LLEAGKKLKVVARVGVGVDNIDLGAASKMGIIVLNSPTGNTLAATELTMGMIFSIARKIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S   G+W++  F+G + 
Sbjct: 119 QANNSLLSGEWKREKFLGTQL 139


>gi|295657214|ref|XP_002789178.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
 gi|226284495|gb|EEH40061.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
          Length = 608

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               +   GKWE+   +G+E 
Sbjct: 126 EGCSTLKAGKWERSRLVGIEV 146


>gi|297526254|ref|YP_003668278.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Staphylothermus hellenicus DSM 12710]
 gi|297255170|gb|ADI31379.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Staphylothermus hellenicus DSM 12710]
          Length = 311

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+ RAG+G DN+DL  A+  GI V N P   + + AE AI LM+ + R+I 
Sbjct: 58  VIEVAEKLKVIARAGVGLDNIDLDAANEKGIQVFNAPSAPTQSVAELAIGLMIDVLRKIA 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G W K   +G E 
Sbjct: 118 FADRKMREGAWAKKQCLGREL 138


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+GRAG+G DNVD+  AS  GI+V+NTP  N+I   E  IS ML + R   
Sbjct: 59  LIDRGEHLKVIGRAGVGVDNVDIERASLRGILVVNTPGANTIGATELTISHMLNVLRNAH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++S  +G+W++  FMG E 
Sbjct: 119 IAHQSILEGRWDRKKFMGREL 139


>gi|311030775|ref|ZP_07708865.1| D-3-phosphoglycerate dehydrogenase [Bacillus sp. m3-13]
          Length = 524

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    ++VV RAG+G DN+D+  A++ G+VV+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LLSSLSNLQVVARAGVGVDNIDITAATKRGVVVINAPDGNTISTAEHTFAMISSLVRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +    +W +  F+G E 
Sbjct: 116 QANMNVKGAQWSRKKFIGTEL 136


>gi|305665475|ref|YP_003861762.1| putative dehydrogenase [Maribacter sp. HTCC2170]
 gi|88710231|gb|EAR02463.1| predicted dehydrogenase [Maribacter sp. HTCC2170]
          Length = 337

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  AK +K +GR G G +N+D+  A +  I +   P GN     EH + ++L++   + 
Sbjct: 82  FIKKAKNLKFIGRVGAGLENIDVAYAKKKNIFLAAAPEGNRNAVGEHTLGMLLSLFNNLN 141

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW++    GVE 
Sbjct: 142 KANLEVRNGKWDREGNRGVEL 162


>gi|327311266|ref|YP_004338163.1| D-3-phosphoglycerate dehydrogenase [Thermoproteus uzoniensis
           768-20]
 gi|326947745|gb|AEA12851.1| D-3-phosphoglycerate dehydrogenase (serA) [Thermoproteus uzoniensis
           768-20]
          Length = 305

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    ++K+V R G+G DN+ +  A + GI V+N P   + + AE  + LM+A+AR+IP
Sbjct: 57  VIDRGARLKIVARYGVGLDNIAVDYAIKRGIAVINAPNAPTRSAAELTLGLMIALARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G W K  ++G E 
Sbjct: 117 ILDREVKAGGWPKGKYVGREL 137


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 62/81 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+++VGRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADKLRIVGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G W++  ++G E 
Sbjct: 117 QAHASMREGAWDRKKYVGNEL 137


>gi|255533692|ref|YP_003094064.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Pedobacter heparinus DSM 2366]
 gi|255346676|gb|ACU06002.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Pedobacter heparinus DSM 2366]
          Length = 307

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K + RAG G DN+D   A   GI ++N P GN     EHAI ++LA+     
Sbjct: 59  LMEAAPNLKFIARAGAGLDNIDEAFAKLKGIKLLNAPEGNMDAVGEHAIGMLLALMNNFR 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    KG W++    G E 
Sbjct: 119 NADTEVRKGVWDREGNRGYEL 139


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +V RAGIG DN+D+  A+  G++V N P GN    AEH ++L  A AR IP
Sbjct: 57  VFEAAPDLVIVARAGIGVDNIDIDAATDHGVMVANAPAGNVRAAAEHTVALAFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W K +++G E 
Sbjct: 117 QAHARLDAGSWAKDDYLGTEL 137


>gi|120437831|ref|YP_863517.1| D-3-phosphoglycerate dehydrogenase [Gramella forsetii KT0803]
 gi|117579981|emb|CAL68450.1| D-3-phosphoglycerate dehydrogenase [Gramella forsetii KT0803]
          Length = 326

 Score = 84.9 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +K + R G G +++D+  A   GI + + P GN     EH++ ++L++  ++ 
Sbjct: 57  FIDAAPNLKFIARVGAGLESIDVEYAKERGIQLFSAPEGNRNAVGEHSLGMLLSLFNKLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++   +G W++    GVE 
Sbjct: 117 KADKEVREGLWQREENRGVEL 137


>gi|291287172|ref|YP_003503988.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884332|gb|ADD68032.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 544

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 58/81 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +  K+K++GRAG+G DNVD+  AS  GI+VMN P GN++   E  + +ML++ R++P
Sbjct: 61  LIENPGKLKIIGRAGVGLDNVDIEAASMKGIIVMNAPTGNTLAACELTMGMMLSVVRKLP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +AN+ T  G+W++  FMG++ 
Sbjct: 121 LANQVTKSGEWDRKRFMGIQL 141


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AE A++LML+++R +P
Sbjct: 57  VIKAGGRLRIIGRAGVGVDNVDVPTATQQGVLVVNSPEGNTIAAAEQALALMLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W++  ++G E 
Sbjct: 117 QAHASTMAGGWDRKKYVGNEL 137


>gi|289743179|gb|ADD20337.1| D-3-phosphoglycerate dehydrogenase [Glossina morsitans morsitans]
          Length = 332

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   K  +KVVGRAG G DN+D+  A++  ++V+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLDAGKGSLKVVGRAGAGVDNIDVPAATKNNVIVLNTPGGNSISACELTCVLIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 CPAAQSMKEGRWDRKLYTGTEL 143


>gi|226289513|gb|EEH45017.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb18]
          Length = 598

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   GKWE+   +GVE 
Sbjct: 126 EGCSILKAGKWERSRLVGVEV 146


>gi|225680421|gb|EEH18705.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb03]
          Length = 518

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR I 
Sbjct: 66  VLRAGKNLKVVARAGVGVDNVDVPTATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIS 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   GKWE+   +GVE 
Sbjct: 126 EGCSILKAGKWERSRLVGVEV 146


>gi|189201403|ref|XP_001937038.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984137|gb|EDU49625.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 573

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 57/80 (71%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKKMKVV RAG+G DNVD+  A+  GI+V+N+P GN    AEH I+L++A+AR + 
Sbjct: 65  LLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNSPSGNINAAAEHTITLLMAVARNVG 124

Query: 61  VANESTHKGKWEKFNFMGVE 80
            A++S   GKWE+   +GVE
Sbjct: 125 DASQSIKAGKWERSRLVGVE 144


>gi|39971783|ref|XP_367282.1| hypothetical protein MGG_07207 [Magnaporthe oryzae 70-15]
 gi|145019699|gb|EDK03927.1| hypothetical protein MGG_07207 [Magnaporthe oryzae 70-15]
          Length = 586

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 58/82 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A K++VV RAG+G DN+++  A++ GI+V+N+P GN +  AEH ++L+LA AR + 
Sbjct: 76  VLSAAAKLRVVARAGVGVDNINVDAATKQGIIVVNSPAGNIVAAAEHTVALLLATARHVG 135

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  + KWE+   +GVE G
Sbjct: 136 RADSTLKQRKWERSKLVGVEVG 157


>gi|167042357|gb|ABZ07085.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine crenarchaeote
           HF4000_ANIW97M7]
          Length = 310

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K K++ R G+G DN+D   A    I V+N   G +   AE  I LML++AR+I 
Sbjct: 61  LIEKADKCKIIARVGVGLDNIDEEAAKEKNIRVINAVEGATTAVAELVIGLMLSMAREIT 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W K   MG E 
Sbjct: 121 RADREIRNGNWIKKELMGSEL 141


>gi|332169711|gb|AEE18966.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 315

 Score = 84.5 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +K + R G G +++D+  A   GI +++ P GN     E A+ ++L++   + 
Sbjct: 57  FIDAAPNLKFIARVGAGLESIDIPYAESKGIYLISAPEGNRNAVGEQALGMLLSLFNNLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W +    GVE 
Sbjct: 117 RADAEVKAGNWNREANRGVEL 137


>gi|330466217|ref|YP_004403960.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328809188|gb|AEB43360.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 532

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 119 ASAALKAGEWKRSKYTGVEL 138


>gi|307111670|gb|EFN59904.1| hypothetical protein CHLNCDRAFT_56437 [Chlorella variabilis]
          Length = 609

 Score = 84.5 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +K ++KVVGRAG+G DNVDL  AS  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 124 VFEASKGRLKVVGRAGVGIDNVDLAAASEMGCLVVNAPTANTVAAAEHGIALLCALARNV 183

Query: 60  PVANESTHKGKWEKFNFMGV 79
           P A+ +   G+WE+  ++GV
Sbjct: 184 PQADAAMKGGRWERSKWVGV 203


>gi|298528388|ref|ZP_07015792.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512040|gb|EFI35942.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 394

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 39/85 (45%), Positives = 51/85 (60%), Gaps = 4/85 (4%)

Query: 1   MLSHAK----KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           ++  A     K+K++GR G+GTDN+DL  A   G+VV   P GN   TAEH I LM AIA
Sbjct: 56  LIEAATTKRGKLKIIGRGGVGTDNIDLQAAKECGVVVKFAPHGNINATAEHVIGLMFAIA 115

Query: 57  RQIPVANESTHKGKWEKFNFMGVEA 81
           R++P A+ +   G W K  F GVE 
Sbjct: 116 RKVPFAHHTLKSGIWHKARFKGVEL 140


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LYEKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSKEWNRGAYVGAEL 136


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +      +K+VGRAG+G DN+D+  A++ G++V+N P GN+I+TAEH  +++ ++ R IP
Sbjct: 56  LYEKMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN S    +W +  ++G E 
Sbjct: 116 QANISVKSKEWNRGAYVGAEL 136


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 58  VLDGAADLMIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAAARSIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W K +F+G E 
Sbjct: 118 QAHTRLKAGDWAKSDFLGTEV 138


>gi|325286662|ref|YP_004262452.1| phosphoglycerate dehydrogenase [Cellulophaga lytica DSM 7489]
 gi|324322116|gb|ADY29581.1| Phosphoglycerate dehydrogenase [Cellulophaga lytica DSM 7489]
          Length = 312

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K +GR G G +N+D   A++ GI + + P GN     EH + ++L++  ++ 
Sbjct: 57  FLDKATNLKFIGRLGAGLENIDTDYATQKGIFLASAPEGNRNAVGEHTLGMILSLFNKLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    GKW++    G+E 
Sbjct: 117 KADKEVRNGKWDREGNRGIEL 137


>gi|154270428|ref|XP_001536069.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150409996|gb|EDN05384.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 603

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVVGRA +G DNVD+  A++ GIVV+N+P GN    AEH I+LML++AR IP
Sbjct: 71  VLQAGKNLKVVGRAVVGVDNVDVTAATKLGIVVINSPSGNVGAAAEHTIALMLSMARNIP 130

Query: 61  VANESTHKGKWEKFNFMGVEA 81
               S   GKWE+   +GVE 
Sbjct: 131 DGCSSLKNGKWERSRLVGVEI 151


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AE A++LML+++R +P
Sbjct: 61  VIKAGARLRIIGRAGVGVDNVDVPTATQQGVLVVNSPEGNTIAAAEQALALMLSLSRHVP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G W++  ++G E 
Sbjct: 121 QAHASTMAGGWDRKKYVGNEL 141


>gi|149030527|gb|EDL85564.1| 3-phosphoglycerate dehydrogenase, isoform CRA_b [Rattus norvegicus]
 gi|149030529|gb|EDL85566.1| 3-phosphoglycerate dehydrogenase, isoform CRA_b [Rattus norvegicus]
          Length = 140

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 55/76 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+K++VVGRAG G DNVDL  A+R G++VMNTP GNS++ AE    +++ +ARQIP
Sbjct: 63  VINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQIP 122

Query: 61  VANESTHKGKWEKFNF 76
            A  S   GKW++  F
Sbjct: 123 QATASMKDGKWDRKKF 138


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+K+KVVGRAG+G DNVD+  A++ GI+V+NTP  N+I   E  +  ML I R   
Sbjct: 59  LLERAEKLKVVGRAGVGVDNVDIEEATKRGILVVNTPGANTIGATELTMMHMLTIMRNGH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ES    KW++  FMG E 
Sbjct: 119 KAHESMLNYKWDRKKFMGEEL 139


>gi|289578762|ref|YP_003477389.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter italicus Ab9]
 gi|289528475|gb|ADD02827.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter italicus Ab9]
          Length = 325

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 54/82 (65%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A K+K++ R G G DN+D+  A+  GI+V N P  NS++ AEH I+++L +A+Q+ 
Sbjct: 58  IIENAPKLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNSLSVAEHTIAMILHLAKQLS 117

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
           + +++   G WE + + + VE 
Sbjct: 118 LMDQAVRNGNWEMRNSNISVEV 139


>gi|217076470|ref|YP_002334186.1| D-3-phosphoglycerate dehydrogenase [Thermosipho africanus TCF52B]
 gi|217036323|gb|ACJ74845.1| D-3-phosphoglycerate dehydrogenase [Thermosipho africanus TCF52B]
          Length = 303

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ RAG G DNVD+  A   GI V+NTP  N I+ AE AI LM++ AR I 
Sbjct: 56  IIEAGKNLKIIARAGTGLDNVDVEKAKEKGIKVINTPGANGISVAELAIGLMISCARHIA 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   G+W K    G E 
Sbjct: 116 KGTIDLKNGEWTKKQLKGHEL 136


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 59  VFEAASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAGARSIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K  ++G E 
Sbjct: 119 QAHARLRTGEWAKSEYLGTEV 139


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 61  VFEAASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAGARSIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K  ++G E 
Sbjct: 121 QAHARLRTGEWAKSEYLGTEV 141


>gi|302785179|ref|XP_002974361.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
 gi|300157959|gb|EFJ24583.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
          Length = 545

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +  ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 59  VFEASNGRLKVVGRAGVGIDNVDLQAATEMGCLVVNAPTANTVAAAEHGIALLAALARNV 118

Query: 60  PVANESTHKGKWEKFNFMGV 79
             AN S   GKW++  F GV
Sbjct: 119 AQANASVKSGKWQRNKFTGV 138


>gi|302786926|ref|XP_002975234.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
 gi|300157393|gb|EFJ24019.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
          Length = 629

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +  ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 143 VFEASNGRLKVVGRAGVGIDNVDLQAATEMGCLVVNAPTANTVAAAEHGIALLAALARNV 202

Query: 60  PVANESTHKGKWEKFNFMGV 79
             AN S   GKW++  F GV
Sbjct: 203 AQANASVKSGKWQRNKFTGV 222


>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R +
Sbjct: 147 VFEAAKGRLKVVGRAGVGIDNVDLGAATEFGCLVVNAPTANTVAAAEHGIALLAAMSRNV 206

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   G+W++  ++GV
Sbjct: 207 AQADASMKAGEWQRNKYVGV 226


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 56/75 (74%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           KM+ V RAG+G DN+D+  A+R G+VVMNTP GN+++ AEH I+L+LA++R+IP A+ + 
Sbjct: 64  KMRAVARAGVGVDNIDVAAATRKGVVVMNTPGGNTVSAAEHTIALLLALSRRIPAADATM 123

Query: 67  HKGKWEKFNFMGVEA 81
             G W++  F+G E 
Sbjct: 124 KAGGWDRNKFVGTEV 138


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKRGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +  +G + +  F GVE 
Sbjct: 117 QAYMACKQGDFRRNRFKGVEL 137


>gi|126460346|ref|YP_001056624.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum calidifontis JCM
           11548]
 gi|126250067|gb|ABO09158.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum calidifontis JCM
           11548]
          Length = 306

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +K++ R G+G DNVD+  A + GI V+N P   + + AE  I LM A+AR+IP
Sbjct: 57  VIDAGRNLKILARYGVGLDNVDVEYAVKRGISVVNAPNAPARSVAELTIGLMFAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G+W K  ++G+E 
Sbjct: 117 LLSTKVKAGEWPKGKYVGIEL 137


>gi|126698579|ref|YP_001087476.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           630]
 gi|254974543|ref|ZP_05271015.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-66c26]
 gi|255091931|ref|ZP_05321409.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CIP 107932]
 gi|255100030|ref|ZP_05329007.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-63q42]
 gi|255305917|ref|ZP_05350089.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           ATCC 43255]
 gi|255313666|ref|ZP_05355249.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-76w55]
 gi|255516350|ref|ZP_05384026.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-97b34]
 gi|255649450|ref|ZP_05396352.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-37x79]
 gi|260682616|ref|YP_003213901.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CD196]
 gi|260686216|ref|YP_003217349.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           R20291]
 gi|306519527|ref|ZP_07405874.1| D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-32g58]
 gi|115250016|emb|CAJ67836.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile]
 gi|260208779|emb|CBA61655.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           CD196]
 gi|260212232|emb|CBE02943.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           R20291]
          Length = 313

 Score = 83.8 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 1   MLSHA---KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR 57
           ++  A   KK+K++ R G+G DN+D+  A   GI VMNTP  +SI+ AE  I  +  +AR
Sbjct: 57  VIDKALEGKKLKLIVRGGVGLDNIDVKYAQANGIKVMNTPNASSISVAELTIGQLFVLAR 116

Query: 58  QIPVANESTHKGKWEKFNFMGVEA 81
            I  AN +   GKWEK  + G E 
Sbjct: 117 FINTANVTMRDGKWEKKKYKGTEI 140


>gi|255654967|ref|ZP_05400376.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium difficile
           QCD-23m63]
 gi|296449715|ref|ZP_06891485.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP08]
 gi|296877968|ref|ZP_06901987.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP07]
 gi|296261439|gb|EFH08264.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP08]
 gi|296431036|gb|EFH16864.1| phosphoglycerate dehydrogenase [Clostridium difficile NAP07]
          Length = 313

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 1   MLSHA---KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIAR 57
           ++  A   KK+K++ R G+G DN+D+  A   GI VMNTP  +SI+ AE  I  +  +AR
Sbjct: 57  VIDKALEGKKLKLIVRGGVGLDNIDVKYAQANGIKVMNTPNASSISVAELTIGQLFVLAR 116

Query: 58  QIPVANESTHKGKWEKFNFMGVEA 81
            I  AN +   GKWEK  + G E 
Sbjct: 117 FINTANVTMRDGKWEKKKYKGTEI 140


>gi|257069029|ref|YP_003155284.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
 gi|256559847|gb|ACU85694.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
          Length = 535

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A ++KVV RAG+G DNVD+  A+ AG++V+N P  N ++ AE AI+L+L+  R + 
Sbjct: 59  VYAAASQLKVVARAGVGLDNVDVDAATAAGVMVINAPTSNIVSAAELAITLILSSLRNLG 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+WE+    GVE 
Sbjct: 119 RADASVKAGRWERKQLTGVEL 139


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KVVGRAG+G DNVD+  A+R GI+V+NTP  N+I   E  +  ML I R   
Sbjct: 59  LLDRAQRLKVVGRAGVGVDNVDIEEATRRGILVVNTPGANTIGATELTMMHMLTILRNGH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ES  + +W++  FMG E 
Sbjct: 119 RAHESILEHRWDRKKFMGTEL 139


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K+VGRAG G DN+++  A++ GI+V NTP  N+I+  E AI+ +LA +R   
Sbjct: 59  LMEKAPNLKIVGRAGNGVDNINIEEATKRGIIVANTPDSNTISACEIAIAHILAGSRNFT 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKWE+  FMG E 
Sbjct: 119 YADSYLKAGKWERDLFMGNEL 139


>gi|221633825|ref|YP_002523051.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
 gi|221156639|gb|ACM05766.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
          Length = 333

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA ++KV+  +G+G DN+D+  A+R GIVV N    N  + AE A  LMLA+AR I 
Sbjct: 74  VLAHANRLKVISTSGVGFDNIDVAEATRRGIVVANCHGANEHSVAELAFGLMLALARGIH 133

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++    +G+WE   + GVE 
Sbjct: 134 RSDRLMREGRWE--PYFGVEL 152


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 57  VFEAASDLVIVGRAGIGVDNIDIEAATENGVIVANAPEGNVRAAAEHTVAMAFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K +++G E 
Sbjct: 117 QAHARLKGGEWAKGDYLGTEL 137


>gi|302865806|ref|YP_003834443.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315502351|ref|YP_004081238.1| d-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
 gi|302568665|gb|ADL44867.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408970|gb|ADU07087.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
          Length = 532

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 119 ASAALKAGEWKRSKYTGVEI 138


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A AR IP
Sbjct: 61  VFEAASDLVIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHTVAMAFASARSIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K +++G E 
Sbjct: 121 QAHARLKTGEWAKGDYLGTEL 141


>gi|171186007|ref|YP_001794926.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoproteus neutrophilus V24Sta]
 gi|170935219|gb|ACB40480.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoproteus neutrophilus V24Sta]
          Length = 311

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 51/82 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ R G+G DNVD+  A + G+VV++ P   + + AE  I LMLA+AR+IP
Sbjct: 61  VIDAGTNLKILARYGVGLDNVDVEYAVKRGLVVVSAPNAPTQSVAELTIGLMLAVARRIP 120

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
           + +     G+W K  ++GVE G
Sbjct: 121 LLSGKVKGGEWPKGRYVGVELG 142


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA +++VV RAG G DN+DL  A+ AGI+V+N P  N+++  EH ++LMLAIAR + 
Sbjct: 257 LLAHAPRLRVVARAGTGVDNIDLQAATEAGILVLNAPGANAVSAGEHTVALMLAIARNLI 316

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +TH G+WE+  F   + 
Sbjct: 317 DANATTHAGRWERKRFRPFDL 337


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A  +KVV RAGIG DNVD+  A+  G++V+N P  N ++ AEHA++L+LA AR IP 
Sbjct: 62  LAAAPNLKVVARAGIGLDNVDVPAATERGVLVVNAPTSNIVSAAEHAVALLLAAARHIPA 121

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S  +G W++  F GVE 
Sbjct: 122 ADASLREGTWKRSKFTGVEV 141


>gi|18976691|ref|NP_578048.1| glyoxylate reductase [Pyrococcus furiosus DSM 3638]
 gi|47115880|sp|Q8U3Y2|GYAR_PYRFU RecName: Full=Glyoxylate reductase
 gi|18892269|gb|AAL80443.1| putative phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM
           3638]
          Length = 336

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A ++++V    +G DN+D+  A+R GI V NTP   +  TA+HA +L+LA AR + 
Sbjct: 61  VFENAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTNATADHAFALLLATARHVV 120

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
             ++    G+W++         F+G E 
Sbjct: 121 KGDKFVRSGEWKRKGIAWHPKWFLGYEL 148


>gi|224060560|ref|XP_002300235.1| predicted protein [Populus trichocarpa]
 gi|118485917|gb|ABK94804.1| unknown [Populus trichocarpa]
 gi|222847493|gb|EEE85040.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+LM A+AR +  A+ S 
Sbjct: 118 RLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALMAAMARNVAQADASV 177

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 178 KAGKWERNKYVGV 190


>gi|317484972|ref|ZP_07943856.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
 gi|316923777|gb|EFV44979.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
          Length = 323

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++ + G G D +D+    R GI++ NTP  NS+  AEH  +L+L   R +P
Sbjct: 67  LLEKLPNLKLIAKLGTGLDMIDIPSVLRRGILLCNTPGANSVAVAEHTFALLLGYLRNVP 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + +   G+WEK   MG E 
Sbjct: 127 QCDNAVRTGQWEKARTMGGEI 147


>gi|224063477|ref|XP_002301163.1| predicted protein [Populus trichocarpa]
 gi|222842889|gb|EEE80436.1| predicted protein [Populus trichocarpa]
          Length = 598

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KAGKWQRSKYVGV 191


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KV+GRAG+G DNVD+  AS+ GI+V NTP  N+I   E  I  M+ I R I 
Sbjct: 56  LLERAKNLKVIGRAGVGVDNVDIETASKKGILVCNTPGANTIGATELTIGHMINIIRTIH 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + +    +WE+ +FMG+E 
Sbjct: 116 KTHNTIMDYRWERHSFMGIEL 136


>gi|260904884|ref|ZP_05913206.1| D-3-phosphoglycerate dehydrogenase [Brevibacterium linens BL2]
          Length = 530

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 52/80 (65%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ AKK++V+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  ++ +LA AR    
Sbjct: 60  IAAAKKLQVIARAGVGLDNVDVPAATSAGVMVVNAPTSNIISAAELTMAHILASARYFGA 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
            N S   G+W++  + GVE 
Sbjct: 120 GNTSLKAGEWKRSKYTGVEL 139


>gi|302186083|ref|ZP_07262756.1| putative hydroxyacid dehydrogenase [Pseudomonas syringae pv.
           syringae 642]
          Length = 325

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPKLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 122 WLDARTRQGHWDKATANGIEL 142


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G W++  ++G E 
Sbjct: 117 QAHGSMRAGAWDRKKYVGNEL 137


>gi|323704756|ref|ZP_08116333.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535682|gb|EGB25456.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 533

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S  K +KV+GRAG G DN+DL+ A+  GI+V+NTP GN I+ AEH I LML+IAR IP
Sbjct: 56  LISKGKNLKVIGRAGNGVDNIDLLAATEKGIIVVNTPEGNIISAAEHTIGLMLSIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G + +  F GVE 
Sbjct: 116 QAYIGAKNGDFRRNKFKGVEL 136


>gi|255538186|ref|XP_002510158.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223550859|gb|EEF52345.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 598

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KSGKWQRSKYVGV 191


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAGDRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G W++  ++G E 
Sbjct: 117 QAHASMRQGAWDRKKYVGNEL 137


>gi|284045014|ref|YP_003395354.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
 gi|283949235|gb|ADB51979.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
          Length = 541

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++    ++V+GRAG+G +NVD+  A+R GIVV N P  N +T AEH ++L+L++AR +P 
Sbjct: 64  IALGTNLRVIGRAGVGVNNVDVPAATRRGIVVANAPQSNVVTAAEHTMALLLSLARNVPQ 123

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S    +WE+  F GVE 
Sbjct: 124 AHRSLTDHRWERSKFGGVEV 143


>gi|224137644|ref|XP_002327177.1| predicted protein [Populus trichocarpa]
 gi|222835492|gb|EEE73927.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR I  A+ S 
Sbjct: 118 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTIAAAEHGIALLTAMARNIAQADASI 177

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 178 KSGKWQRSKYVGV 190


>gi|300783616|ref|YP_003763907.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793130|gb|ADJ43505.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 532

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +   ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR++P
Sbjct: 62  VFAATTQLKVVARAGVGLDNVEVPAATERGVLVVNAPTSNIVSAAEHAVALLLAVARRVP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   G+W++ +F GVE 
Sbjct: 122 AADQSLRGGEWKRSSFSGVEL 142


>gi|15806309|ref|NP_295015.1| D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
 gi|6459038|gb|AAF10861.1|AE001976_4 D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
          Length = 544

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 2/82 (2%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L  A  ++KV+GR G+G DN+DL  ASR G++V+N P  N+++ AE A+  ++A AR +
Sbjct: 73  LLDAAGPRLKVIGRGGVGVDNIDLEYASRRGLLVLNAPESNNVSAAELAVMHLMAAARGL 132

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             ++  T  G+W++  F+G+E 
Sbjct: 133 TRSDRKTRAGEWDRK-FLGLEL 153


>gi|224105607|ref|XP_002313870.1| predicted protein [Populus trichocarpa]
 gi|222850278|gb|EEE87825.1| predicted protein [Populus trichocarpa]
          Length = 543

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +  A+ S 
Sbjct: 64  RLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTIAAAEHGIALLAAMARNVAQADASV 123

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 124 KAGKWQRNKYVGV 136


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R +P
Sbjct: 57  VIAAADRLRIIGRAGVGVDNVDVPAATQRGVLVVNSPEGNTIAAAEHALALLLSLSRHVP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G W++  ++G E 
Sbjct: 117 QAHGSMRSGAWDRKKYVGNEL 137


>gi|296171277|ref|ZP_06852681.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894245|gb|EFG74002.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHAWKRSSFNGTEI 139


>gi|225428898|ref|XP_002285358.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 595

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +  ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 109 VFEASSGRLKVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNV 168

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 169 AQADASVKSGKWQRNKYVGV 188


>gi|326391225|ref|ZP_08212768.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992729|gb|EGD51178.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 324

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A  +K++ R G G DN+D+  A+  GI+V N P  N+++ AEH I+++L +A+Q+ 
Sbjct: 57  VIENAPHLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNNLSVAEHTIAMILNLAKQLS 116

Query: 61  VANESTHKGKW-EKFNFMGVEA 81
           + +++   G W  + + + VE 
Sbjct: 117 LMDKAVRSGNWGARNSNISVEI 138


>gi|242096578|ref|XP_002438779.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
 gi|241917002|gb|EER90146.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
          Length = 613

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 56/82 (68%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR +
Sbjct: 127 VFEAARGRLRVVGRAGVGVDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAMARNV 186

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A+ S   GKW++  ++GV  
Sbjct: 187 AQADASLKAGKWQRSKYVGVTL 208


>gi|255528364|ref|ZP_05395168.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium carboxidivorans P7]
 gi|296187909|ref|ZP_06856302.1| 4-phosphoerythronate dehydrogenase [Clostridium carboxidivorans P7]
 gi|255507940|gb|EET84376.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium carboxidivorans P7]
 gi|296047530|gb|EFG86971.1| 4-phosphoerythronate dehydrogenase [Clostridium carboxidivorans P7]
          Length = 309

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 1   MLSHAKK--MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++  AK   +K++ R G+G DN+D+  A   GI V NTP  +S + AE AI  M A+ R 
Sbjct: 57  LIDEAKNGELKLIIRGGVGVDNIDVEYARENGIEVRNTPNASSASVAELAIGHMFALTRY 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I ++N +   GKWEK  + GVE 
Sbjct: 117 INISNITMRDGKWEKKKYKGVEL 139


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + +VGRAGIG DN+D+  A+ AG++V N P GN    +EH +++  A AR IP
Sbjct: 57  VLDAASDLVIVGRAGIGVDNIDIDAATDAGVIVANAPEGNVRAASEHTVAMTFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K  F+G E 
Sbjct: 117 QAHTRLKGGEWAKGEFLGTEL 137


>gi|15827900|ref|NP_302163.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae TN]
 gi|221230377|ref|YP_002503793.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae Br4923]
 gi|3122862|sp|O33116|SERA_MYCLE RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2414551|emb|CAB16440.1| phosphoglycerate dehydrogenase [Mycobacterium leprae]
 gi|13093453|emb|CAC30645.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae]
 gi|219933484|emb|CAR71787.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae Br4923]
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQI 
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S     W++ +F G E 
Sbjct: 119 EADASLRAHIWKRSSFSGTEI 139


>gi|297844730|ref|XP_002890246.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gi|297336088|gb|EFH66505.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
          Length = 613

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   AK +MKVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+  +AR +
Sbjct: 138 VFEAAKGRMKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLACMARNV 197

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKWE+  ++GV
Sbjct: 198 AQADASIKAGKWERSKYVGV 217


>gi|150020020|ref|YP_001305374.1| phosphoglycerate dehydrogenase [Thermosipho melanesiensis BI429]
 gi|149792541|gb|ABR29989.1| Phosphoglycerate dehydrogenase [Thermosipho melanesiensis BI429]
          Length = 303

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K++K++ RAG G DNVD+  A   GI V+NTP  N I+ AE AI LM+A AR I 
Sbjct: 56  VIEAGKRLKIIARAGTGLDNVDVEKAKEKGIKVLNTPGANGISVAELAIGLMIACARHIA 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   G+W K    G E 
Sbjct: 116 KGTLDLKSGEWTKKQLKGHEL 136


>gi|313679957|ref|YP_004057696.1| d-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
 gi|313152672|gb|ADR36523.1| D-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
          Length = 520

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+GR G+G DN+DL  ASR GI+V+N P  N+ + AE A  LML+ AR + 
Sbjct: 55  LLERAERLKVIGRGGVGVDNIDLDAASRRGILVINVPEANTRSAAELAFGLMLSAARLVA 114

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +++    +G+W +   +G E 
Sbjct: 115 LSDRELREGRWNRK-HLGREL 134


>gi|260889453|ref|ZP_05900716.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
 gi|260860864|gb|EEX75364.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
          Length = 530

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 53/80 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+VGRAG GTDN+++  A+  G++V NTP  N+++  E AI LMLA AR I 
Sbjct: 59  LLDKAKNLKIVGRAGNGTDNINIPEATAHGVIVANTPDSNTVSACEIAIGLMLASARNIV 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
            AN     GKWE+  F+G E
Sbjct: 119 AANNFIKSGKWEREIFVGSE 138


>gi|149199039|ref|ZP_01876079.1| SerA [Lentisphaera araneosa HTCC2155]
 gi|149137828|gb|EDM26241.1| SerA [Lentisphaera araneosa HTCC2155]
          Length = 522

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K V RAG G + +D+  A    I VMNTP  NS   AE A+ +M++ AR   
Sbjct: 58  VIDLFPNLKAVVRAGAGYNTIDIQYARSKDITVMNTPGANSNAVAEEAVGMMISCARFFI 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + ST  G+W+K    G E 
Sbjct: 118 EGDRSTRAGEWKKAQLQGFEL 138


>gi|219559028|ref|ZP_03538104.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T17]
 gi|289571195|ref|ZP_06451422.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
 gi|289544949|gb|EFD48597.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|330981806|gb|EGH79909.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 272

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 122 WLDARTRQGHWDKATANGIEL 142


>gi|330955157|gb|EGH55417.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae Cit 7]
          Length = 325

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 122 WLDARTRQGHWDKATANGIEL 142


>gi|330901374|gb|EGH32793.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 325

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 122 WLDARTRQGHWDKATANGIEL 142


>gi|289674179|ref|ZP_06495069.1| putative hydroxyacid dehydrogenase [Pseudomonas syringae pv.
           syringae FF5]
          Length = 267

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++ARQI 
Sbjct: 62  MIEASPRLKAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARQIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 122 WLDARTRQGHWDKATANGIEL 142


>gi|254365629|ref|ZP_04981674.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
 gi|134151142|gb|EBA43187.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|60594358|pdb|1YGY|B Chain B, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|313507314|pdb|3DC2|A Chain A, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
 gi|313507315|pdb|3DC2|B Chain B, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
          Length = 529

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 60  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 120 AADASLREHTWKRSSFSGTEI 140


>gi|15842552|ref|NP_337589.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31794172|ref|NP_856665.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis AF2122/97]
 gi|57117042|ref|YP_177916.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Rv]
 gi|121638877|ref|YP_979101.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148662846|ref|YP_001284369.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148824186|ref|YP_001288940.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis F11]
 gi|167967839|ref|ZP_02550116.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis H37Ra]
 gi|215404980|ref|ZP_03417161.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           02_1987]
 gi|215428447|ref|ZP_03426366.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T92]
 gi|215431947|ref|ZP_03429866.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           EAS054]
 gi|224991369|ref|YP_002646058.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253797911|ref|YP_003030912.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|254233079|ref|ZP_04926406.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|254552073|ref|ZP_05142520.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260188020|ref|ZP_05765494.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CPHL_A]
 gi|260202137|ref|ZP_05769628.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|260206320|ref|ZP_05773811.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis K85]
 gi|289444561|ref|ZP_06434305.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289448668|ref|ZP_06438412.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289553214|ref|ZP_06442424.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289575703|ref|ZP_06455930.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289746800|ref|ZP_06506178.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289751673|ref|ZP_06511051.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289755114|ref|ZP_06514492.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|294993916|ref|ZP_06799607.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis 210]
 gi|297635621|ref|ZP_06953401.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           4207]
 gi|297732619|ref|ZP_06961737.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           R506]
 gi|306777289|ref|ZP_07415626.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|306781200|ref|ZP_07419537.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|306785839|ref|ZP_07424161.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|306789879|ref|ZP_07428201.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|306794690|ref|ZP_07432992.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|306798933|ref|ZP_07437235.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|306804778|ref|ZP_07441446.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|306969070|ref|ZP_07481731.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|306973407|ref|ZP_07486068.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|307081115|ref|ZP_07490285.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|307085720|ref|ZP_07494833.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|313659951|ref|ZP_07816831.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           V2475]
 gi|61242571|sp|P0A544|SERA_MYCTU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|61242577|sp|P0A545|SERA_MYCBO RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|13882863|gb|AAK47403.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31619767|emb|CAD96707.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium bovis AF2122/97]
 gi|41352771|emb|CAE55535.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium tuberculosis H37Rv]
 gi|121494525|emb|CAL73006.1| Probable D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|124602138|gb|EAY61148.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|148506998|gb|ABQ74807.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148722713|gb|ABR07338.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis F11]
 gi|224774484|dbj|BAH27290.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253319414|gb|ACT24017.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|289417480|gb|EFD14720.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289421626|gb|EFD18827.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289437846|gb|EFD20339.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289540134|gb|EFD44712.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289687328|gb|EFD54816.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289692260|gb|EFD59689.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289695701|gb|EFD63130.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|308214339|gb|EFO73738.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|308325983|gb|EFP14834.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|308329514|gb|EFP18365.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|308333653|gb|EFP22504.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|308337010|gb|EFP25861.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|308340824|gb|EFP29675.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|308348637|gb|EFP37488.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|308353362|gb|EFP42213.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|308357207|gb|EFP46058.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|308361161|gb|EFP50012.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|308364754|gb|EFP53605.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|323718375|gb|EGB27549.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CDC1551A]
 gi|326904610|gb|EGE51543.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis W-148]
 gi|328457686|gb|AEB03109.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 4207]
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|254520812|ref|ZP_05132868.1| D-isomer specific 2-hydroxyacid dehydrogenase [Clostridium sp.
           7_2_43FAA]
 gi|226914561|gb|EEH99762.1| D-isomer specific 2-hydroxyacid dehydrogenase [Clostridium sp.
           7_2_43FAA]
          Length = 308

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 1   MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           +L  A   K+K++ RAG+G DN+D+  A   GI V NTP  +S + AE A++ M A+AR 
Sbjct: 64  VLEKASGGKLKLIIRAGVGIDNIDIYTAHEKGITVKNTPNASSDSVAELALAHMFAVARF 123

Query: 59  IPVANESTHKGKWEKFNFMGVEAG 82
           +  +N +   G+W K  + G+E G
Sbjct: 124 VGTSNYTMRNGEWNKKKYEGIELG 147


>gi|320101099|ref|YP_004176691.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfurococcus mucosus DSM 2162]
 gi|319753451|gb|ADV65209.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfurococcus mucosus DSM 2162]
          Length = 316

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++++ RAG+G DN+D+  A   GI V+N P  ++++ AE A+ LM+++AR+I 
Sbjct: 63  VIYSADSLRIIARAGVGLDNIDVEAARERGIEVINAPASSTMSVAELAVGLMISVARKIA 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++     G+W K + +GVE 
Sbjct: 123 FSDRRMRMGEWPKKHAVGVEL 143


>gi|308375950|ref|ZP_07445640.2| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
 gi|308344687|gb|EFP33538.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
          Length = 526

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 57  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 117 AADASLREHTWKRSSFSGTEI 137


>gi|289741575|gb|ADD19535.1| D-3-phosphoglycerate dehydrogenase [Glossina morsitans morsitans]
          Length = 332

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   K  +K +GRAG G DN+D+  A++  ++V+NTP GNSI+  E    L+  +AR +
Sbjct: 62  VLEAGKGSLKAIGRAGAGVDNIDVAAATKNNVIVLNTPGGNSISACELTCILIGNLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VHAAQSMKEGRWDRKLYTGNEL 143


>gi|238063230|ref|ZP_04607939.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
 gi|237885041|gb|EEP73869.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
          Length = 532

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATARGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 119 ASAALKAGEWKRSKYTGVEV 138


>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
 gi|194368790|pdb|3DDN|B Chain B, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
          Length = 528

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   AKK+KV+GRAG G DN+DL  A++ GI+V+NTP  N I+ AEH I L+LA  R   
Sbjct: 61  LYDAAKKLKVIGRAGNGVDNIDLDGATKRGIIVVNTPEANIISAAEHTIGLLLASCRNTV 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+   +G WE+ +  G E 
Sbjct: 121 RANKMLEEGIWERKDLKGSEL 141


>gi|86140932|ref|ZP_01059491.1| D-3-phosphoglycerate dehydrogenase [Leeuwenhoekiella blandensis
           MED217]
 gi|85832874|gb|EAQ51323.1| D-3-phosphoglycerate dehydrogenase [Leeuwenhoekiella blandensis
           MED217]
          Length = 299

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K + R G G +++D+  A   GI ++  P GN     EHA+ ++L +  ++ 
Sbjct: 45  FLDAATNLKFIARVGAGLESIDIPYAESKGIALIAAPEGNRNAVGEHALGMLLMLFNKLK 104

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W +    G+E 
Sbjct: 105 QADAEVRSGQWNREKNRGLEL 125


>gi|145591937|ref|YP_001153939.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pyrobaculum arsenaticum DSM 13514]
 gi|145283705|gb|ABP51287.1| D-3-phosphoglycerate dehydrogenase [Pyrobaculum arsenaticum DSM
           13514]
          Length = 307

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +K++ R G+G DNVD+  A + GI V++ P   + + AE  I+L+ ++AR++ 
Sbjct: 57  IIDAGRSLKILARYGVGLDNVDVEYAVKRGISVVSAPNSPTRSVAELTIALIFSVARRVT 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G+W K  ++G+E 
Sbjct: 117 LFDRKVKAGEWPKGKYIGMEL 137


>gi|307595453|ref|YP_003901770.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
 gi|307550654|gb|ADN50719.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
          Length = 311

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++V+ RAG+G DN+D+  A   GI V+N P G++ + AE  I LM+A AR + 
Sbjct: 58  VIDAAGRLRVIARAGVGLDNIDVDYARLRGIEVINAPEGSTQSVAELTIGLMIAAARLVA 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G+W K  ++G E 
Sbjct: 118 LQDRLVKGGEWPKGKYVGSEL 138


>gi|211906486|gb|ACJ11736.1| phosphoglycerate dehydrogenase [Gossypium hirsutum]
          Length = 602

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A+ S 
Sbjct: 123 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTVAAAEHGIALLAAMARNVAQADASV 182

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 183 KAGKWQRNKYVGV 195


>gi|255555301|ref|XP_002518687.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223542068|gb|EEF43612.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 596

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +  A+ S 
Sbjct: 117 RLKVVGRAGVGIDNVDLSAATEHGCLVVNAPTANTVAAAEHGIALLAAMARNVAQADASV 176

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 177 KAGKWQRNKYVGV 189


>gi|289759122|ref|ZP_06518500.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T85]
 gi|289714686|gb|EFD78698.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T85]
          Length = 193

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA +RQIP
Sbjct: 40  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIP 99

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 100 AADASLREHTWKRSSFSGTEI 120


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++VV RAG G DN+D+  A+ AGI+V+N P  N+++  EH I+L+LA+ RQIP
Sbjct: 252 VLAAGPSLRVVARAGTGVDNIDVQGATEAGILVLNAPGANAVSAGEHTIALLLALTRQIP 311

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN + H G+WE+  F   + 
Sbjct: 312 DANAAVHAGRWERKRFKPFDL 332


>gi|325108946|ref|YP_004270014.1| phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM 5305]
 gi|324969214|gb|ADY59992.1| Phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM 5305]
          Length = 326

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++V+ R G+G D +DL   +   +VV  TP  N    AEHAI+L++ +AR  P
Sbjct: 62  VLDALPQLRVIARTGVGFDAIDLAACAERNVVVTTTPGVNHHAVAEHAIALLMGVARGFP 121

Query: 61  VANESTHKGKWEKFNF---MGVEAG 82
             +    +G W++FN    MG   G
Sbjct: 122 DRDRLVREGNWQRFNTPRVMGSTLG 146


>gi|269839091|ref|YP_003323783.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790821|gb|ACZ42961.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 314

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++V+GR G+G DN+DL  A   G+ V+ TP  N+ + AEHA+ +MLA+A+++ 
Sbjct: 59  VLEAADSLRVIGRHGVGLDNIDLEAARELGVAVVYTPLANAESVAEHAVGMMLALAKRLR 118

Query: 61  VANESTHKGKW-EKFNFMGVEA 81
             + +  +G+W  +++  G E 
Sbjct: 119 EGDAALRRGEWGARYSLTGREL 140


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/81 (50%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S  K +KV+GRAG G DN+DL+ A+  GI+V+NTP GN I+ AEH I LML+IAR IP
Sbjct: 56  LISKGKNLKVIGRAGNGVDNIDLLAATEKGIIVVNTPEGNIISAAEHTIGLMLSIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G + +  F GVE 
Sbjct: 116 QAYNGAINGDFRRNKFKGVEL 136


>gi|254780152|ref|YP_003064565.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254039829|gb|ACT56625.1| D-3-phosphoglycerate dehydrogenase [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 82

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
          MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP
Sbjct: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60

Query: 61 VANESTHKGKWEKFNFMGVEAG 82
          VANESTHKGKWEKFNFMGVEAG
Sbjct: 61 VANESTHKGKWEKFNFMGVEAG 82


>gi|167040546|ref|YP_001663531.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300914590|ref|ZP_07131906.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter sp. X561]
 gi|307724176|ref|YP_003903927.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter sp. X513]
 gi|166854786|gb|ABY93195.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|300889525|gb|EFK84671.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter sp. X561]
 gi|307581237|gb|ADN54636.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter sp. X513]
          Length = 324

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A  +K++ R G G DN+D+  A+  GI+V N P  N+++ AEH I+++L +++Q+ 
Sbjct: 57  VIENAPHLKIISRTGAGVDNIDVNAATEKGILVCNLPAVNNLSVAEHTIAMILNLSKQLS 116

Query: 61  VANESTHKGKW-EKFNFMGVEA 81
           + +++   G W  + + + VE 
Sbjct: 117 LMDKAVRSGNWGARNSNISVEI 138


>gi|145224813|ref|YP_001135491.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315445143|ref|YP_004078022.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
 gi|145217299|gb|ABP46703.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315263446|gb|ADU00188.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
          Length = 528

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSTARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++  F G E 
Sbjct: 119 AADATLREHTWKRSAFSGTEI 139


>gi|239618528|ref|YP_002941850.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507359|gb|ACR80846.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
          Length = 307

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K+KVVGRAG+G DNVD+  A   GI V NTP  N+I+ AE  I L++A+ RQIP
Sbjct: 58  ILKAGTKLKVVGRAGVGLDNVDVSTAKELGIRVYNTPGANAISAAELTIGLLIALMRQIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                  +GKWEK    G E 
Sbjct: 118 RGTNGLKEGKWEKKKLKGHEI 138


>gi|254819120|ref|ZP_05224121.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium intracellulare
           ATCC 13950]
          Length = 528

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|218884168|ref|YP_002428550.1| phosphoglycerate dehydrogenase [Desulfurococcus kamchatkensis
           1221n]
 gi|218765784|gb|ACL11183.1| phosphoglycerate dehydrogenase [Desulfurococcus kamchatkensis
           1221n]
          Length = 313

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +  +KV+ RAG+G DN+D+  A   GI V+N P  +S++ AE A+ LM+A+AR+I 
Sbjct: 62  VIESSDVLKVIARAGVGLDNIDVEAAKARGIEVINAPASSSVSVAELAVGLMIAVARKIA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++     G+W K   MG+E 
Sbjct: 122 FSDRRMRLGEWPKKQAMGIEL 142


>gi|154248802|ref|YP_001409627.1| phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
 gi|154152738|gb|ABS59970.1| Phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
          Length = 303

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+K++GRAG G DN+D+ VA   GI V+NTP  NSI+ AE  I LM+A +R I 
Sbjct: 57  IIEAGTKLKIIGRAGTGLDNIDVKVAEAKGIKVINTPGANSISVAELTIGLMIACSRHIA 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   GKW K    G E 
Sbjct: 117 RGTIDLKNGKWTKKELEGHEL 137


>gi|15893313|ref|NP_346662.1| D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum ATCC
           824]
 gi|15022834|gb|AAK78002.1|AE007515_2 D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum ATCC
           824]
 gi|325507422|gb|ADZ19058.1| D-3-phosphoglycerate dehydrogenase [Clostridium acetobutylicum EA
           2018]
          Length = 305

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 4/85 (4%)

Query: 1   MLSHAK----KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           ++  A     K+K++ RAG+G DN+D+  A   G+ V NTP  +S + AE AI  M A++
Sbjct: 57  VIDAATVKGAKLKLIIRAGVGVDNIDVTYARDKGLTVNNTPNASSASVAELAIGHMFAVS 116

Query: 57  RQIPVANESTHKGKWEKFNFMGVEA 81
           R I  AN +  +GKWEK  + G E 
Sbjct: 117 RFINTANVTMRQGKWEKKAYTGTEI 141


>gi|27413666|gb|AAO11839.1| phosphoglycerate dehydrogenase [Bacillus coagulans]
          Length = 314

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K + + G G DN+D   A   GI V NTP  N+   A+ AI LMLA AR IP
Sbjct: 63  IIDAAPNLKYIMKFGAGYDNIDFKYAREKGIPVTNTPGQNADAVADLAIGLMLATARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             NE    G WE    MG+E 
Sbjct: 123 AKNEELRNGNWELS--MGIEI 141


>gi|23099741|ref|NP_693207.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22777971|dbj|BAC14242.1| glycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 314

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K + + G G DN+D   A   GI V NTP  N+   A+ AI LMLA AR IP
Sbjct: 63  IIDAAPNLKYIMKFGAGYDNIDFKYAREKGIPVTNTPGQNADAVADLAIGLMLATARNIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             NE    G WE    MG+E 
Sbjct: 123 AKNEELRNGNWELS--MGIEI 141


>gi|159468538|ref|XP_001692431.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
 gi|158278144|gb|EDP03909.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
          Length = 587

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ A+AR IP A+ S 
Sbjct: 102 RLKVVGRAGVGVDNVDLAAATEAGCLVVNAPTANTVAAAEHGIALLCAMARNIPQADASM 161

Query: 67  HKGKWEKFNFMGV 79
             G W++  ++G 
Sbjct: 162 KAGSWDRSAYVGT 174


>gi|257871175|ref|ZP_05650828.1| phosphoglycerate dehydrogenase [Enterococcus gallinarum EG2]
 gi|257805339|gb|EEV34161.1| phosphoglycerate dehydrogenase [Enterococcus gallinarum EG2]
          Length = 315

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +    ++KV+ + G+GTDN+D+  A   GI V  T   NSI  AEH ++L+ + ++ I 
Sbjct: 63  FIDQCPQLKVICKFGVGTDNIDVAYAESKGIYVGRTIGSNSIAVAEHVMALIYSESKNIY 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                  +G+W+K    G E 
Sbjct: 123 ETVREVKEGEWQK--PTGREL 141


>gi|16119626|ref|NP_396332.1| putative phosphoglycerate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
 gi|15162196|gb|AAK90773.1| putative phosphoglycerate dehydrogenase [Agrobacterium tumefaciens
           str. C58]
          Length = 317

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + + A ++K + R G+G DN+D+  A R GI V N P GN+   AE  + L+L+  R+IP
Sbjct: 65  VFNLAPRLKAIARFGVGVDNIDIDAAHRHGIAVTNAPGGNANAVAELTLGLILSAMRRIP 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +++   G W++  F+G E 
Sbjct: 125 YLHDALRGGAWDR--FVGQEL 143


>gi|18313986|ref|NP_560653.1| D-3-phosphoglycerate dehydrogenase (serA) [Pyrobaculum aerophilum
           str. IM2]
 gi|18161561|gb|AAL64835.1| D-3-phosphoglycerate dehydrogenase (serA) [Pyrobaculum aerophilum
           str. IM2]
          Length = 307

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +K++ R G+G DNVD+  A + GI V++ P   S + AE  I L+ ++AR+IP
Sbjct: 57  IMDAGQNLKILARYGVGLDNVDVEYAVKKGIAVVSAPNAPSQSVAELTIGLLFSVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + N     G+W K  ++G+E 
Sbjct: 117 LLNAKVKAGEWPKGKYIGIEI 137


>gi|240849475|ref|NP_001155671.1| D-3-phosphoglycerate dehydrogenase [Acyrthosiphon pisum]
 gi|239799336|dbj|BAH70594.1| ACYPI006664 [Acyrthosiphon pisum]
          Length = 335

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 55/83 (66%), Gaps = 2/83 (2%)

Query: 1   MLSHAKK--MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++    +  +KV+GRAG G DN+DL  A+ AGI+V+NTP GNS +  E   SL+L++AR 
Sbjct: 67  VIEAGAQYGLKVIGRAGTGVDNIDLDSATNAGILVLNTPGGNSNSACELTCSLILSLARN 126

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           +P   +S  +G+W++  +MG E 
Sbjct: 127 VPQGCQSLKEGRWDRKLYMGTEI 149


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+L+++R IP
Sbjct: 57  IIEAGVNLKIIGRAGVGVDNVDVPAATKRGVIVVNSPGGNTIAAAEHALALLLSLSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  GKW++  F+G E 
Sbjct: 117 QAHLSTISGKWDRKKFVGNEL 137


>gi|303311837|ref|XP_003065930.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105592|gb|EER23785.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039874|gb|EFW21808.1| D-3-phosphoglycerate dehydrogenase [Coccidioides posadasii str.
           Silveira]
          Length = 589

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LMLA AR+I 
Sbjct: 66  VLQTAKNLKVVARAGVGVDNVDVDTATKLGIVVVNSPAGNVGAAAEHTIALMLATARKIS 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+  F+GVE 
Sbjct: 126 HACSSLKGDKWERSKFVGVEV 146


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 52/79 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D   A+R GIVVMNTP GN+ +TAE  I+LM+A+AR I 
Sbjct: 59  VLKGQPRLKAIVRAGVGVDNIDRAAATREGIVVMNTPAGNTTSTAEQTIALMMALARNIG 118

Query: 61  VANESTHKGKWEKFNFMGV 79
            A  +  +GKWE+    G 
Sbjct: 119 PAYATMKEGKWERKKLTGT 137


>gi|291280499|ref|YP_003497334.1| D-isomer specific 2-hydroxyacid dehydrogenase catalytic component
           [Deferribacter desulfuricans SSM1]
 gi|290755201|dbj|BAI81578.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic component
           [Deferribacter desulfuricans SSM1]
          Length = 316

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A  +KVV    +G +N+D+  A++ G+VV NTP   + TTAE   +LM+++AR++ 
Sbjct: 58  LFDNAPNLKVVANYAVGYNNIDVEYATKKGVVVCNTPDVLTETTAELGFALMISLARRVV 117

Query: 61  VANESTHKGK---WEKFNFMGVEA 81
            A++ T +GK   W    F+G + 
Sbjct: 118 EADKFTREGKFEGWTPNLFLGTDL 141


>gi|94442940|emb|CAJ91152.1| D-3-phosphoglycerate dehydrogenase [Platanus x acerifolia]
          Length = 223

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +K ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 138 VFEASKGRLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALLASMARNV 197

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 198 AQADASIKAGKWQRNKYVGV 217


>gi|297622551|ref|YP_003703985.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
 gi|297163731|gb|ADI13442.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
          Length = 524

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 53/81 (65%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GR G+G DN+D+  ASR GI+V+N P  N+++ AE  I+LML  AR + 
Sbjct: 56  LIRAAARLKVIGRGGVGVDNIDIAAASRRGILVLNAPESNNVSAAELTIALMLCAARGVS 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++     GKW++  F+G E 
Sbjct: 116 RSDRLIRAGKWDRK-FLGREV 135


>gi|226355874|ref|YP_002785614.1| D-3-phosphoglycerate dehydrogenase [Deinococcus deserti VCD115]
 gi|226317864|gb|ACO45860.1| putative Phosphoglycerate dehydrogenase [Deinococcus deserti
           VCD115]
          Length = 544

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 54/82 (65%), Gaps = 2/82 (2%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++  A  ++KV+GR G+G DN+DL  AS  G++V+N P  N+++ AE A+  ++A AR +
Sbjct: 72  LIDAAGPRLKVIGRGGVGVDNIDLEYASLRGLLVLNAPESNNVSAAELAVMHLMASARGL 131

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             ++  T  G+W++  ++G+E 
Sbjct: 132 TRSDRKTRAGEWDRK-YLGMEL 152


>gi|116789697|gb|ABK25346.1| unknown [Picea sitchensis]
          Length = 622

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 52/73 (71%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +P A+ S 
Sbjct: 143 RLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTVAAAEHGIALIASMARNVPQASASM 202

Query: 67  HKGKWEKFNFMGV 79
             GKW++  F+GV
Sbjct: 203 KAGKWQRNKFVGV 215


>gi|330989740|gb|EGH87843.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 327

 Score = 81.8 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K++ + G+G D +D+  A+  G+ V      N+ + AEHA +LM ++ARQ  
Sbjct: 62  MIQASPKLKIIAKHGVGYDTIDIQAAAEQGVPVTIALGANAQSVAEHAFALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W+K    G E 
Sbjct: 122 ALDARMRAGHWDKTTANGTEL 142


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score = 81.8 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 51/81 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++ +VGRAGIG DN+D+  A+  G++V N P GN    +EH +++  A AR IP
Sbjct: 57  VLEAAEELAIVGRAGIGVDNIDIDAATDEGVIVANAPEGNVRAASEHTVAMTFAAARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K +++G E 
Sbjct: 117 QAHIRLKNGEWAKGDYLGAEL 137


>gi|257487625|ref|ZP_05641666.1| putative hydroxyacid dehydrogenase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331013107|gb|EGH93163.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 327

 Score = 81.8 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K++ + G+G D +D+  A+  G+ V      N+ + AEHA +LM ++ARQ  
Sbjct: 62  MIQASPKLKIIAKHGVGYDTIDIQAAAEQGVPVTIALGANAQSVAEHAFALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W+K    G E 
Sbjct: 122 ALDARMRAGHWDKTTANGTEL 142


>gi|329765660|ref|ZP_08257232.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           domain-containing protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329137852|gb|EGG42116.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           domain-containing protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 310

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K K++ R G+G DNVD V A    I V+N   G     AE  + LML++ARQ  
Sbjct: 61  IIEKADKCKIIARVGVGLDNVDQVAAKEKNIRVINAAEGAMNAVAELVLGLMLSLARQTA 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + +   G+W K    G E 
Sbjct: 121 RGDRAIRNGQWLKNELKGTEL 141


>gi|319953421|ref|YP_004164688.1| phosphoglycerate dehydrogenase [Cellulophaga algicola DSM 14237]
 gi|319422081|gb|ADV49190.1| Phosphoglycerate dehydrogenase [Cellulophaga algicola DSM 14237]
          Length = 313

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K +GR G G +N+D   A   GI +   P GN     EH + ++L++   + 
Sbjct: 57  FLEKATNLKFIGRLGAGLENIDTDYAKDRGIFLAAAPEGNRNAVGEHTLGMLLSLFNNLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    GKW++    G+E 
Sbjct: 117 KADQEVRHGKWDREGNRGIEL 137


>gi|168014318|ref|XP_001759699.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689238|gb|EDQ75611.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +K K+KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 85  VFEASKGKLKVVGRAGVGIDNVDLEAATELGCLVVNAPTANTVAAAEHGIALLTAMARNV 144

Query: 60  PVANESTHKGKWEKFNFMGV 79
             ++ S   GKWE+  ++GV
Sbjct: 145 APSDSSMKSGKWERNKYVGV 164


>gi|159036772|ref|YP_001536025.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
 gi|157915607|gb|ABV97034.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
          Length = 531

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATTRGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 119 ASTALKAGEWKRSKYTGVEV 138


>gi|295394378|ref|ZP_06804602.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972730|gb|EFG48581.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 527

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 49/80 (61%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNV++  A+RAG++V+N P  N I+ AE  ++ +L  AR    
Sbjct: 59  IAAAPELKVIARAGVGLDNVEIPAATRAGVMVVNAPTSNIISAAELTMAHILGSARNYGA 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
            + S   G+W +    GVE 
Sbjct: 119 GHASLKAGEWNRSKLSGVEL 138


>gi|149277462|ref|ZP_01883603.1| phosphoglycerate dehydrogenase [Pedobacter sp. BAL39]
 gi|149231695|gb|EDM37073.1| phosphoglycerate dehydrogenase [Pedobacter sp. BAL39]
          Length = 309

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+K + RAG G DN+D  VA    I ++N P GN     EHA+ LML++     
Sbjct: 60  LIDAGTKLKFIARAGAGLDNIDEAVALERNIHLINAPEGNMDAVGEHAVGLMLSLMNNFR 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    KGKW++    G E 
Sbjct: 120 NADMEIRKGKWDREGNRGYEL 140


>gi|330892127|gb|EGH24788.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 327

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + K+K++ + G+G D +D+  A+  G+ V      N+ + AEHA +LM ++ARQ  
Sbjct: 62  MIQASPKLKIIAKHGVGYDTIDIQAAAEQGVPVTIALGANAQSVAEHAFALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G WEK    G E 
Sbjct: 122 ALDARMRAGHWEKTTANGTEL 142


>gi|302524967|ref|ZP_07277309.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
 gi|302433862|gb|EFL05678.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
          Length = 532

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+LA+AR++P
Sbjct: 62  VLGATTQLKVVARAGVGLDNVEVPAATERGVLVVNAPTSNIVSAAEHAVALLLAVARRVP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++S   G+W++ +F GVE 
Sbjct: 122 AADQSLRGGEWKRSSFSGVEI 142


>gi|308081353|ref|NP_001183055.1| hypothetical protein LOC100501398 [Zea mays]
 gi|238009062|gb|ACR35566.1| unknown [Zea mays]
          Length = 598

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 119 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 178

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 179 KAGKWQRNKYVGV 191


>gi|224034059|gb|ACN36105.1| unknown [Zea mays]
          Length = 612

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 133 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 192

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 193 KAGKWQRNKYVGV 205


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  + +VGRAGIG DN+D+  A+  G++V N P GN    AEH++++  A AR IP
Sbjct: 57  VLSAAPDLVIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHSVAMAFATARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E    G+W K +++G E 
Sbjct: 117 QAHERLTGGEWAKGDYLGTEV 137


>gi|312892423|ref|ZP_07751918.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Mucilaginibacter paludis DSM 18603]
 gi|311295207|gb|EFQ72381.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Mucilaginibacter paludis DSM 18603]
          Length = 309

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++ + R G G DN+D   A +  I ++N P GN     EHA+ ++L +   I 
Sbjct: 59  VLDIATNLRFICRGGAGMDNIDEAYALQKNITLINAPEGNMDAVGEHAVGMLLNLMNNIN 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W++    G E 
Sbjct: 119 RADAEVRAGLWKREANRGYEL 139


>gi|302503639|ref|XP_003013779.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
 gi|291177345|gb|EFE33139.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
          Length = 575

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/85 (44%), Positives = 56/85 (65%), Gaps = 4/85 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNV----DLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           +L  A K+KVV RAG+G DN+    D+  A++ GIVV+N+P GN++  AEH I+L++ +A
Sbjct: 68  VLQAASKLKVVARAGVGVDNIVTPEDVDAATKQGIVVVNSPSGNNVAAAEHTIALLMCMA 127

Query: 57  RQIPVANESTHKGKWEKFNFMGVEA 81
           R IP A  S    +WE+   +GVE 
Sbjct: 128 RNIPDACSSLKSNQWERSRLVGVEV 152


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+GTDN++L  A+R GIVVMNTP GN+ +TAEH I++M+A++R I 
Sbjct: 59  ILKDQPRLKAIVRAGVGTDNINLPAATREGIVVMNTPAGNTTSTAEHTIAMMMALSRNIA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G W++ +F G + 
Sbjct: 119 PAASKLRDGVWDRKSFTGTQL 139


>gi|119193730|ref|XP_001247470.1| hypothetical protein CIMG_01241 [Coccidioides immitis RS]
          Length = 585

 Score = 81.8 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/81 (51%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+KVV RAG+G DNVD+  A++ GIVV+N+P GN    AEH I+LM+  AR+I 
Sbjct: 66  VLQTAKKLKVVARAGVGVDNVDVDTATKLGIVVVNSPAGNVGAAAEHTIALMMGTARKIS 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S    KWE+  F+GVE 
Sbjct: 126 HACSSLKGDKWERSKFVGVEV 146


>gi|289622714|emb|CBI50983.1| unnamed protein product [Sordaria macrospora]
          Length = 623

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 53/77 (68%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
             ++V+ RAG+G DN+D+  A++ GI+V+N+P GN    AEH ++L+LA+AR I  A+  
Sbjct: 84  PNLRVIARAGVGVDNIDVEAATKRGIIVVNSPHGNIAAAAEHTLALLLALARNIGRADTG 143

Query: 66  THKGKWEKFNFMGVEAG 82
             +G+WE+   +GVE G
Sbjct: 144 MKQGRWERSKLVGVEVG 160


>gi|150020784|ref|YP_001306138.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosipho melanesiensis BI429]
 gi|149793305|gb|ABR30753.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosipho melanesiensis BI429]
          Length = 318

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +   K +K++    +G +N+D+  A + GI V NTP   +  TA+ A +L+LA+AR+I 
Sbjct: 59  FIDAGKNLKIIANYAVGYNNIDVEYAKKKGIYVTNTPDVLTEATADIAWALILAVARKII 118

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            A++   +GK+E +    F+G E 
Sbjct: 119 PADKFVREGKFEGWKPHLFLGHEI 142


>gi|217074366|gb|ACJ85543.1| unknown [Medicago truncatula]
          Length = 473

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +    K K+KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +
Sbjct: 144 VFEAGKGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNV 203

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW +  ++GV
Sbjct: 204 SQADASLKAGKWLRSKYVGV 223


>gi|217070860|gb|ACJ83790.1| unknown [Medicago truncatula]
          Length = 229

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +    K K+KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ A+AR +
Sbjct: 144 VFEAGKGKLKVVGRAGVGIDNVDLQAATEFGCLVVNAPTANTIAAAEHGIALLAAMARNV 203

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW +  ++GV
Sbjct: 204 SQADASLKAGKWLRSKYVGV 223


>gi|324513534|gb|ADY45559.1| D-3-phosphoglycerate dehydrogenase [Ascaris suum]
          Length = 504

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++   + K+K++GRAG G DN+DL  A+  GI+VMNTP GNS + AE     +L++AR +
Sbjct: 61  IIEAVSGKLKLIGRAGTGIDNIDLAAATEYGIIVMNTPAGNSRSAAELTCVCILSLARHL 120

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P A  S   GKW +  +MG E 
Sbjct: 121 PQAVASMKAGKWARKEYMGEEV 142


>gi|326490081|dbj|BAJ94114.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504998|dbj|BAK02886.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR +
Sbjct: 127 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAMARNV 186

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 187 AQADASLKSGKWQRSKYVGV 206


>gi|315425645|dbj|BAJ47304.1| D-3-phosphoglycerate dehydrogenase [Candidatus Caldiarchaeum
           subterraneum]
          Length = 310

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++      +KVVGRAG+G DNVDL  A+R G+ V+NTP  ++ + AE  I LM+A+AR+I
Sbjct: 59  VIERGVPVLKVVGRAGVGLDNVDLEAAARHGVKVLNTPESSTESVAELVIGLMIAVARKI 118

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
              ++    GKW K   MGVE 
Sbjct: 119 AWCDKQVRSGKWPKSEAMGVEL 140


>gi|297798490|ref|XP_002867129.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312965|gb|EFH43388.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 603

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|15235282|ref|NP_195146.1| EDA9 (embryo sac development arrest 9); ATP binding [Arabidopsis
           thaliana]
 gi|2911042|emb|CAA17552.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|7270370|emb|CAB80137.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|17380672|gb|AAL36166.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|23297595|gb|AAN12903.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 603

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|21536501|gb|AAM60833.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
          Length = 603

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+AR +  A+ S 
Sbjct: 124 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMARNVAQADASV 183

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 184 KAGEWKRNKYVGV 196


>gi|168028593|ref|XP_001766812.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682021|gb|EDQ68443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 565

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +K ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR +
Sbjct: 80  VFEASKGRLKVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGIALLTAMARNV 139

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 140 AQASASMKAGKWQRNKWVGV 159


>gi|332045054|gb|EGI81247.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Lacinutrix algicola 5H-3-7-4]
          Length = 312

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +K +GR G G +N+D   A + GI ++  P GN     EH+++++L++  ++ 
Sbjct: 57  FIDSATNLKFIGRVGAGLENIDCDYAEQKGITLIAAPEGNRNAVGEHSLAMLLSLFNKLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W + +  G+E 
Sbjct: 117 KADREVRNGQWLREDNRGLEL 137


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIECGKNLKVIARAGVGIDNVDVESATKHGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|94984817|ref|YP_604181.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
 gi|94555098|gb|ABF45012.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
          Length = 542

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 54/82 (65%), Gaps = 2/82 (2%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L  A  ++KV+GR G+G DN+DL   SR GI+V+N P  N+++ AE AI  +LA AR +
Sbjct: 70  LLEAAGDRLKVIGRGGVGVDNIDLEACSRRGILVLNAPESNNVSAAELAIMHLLAAARGL 129

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             ++  T  G+W++  F+GVE 
Sbjct: 130 TRSDRKTRAGEWDRK-FLGVEL 150


>gi|187933947|ref|YP_001887612.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722100|gb|ACD23321.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum B str. Eklund 17B]
          Length = 302

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSH--AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M A++R 
Sbjct: 57  VIDKEIGGNLKLIIRAGVGIDNIDIPYAVKNNLSVTNTPSASSDSVAELALAHMFAVSRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           + +AN +   G+W K  + G E 
Sbjct: 117 VGIANVTMRNGEWNKKKYQGFEL 139


>gi|311747367|ref|ZP_07721152.1| phosphoglycerate dehydrogenase [Algoriphagus sp. PR1]
 gi|126579085|gb|EAZ83249.1| phosphoglycerate dehydrogenase [Algoriphagus sp. PR1]
          Length = 309

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K + RAG G D +DL      GI + +   GN    AEH++ ++L++   + 
Sbjct: 57  LLEKAVKLKFIARAGAGLDQIDLDFLVARGIKLFHAAKGNRDAVAEHSLGMLLSLFNHVI 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G W++    G E 
Sbjct: 117 KADQEVRTGVWDREGNRGFEL 137


>gi|120403120|ref|YP_952949.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955938|gb|ABM12943.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
          Length = 528

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 119 AADATLREHSWKRSSFSGTEI 139


>gi|119719732|ref|YP_920227.1| glyoxylate reductase [Thermofilum pendens Hrk 5]
 gi|205781929|sp|A1RYE4|GYAR_THEPD RecName: Full=Glyoxylate reductase
 gi|119524852|gb|ABL78224.1| Glyoxylate reductase [Thermofilum pendens Hrk 5]
          Length = 339

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+    +G D++D+  A++ GI V +TP   +   AE  + L+LA+ R+I 
Sbjct: 63  VMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTHTPGVLTDAVAEFTVGLILAVTRRIV 122

Query: 61  VANESTHKGKWEK----FNFMGVEA 81
            A++    G+W+K    +   G E 
Sbjct: 123 EADKIIRTGQWDKPWNPYFLTGPEL 147


>gi|41409131|ref|NP_961967.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397951|gb|AAS05581.1| SerA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 528

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA AR+IP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAAREIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|118463523|ref|YP_883011.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
 gi|254776268|ref|ZP_05217784.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|118164810|gb|ABK65707.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
          Length = 528

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA AR+IP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIHSAAEHALALLLAAAREIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGTEI 139


>gi|229589796|ref|YP_002871915.1| putative hydroxyacid dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|229361662|emb|CAY48542.1| putative hydroxyacid dehydrogenase [Pseudomonas fluorescens SBW25]
          Length = 325

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +K++ + G+G D +D+  A+   I V      N+ + AEHA++LM ++ARQ  
Sbjct: 62  MIDASPALKIIAKHGVGYDTIDIAAAAERRIPVTIALGANAQSVAEHALALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G W+K   +G+E 
Sbjct: 122 LLDARMRDGHWDKATSVGIEL 142


>gi|125598081|gb|EAZ37861.1| hypothetical protein OsJ_22207 [Oryza sativa Japonica Group]
          Length = 613

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +
Sbjct: 127 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNV 186

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 187 AQADASLKAGKWQRNKYVGV 206


>gi|125556326|gb|EAZ01932.1| hypothetical protein OsI_23958 [Oryza sativa Indica Group]
          Length = 613

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +
Sbjct: 127 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNV 186

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 187 AQADASLKAGKWQRNKYVGV 206


>gi|115469298|ref|NP_001058248.1| Os06g0655100 [Oryza sativa Japonica Group]
 gi|113596288|dbj|BAF20162.1| Os06g0655100 [Oryza sativa Japonica Group]
          Length = 629

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHAI+L+ A+AR +
Sbjct: 127 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLAAMARNV 186

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 187 AQADASLKAGKWQRNKYVGV 206


>gi|119952755|ref|YP_950271.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Arthrobacter aurescens TC1]
 gi|119951885|gb|ABM10794.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Arthrobacter aurescens TC1]
          Length = 329

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++K++ R G+GTDNVD+  AS   + V +TP  NS   AEH  SL+L++ R+I 
Sbjct: 56  MIEASPRLKIIARHGVGTDNVDIPAASEHSVWVTSTPGSNSNAVAEHVFSLLLSLTRRII 115

Query: 61  VANESTHKGKWE--KFNFMGVEA 81
            A      G W   + + +G E 
Sbjct: 116 PAANRVLAGTWAEGRGDLVGFEL 138


>gi|242399259|ref|YP_002994683.1| Glyoxylate reductase [Thermococcus sibiricus MM 739]
 gi|242265652|gb|ACS90334.1| Glyoxylate reductase [Thermococcus sibiricus MM 739]
          Length = 334

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 46/75 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +K++ +  +G DN+D+  A++ G+ V NTP   +  TA+ A +L+LA AR++ 
Sbjct: 61  LLDSAPNLKIIAQYAVGYDNIDVEEATKRGVYVTNTPGVLTDATADLAFTLLLATARRLI 120

Query: 61  VANESTHKGKWEKFN 75
            A++    G+W+K  
Sbjct: 121 EADQFVRSGEWKKSG 135


>gi|300853317|ref|YP_003778301.1| D-3-phosphoglycerate dehydrogenase [Clostridium ljungdahlii DSM
           13528]
 gi|300433432|gb|ADK13199.1| D-3-phosphoglycerate dehydrogenase [Clostridium ljungdahlii DSM
           13528]
          Length = 308

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 52/83 (62%), Gaps = 2/83 (2%)

Query: 1   MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++  AK   ++++ R G+G DN+D+  A++ GI V NTP  ++++ AE  +  + A++R 
Sbjct: 57  LIDEAKKGNLRLIIRGGVGVDNIDVKYATQNGITVRNTPNASTVSVAELTMGHIFAVSRY 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I +AN +   GKWEK  + GVE 
Sbjct: 117 INIANVTMRDGKWEKKKYKGVEL 139


>gi|325969666|ref|YP_004245858.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta moutnovskia 768-28]
 gi|323708869|gb|ADY02356.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta moutnovskia 768-28]
          Length = 307

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K++++ RAG+G DN+D+  A   GI V+N P G++ + AE  I  M+  AR + 
Sbjct: 58  VIDTANKLRIIARAGVGLDNIDVEYAKSKGIEVINAPEGSTQSVAELVIGFMITAARLVM 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + +     G W K  ++G E 
Sbjct: 118 LQDRLVKDGGWPKGKYVGTEL 138


>gi|225011217|ref|ZP_03701676.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-3C]
 gi|225004631|gb|EEG42594.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-3C]
          Length = 315

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K +GR G G +N+DL  A+  G+ +   P GN     EH++ L+LA+ +++ 
Sbjct: 57  FLKAATNLKFIGRVGAGLENIDLATAAELGVFLAAAPEGNRNAVGEHSLGLLLALFQKLH 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++   +G W++    G+E 
Sbjct: 117 TADQEVRQGIWDRSGNRGIEL 137


>gi|222629679|gb|EEE61811.1| hypothetical protein OsJ_16432 [Oryza sativa Japonica Group]
          Length = 544

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 65  RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 124

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 125 KAGKWQRNKYVGV 137


>gi|90399366|emb|CAH68268.1| H0212B02.14 [Oryza sativa Indica Group]
 gi|116311962|emb|CAJ86321.1| OSIGBa0113E10.4 [Oryza sativa Indica Group]
          Length = 613

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|115460988|ref|NP_001054094.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|32488924|emb|CAE04505.1| OSJNBb0059K02.15 [Oryza sativa Japonica Group]
 gi|113565665|dbj|BAF16008.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|125550010|gb|EAY95832.1| hypothetical protein OsI_17701 [Oryza sativa Indica Group]
 gi|215768007|dbj|BAH00236.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 613

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A++R I  A+ S 
Sbjct: 134 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMSRNIAQADASL 193

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 194 KAGKWQRNKYVGV 206


>gi|242074584|ref|XP_002447228.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
 gi|241938411|gb|EES11556.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
          Length = 620

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 51/73 (69%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 141 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASL 200

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 201 KAGQWQRNKYVGV 213


>gi|297830606|ref|XP_002883185.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329025|gb|EFH59444.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 585

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 106 RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 165

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 166 KAGKWTRNKYVGV 178


>gi|14596141|gb|AAK68798.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 516

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 37  RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 96

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 97  KAGKWTRNKYVGV 109


>gi|42565022|ref|NP_566637.2| D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative
           [Arabidopsis thaliana]
 gi|11994471|dbj|BAB02473.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 588

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR I  A+ S 
Sbjct: 109 RLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASI 168

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 169 KAGKWTRNKYVGV 181


>gi|297543711|ref|YP_003676013.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296841486|gb|ADH60002.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 320

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W++   MG E 
Sbjct: 126 AVDRIVKSGGWKR--IMGTEI 144


>gi|195434066|ref|XP_002065024.1| GK15239 [Drosophila willistoni]
 gi|194161109|gb|EDW76010.1| GK15239 [Drosophila willistoni]
          Length = 332

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A++  +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVPAATKHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGTEL 143


>gi|300814338|ref|ZP_07094610.1| 4-phosphoerythronate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300511605|gb|EFK38833.1| 4-phosphoerythronate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 315

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++    +GT+++DL    +  I VMN+P  NS   AE   S  L + R   
Sbjct: 57  ILDAAKNLKLILVGSVGTNHIDLEECKKRNIPVMNSPGQNSNAVAELVFSKALDLYRNTV 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     G W K+ ++G E 
Sbjct: 117 QANNEVKSGIWNKYRWIGREL 137


>gi|282883252|ref|ZP_06291850.1| phosphoglycerate dehydrogenase [Peptoniphilus lacrimalis 315-B]
 gi|281296882|gb|EFA89380.1| phosphoglycerate dehydrogenase [Peptoniphilus lacrimalis 315-B]
          Length = 315

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++    +GT+++DL    +  I VMN+P  NS   AE   S  L + R   
Sbjct: 57  ILDAAKNLKLILVGSVGTNHIDLEECKKRNIPVMNSPGQNSNAVAELVFSKALDLYRNTV 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     G W K+ ++G E 
Sbjct: 117 QANNEVKSGIWNKYRWIGREL 137


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 54/81 (66%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A++ GI+V+NTP GN+I  AE  I LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVEAATQRGILVVNTPAGNTIAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAALNGDFRRDRFKGVEL 136


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++V+GRAG+G DN+DL  A+  GIVV+N   GN++  AEH  +L+LA+ R++ 
Sbjct: 67  LIAAAPRLRVIGRAGVGVDNIDLDAATERGIVVVNVADGNTVAVAEHVFALLLALVRRLL 126

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+WE+  ++G E 
Sbjct: 127 PASASLREGRWERSRWVGEEL 147


>gi|269837544|ref|YP_003319772.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
 gi|269786807|gb|ACZ38950.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
          Length = 316

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++ + R G   DN+D+  A+  GIVV+++P   +   AE  I L+LA+ R IP
Sbjct: 62  VIEAATALRGIARVGFAVDNIDIDAATERGIVVVHSPGARTYAVAEMTIGLILAVLRHIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+WE+  F G + 
Sbjct: 122 AADRSVKAGRWERRAFRGRQL 142


>gi|227530164|ref|ZP_03960213.1| glyoxylate reductase [Lactobacillus vaginalis ATCC 49540]
 gi|227349917|gb|EEJ40208.1| glyoxylate reductase [Lactobacillus vaginalis ATCC 49540]
          Length = 320

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++   G G +N+D+  A   GI V NTPF +S  TAE A  L++A+ R+I 
Sbjct: 61  VIDAAPKLKLIANFGAGFNNIDVKYARSKGIDVTNTPFVSSTATAEVASGLVIALMRRIV 120

Query: 61  VANESTHK---GKWEKFNFMGVEA 81
             +          W    F+G E 
Sbjct: 121 EGDRVMRSVGFDGWAPLFFLGHEL 144


>gi|319649401|ref|ZP_08003559.1| hypothetical protein HMPREF1013_00163 [Bacillus sp. 2_A_57_CT2]
 gi|317399035|gb|EFV79715.1| hypothetical protein HMPREF1013_00163 [Bacillus sp. 2_A_57_CT2]
          Length = 331

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++KV+GR G+G DN+D   A + GI V+     N+ + AE+ +  ML+++R + 
Sbjct: 74  LMAAGPQLKVIGRLGVGLDNIDTASAKKMGIPVVYAKNANATSVAEYVMMAMLSVSRPLH 133

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+     G W++  + G+E 
Sbjct: 134 LADYDVRNGNWDRKTYTGMEL 154


>gi|194759059|ref|XP_001961767.1| GF15130 [Drosophila ananassae]
 gi|190615464|gb|EDV30988.1| GF15130 [Drosophila ananassae]
          Length = 332

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGTEL 143


>gi|167038456|ref|YP_001666034.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116850|ref|YP_004187009.1| phosphoglycerate dehydrogenase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166857290|gb|ABY95698.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929941|gb|ADV80626.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 320

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W++   MG E 
Sbjct: 126 AVDRIVKSGGWKR--IMGTEI 144


>gi|125986067|ref|XP_001356797.1| GA19489 [Drosophila pseudoobscura pseudoobscura]
 gi|195148340|ref|XP_002015132.1| GL18582 [Drosophila persimilis]
 gi|54645123|gb|EAL33863.1| GA19489 [Drosophila pseudoobscura pseudoobscura]
 gi|194107085|gb|EDW29128.1| GL18582 [Drosophila persimilis]
          Length = 332

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGTEL 143


>gi|126434478|ref|YP_001070169.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
 gi|126234278|gb|ABN97678.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
          Length = 528

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 119 AADSTLRERTWKRSSFNGTEI 139


>gi|108798878|ref|YP_639075.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119867993|ref|YP_937945.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
 gi|108769297|gb|ABG08019.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119694082|gb|ABL91155.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
          Length = 528

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+L+ ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLSAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +  W++ +F G E 
Sbjct: 119 AADSTLRERTWKRSSFNGTEI 139


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 60/80 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AK++KVV RAG+G DNVD+  A++AG++V+N P  N ++ AE A++L+LA AR++P 
Sbjct: 67  LAAAKRLKVVARAGVGLDNVDVKAATQAGVMVVNAPTSNIVSAAELAVALLLAAARRVPA 126

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A++S   G+W++  + GVE 
Sbjct: 127 ADQSLKNGEWKRSKYSGVEL 146


>gi|255034232|ref|YP_003084853.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dyadobacter fermentans DSM 18053]
 gi|254946988|gb|ACT91688.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dyadobacter fermentans DSM 18053]
          Length = 337

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML +AK ++ + RAG G D +DL VA    I V +   GN    AEHA+ ++LA+   I 
Sbjct: 86  MLENAKNLRFIARAGAGLDLIDLNVARELNIEVFHAGTGNRDAVAEHALGMLLALFTNIL 145

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G W++    GVE 
Sbjct: 146 RADQQVRNGIWDREGNRGVEL 166


>gi|167038801|ref|YP_001661786.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|256752326|ref|ZP_05493188.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913614|ref|ZP_07130931.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307723371|ref|YP_003903122.1| phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166853041|gb|ABY91450.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter sp. X514]
 gi|256748813|gb|EEU61855.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890299|gb|EFK85444.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307580432|gb|ADN53831.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 320

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W++   MG E 
Sbjct: 126 AVDRIVKSGGWKR--IMGTEI 144


>gi|326389295|ref|ZP_08210863.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994658|gb|EGD53082.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus JW
           200]
          Length = 320

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W++   MG E 
Sbjct: 126 AVDRIVKSGGWKR--IMGTEI 144


>gi|313902560|ref|ZP_07835960.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467126|gb|EFR62640.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 579

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A +++V+GRAG+G DN+DL  A+  GIVV+N   GN++  AEH  +L+LA+ R++ 
Sbjct: 61  LIAAAPRLRVIGRAGVGVDNIDLEAATERGIVVVNVADGNTVAVAEHVFALLLALVRRLV 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G+WE+  F+G E 
Sbjct: 121 PAAASLRQGRWERNRFVGEEL 141


>gi|251781232|ref|ZP_04824148.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243081679|gb|EES47740.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 302

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSH--AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M +++R 
Sbjct: 57  VIDKEIGGNLKLIIRAGVGIDNIDIPHAVKNNLSVTNTPSASSDSVAELALAHMFSVSRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I +AN +   G+W K  + G E 
Sbjct: 117 IGIANVTMRNGEWNKKKYQGFEL 139


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 51/79 (64%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
            HA  +KVVGRAG G DN+D+  A+  GI+V+NTP  N+++ AEH I L++A  R +  A
Sbjct: 59  QHATNLKVVGRAGNGVDNIDMDGATNRGIIVVNTPEANTVSAAEHTIGLLIASTRNVAQA 118

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N      +W++ NF GVE 
Sbjct: 119 NAKIKNREWDRSNFKGVEL 137


>gi|300853586|ref|YP_003778570.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
 gi|300433701|gb|ADK13468.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family
           protein [Clostridium ljungdahlii DSM 13528]
          Length = 316

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +K+V + G+G DN+DL    +  + V N P  N    A+ A  L+LA ARQIP
Sbjct: 61  VLKNAPNLKIVCKHGVGVDNIDLEATKKRNVYVTNVPNANKHAVADFAFGLILASARQIP 120

Query: 61  VANESTHKGKWEKF 74
            AN+ T KG+W + 
Sbjct: 121 QANDLTKKGEWPRT 134


>gi|289577424|ref|YP_003476051.1| phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
 gi|289527137|gb|ADD01489.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
          Length = 320

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  KK+KV+ R G+G DNVDL  A + GIVV NTP  N+ + A+  I LML +AR + 
Sbjct: 66  VINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNANNNSVADLVIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W++   MG E 
Sbjct: 126 AVDRIVKSGGWKR--IMGTEI 144


>gi|148261314|ref|YP_001235441.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Acidiphilium cryptum JF-5]
 gi|326404708|ref|YP_004284790.1| putative 2-hydroxyacid dehydrogenase [Acidiphilium multivorum
           AIU301]
 gi|146402995|gb|ABQ31522.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Acidiphilium cryptum JF-5]
 gi|325051570|dbj|BAJ81908.1| putative 2-hydroxyacid dehydrogenase [Acidiphilium multivorum
           AIU301]
          Length = 328

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A ++++V R G+G D+VD+   +   I +      NS + AEHA+ ++LA+AR++P
Sbjct: 58  VIATAPQLRIVSRHGVGYDSVDVPALNARRIPLSLVGDVNSRSVAEHALMMILALARRLP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + +T  G+W + +    EAG
Sbjct: 118 DYDRATRAGEWHRRD--SREAG 137


>gi|86130913|ref|ZP_01049512.1| D-3-phosphoglycerate dehydrogenase [Dokdonia donghaensis MED134]
 gi|85818324|gb|EAQ39484.1| D-3-phosphoglycerate dehydrogenase [Dokdonia donghaensis MED134]
          Length = 315

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +K + R G G +++D+  A   GI +++ P GN     E ++ ++L++   + 
Sbjct: 57  FIDAAPHLKFIARVGAGLESIDIPYAESKGIYLISAPEGNRNAVGEQSLGMLLSLFNNLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W +    GVE 
Sbjct: 117 RADAQVKAGHWSREPNRGVEL 137


>gi|325290387|ref|YP_004266568.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965788|gb|ADY56567.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 527

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+GRAG+G +++DL  A+R GIVV+N P G S    E+   ++LA++R IP
Sbjct: 56  VIEAGRNLKVIGRAGVGVEHIDLQAATRGGIVVLNAPQGKSAAAIEYTFGMILALSRNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G+W +  + G E 
Sbjct: 116 QAYTAVKDGRWIQDIYTGSEL 136


>gi|163753721|ref|ZP_02160844.1| phosphoglycerate dehydrogenase [Kordia algicida OT-1]
 gi|161325935|gb|EDP97261.1| phosphoglycerate dehydrogenase [Kordia algicida OT-1]
          Length = 299

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K +GR G G +N+D   A   GI +++ P GN     EHA+ ++L++  ++ 
Sbjct: 44  FLAKATNLKFIGRVGAGLENIDCEFAETKGIKLISAPEGNRNAVGEHALGMILSLFNKLN 103

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +GKW +    GVE 
Sbjct: 104 KADREVREGKWLREANRGVEL 124


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVESATKHGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|168002445|ref|XP_001753924.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694900|gb|EDQ81246.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 523

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   +K ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH ISL+ A+AR +
Sbjct: 37  VFEASKGRLKVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGISLLTAMARNV 96

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   GKW++  ++GV
Sbjct: 97  AQASASMKAGKWQRNKWVGV 116


>gi|298207333|ref|YP_003715512.1| phosphoglycerate dehydrogenase [Croceibacter atlanticus HTCC2559]
 gi|83849969|gb|EAP87837.1| phosphoglycerate dehydrogenase [Croceibacter atlanticus HTCC2559]
          Length = 311

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  +K + R G G +++D+  A+   I + + P GN     EH+++L+L +  +I 
Sbjct: 57  FLDAATNLKFIARVGAGLESIDIPYANAKNIALFSAPEGNRNAVGEHSLALLLNLFNKIN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A+ +   G+W +    GVE 
Sbjct: 117 LADATVKSGQWLREQHRGVEL 137


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|297832018|ref|XP_002883891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329731|gb|EFH60150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 602

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+LM A+ R +  A+ S 
Sbjct: 123 RLKVVGRAGVGIDNVDLSAATEFGCLVVNAPTANTIAAAEHGIALMAAMVRNVSQADASV 182

Query: 67  HKGKWEKFNFMGV 79
             G+W++  ++GV
Sbjct: 183 KSGEWKRNKYVGV 195


>gi|317050557|ref|YP_004111673.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945641|gb|ADU65117.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 544

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 55/75 (73%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVD+  AS+ GIVV+NTP GN++   EH ++++LA  R IP A+ + 
Sbjct: 69  RLRVVGRAGVGLDNVDVEAASKKGIVVLNTPTGNTLAATEHTMAMLLAACRMIPKAHNTL 128

Query: 67  HKGKWEKFNFMGVEA 81
             GKW++ +FMG E 
Sbjct: 129 VGGKWDRKSFMGFEL 143


>gi|195385134|ref|XP_002051263.1| GJ14930 [Drosophila virilis]
 gi|194147720|gb|EDW63418.1| GJ14930 [Drosophila virilis]
          Length = 332

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVAAATAHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGTEL 143


>gi|55792494|gb|AAV65345.1| plastid phosphoglycerate dehydrogenase [Prototheca wickerhamii]
          Length = 231

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++  +K +++VVGRAG+G DNVDL  AS +G +V+N P  N+I  AEH ISL+ A+AR +
Sbjct: 114 VIEASKGRLRVVGRAGVGIDNVDLTAASESGCLVVNAPTANTIAAAEHGISLLTALARNV 173

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ S   G W++  ++GV
Sbjct: 174 AQADASMKAGGWDRTTYVGV 193


>gi|182418703|ref|ZP_02949976.1| D-3-phosphoglycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237669451|ref|ZP_04529432.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377397|gb|EDT74953.1| D-3-phosphoglycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237655034|gb|EEP52593.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 302

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 47/80 (58%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
                +K+  RAG+G DN+D+   + AG+ V NTP  +S + AE A++ M A+AR + +A
Sbjct: 61  EKGGNLKLAIRAGVGIDNIDIPAGNEAGVTVKNTPAASSDSVAELALAHMFALARFVGIA 120

Query: 63  NESTHKGKWEKFNFMGVEAG 82
           N +   G+W K  + G E G
Sbjct: 121 NVTMRNGEWNKKKYQGTEIG 140


>gi|77918032|ref|YP_355847.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77544115|gb|ABA87677.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 534

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 48/74 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   + +KVV RAG+G DNVDL  AS  GI+V N PFGN  +  EHA++L+LA  R++ 
Sbjct: 58  LLDAGENLKVVARAGVGLDNVDLKAASEKGIIVCNAPFGNINSVIEHAMALILAACRKLV 117

Query: 61  VANESTHKGKWEKF 74
            A+ S   G+W + 
Sbjct: 118 KADNSIKSGEWNRS 131


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HAKK+K + RAG+G DNVD+   SR GI+VMN P  N+I   E   + MLA  R  P
Sbjct: 62  LLEHAKKLKAIVRAGVGVDNVDMEECSRRGIIVMNVPTANTIAAVELTFAHMLACMRAFP 121

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     +  W++  ++G E 
Sbjct: 122 YAHNQLKLERIWKREAWIGNEL 143


>gi|323489242|ref|ZP_08094474.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Planococcus donghaensis MPA1U2]
 gi|323397129|gb|EGA89943.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Planococcus donghaensis MPA1U2]
          Length = 316

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  +K+V    +G +N+DL  A + G+ V NTP   + +TA+   +L+LA AR++ 
Sbjct: 62  VFEAAPNLKIVSNLAVGYNNIDLEAAHKHGVTVTNTPDVLTESTADLTFALLLATARRVI 121

Query: 61  VANESTHKGKWEKFNFMGV 79
            A ++   G+W  +  MG+
Sbjct: 122 EAEKTVRSGEWRSWTPMGM 140


>gi|326505978|dbj|BAJ91228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326514850|dbj|BAJ99786.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 617

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+LM A+AR +  A+ S 
Sbjct: 138 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALMCAMARNVAQADASL 197

Query: 67  HKGKWEKFNFMGV 79
             GKW +  ++GV
Sbjct: 198 KAGKWARTKYVGV 210


>gi|218247817|ref|YP_002373188.1| Glyoxylate reductase [Cyanothece sp. PCC 8801]
 gi|218168295|gb|ACK67032.1| Glyoxylate reductase [Cyanothece sp. PCC 8801]
          Length = 322

 Score = 79.9 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ +  +G DN+D+  A+   I V +TP   +  TA+   +L++AI R++ 
Sbjct: 62  LINHAPHLKVISQMAVGYDNIDVQAATNREIPVGHTPGVLTEATADLTWALLMAITRRVT 121

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A +   +GKW  +  MG+  G
Sbjct: 122 EAEDYIKQGKWTTWQPMGL-LG 142


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score = 79.9 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   K +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGKNLKVIARAGVGIDNVDVEAATKQGIIVVNAPEGNIMAAAELTIGLIFSIFRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 117 QAYMACKHGDFRRNRFKGVEL 137


>gi|195118714|ref|XP_002003881.1| GI18148 [Drosophila mojavensis]
 gi|193914456|gb|EDW13323.1| GI18148 [Drosophila mojavensis]
          Length = 332

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVAAATTHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGNEL 143


>gi|167998190|ref|XP_001751801.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696899|gb|EDQ83236.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 630

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++KVVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+AR    A+ S 
Sbjct: 147 RLKVVGRAGVGIDNVDLDAATELGCLVVNAPTANTVAAAEHGIALLTAMARNAAPADASM 206

Query: 67  HKGKWEKFNFMGV 79
             GKWE+  ++GV
Sbjct: 207 KSGKWERSKYVGV 219


>gi|121594510|ref|YP_986406.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidovorax sp. JS42]
 gi|120606590|gb|ABM42330.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Acidovorax sp. JS42]
          Length = 337

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++++     G D++DL      GI V N P     T AEHA +L+LA++R I 
Sbjct: 58  VLAQFPRLRLIATRSTGYDHIDLDYCRAHGIAVSNVPDYGDATVAEHAFALLLAVSRHIV 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
              E T +G + +    G E 
Sbjct: 118 TGAERTRRGDFSQHGLRGFEL 138


>gi|206900326|ref|YP_002251477.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206739429|gb|ACI18487.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 316

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 54/81 (66%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+ + G+G DN+D++ A +  IVV NTP  NS   AE  + L++ + R+I 
Sbjct: 64  VLKNANKLKVISKYGVGVDNIDILEAKKRNIVVTNTPGANSNAVAELTVGLIINVLRKIN 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           ++++ T +G+W++  F+G E 
Sbjct: 124 LSDKKTREGRWDR--FIGNEL 142


>gi|195472108|ref|XP_002088344.1| GE12961 [Drosophila yakuba]
 gi|194174445|gb|EDW88056.1| GE12961 [Drosophila yakuba]
          Length = 332

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+    ++KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +
Sbjct: 62  VLAAGSGRLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGSLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYAGTEL 143


>gi|91216104|ref|ZP_01253072.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
 gi|91185621|gb|EAS71996.1| D-3-phosphoglycerate dehydrogenase [Psychroflexus torquis ATCC
           700755]
          Length = 303

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A ++K +GR G G +N+D+  A   GI + N P GN    +EHA+ ++L++  ++ 
Sbjct: 45  FLDKATRLKFIGRVGAGLENIDVDYAREKGIQLYNAPEGNRNAVSEHALGMLLSLFNKLR 104

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    GKW +    G E 
Sbjct: 105 TAHDEVVNGKWRREENRGHEL 125


>gi|86134808|ref|ZP_01053390.1| D-3-phosphoglycerate dehydrogenase [Polaribacter sp. MED152]
 gi|85821671|gb|EAQ42818.1| D-3-phosphoglycerate dehydrogenase [Polaribacter sp. MED152]
          Length = 312

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  AK +K +GR G G +N+D   A+   I ++  P GN     EH++ L+LA+  ++ 
Sbjct: 57  FLDKAKNLKFIGRVGAGLENIDCDYANSKNIKLIAAPEGNRNAVGEHSLGLLLALFNKMI 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +GKW +    G+E 
Sbjct: 117 KADLEVRQGKWLREENRGLEL 137


>gi|299134764|ref|ZP_07027956.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Afipia
           sp. 1NLS2]
 gi|298590574|gb|EFI50777.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Afipia
           sp. 1NLS2]
          Length = 306

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K VGR G+G DN+DL   ++  I V+     N ++ AE+ I+  + + R   
Sbjct: 59  LLDAAPKLKAVGRLGVGLDNIDLEACAKRNIAVLPASGANDLSVAEYVITSAMMLLRGAY 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A  S   GKW +   +G E 
Sbjct: 119 MATGSVVAGKWPRNTLIGREI 139


>gi|32474150|ref|NP_867144.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|32444687|emb|CAD74689.1| phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|327541027|gb|EGF27580.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica WH47]
          Length = 540

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 57/78 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L    +++ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEH  +++LA++R I  
Sbjct: 60  LEGNTRLRALVRAGVGTDNIDKPAATRRGIVVMNTPAGNTVSTAEHTFAMLLAMSRNIAA 119

Query: 62  ANESTHKGKWEKFNFMGV 79
           AN+S  +G+W++  FMG 
Sbjct: 120 ANQSLVEGRWDRKKFMGT 137


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 58/80 (72%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L    +++ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEHA  LM+A++R +  
Sbjct: 60  LEGNTRLRCIARAGVGTDNIDKDAATRLGIVVMNTPTGNTVSTAEHAFCLMMALSRNVAS 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN+S  +G+W++  +MG + 
Sbjct: 120 ANQSLVEGRWDRKKYMGSQL 139


>gi|257060863|ref|YP_003138751.1| Glyoxylate reductase [Cyanothece sp. PCC 8802]
 gi|256591029|gb|ACV01916.1| Glyoxylate reductase [Cyanothece sp. PCC 8802]
          Length = 322

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++HA  +KV+ +  +G DN+D+  A+  GI V +TP   +  TA+   +L++AI R++ 
Sbjct: 62  LINHAPHLKVISQMAVGYDNIDVQAATNRGIRVGHTPGVLTEATADLTWALLMAITRRVT 121

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A +   +GKW  +  MG+  G
Sbjct: 122 EAEDYIKQGKWTTWQPMGL-LG 142


>gi|188587665|ref|YP_001922582.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188497946|gb|ACD51082.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum E3 str. Alaska E43]
          Length = 302

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSH--AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K++ RAG+G DN+D+  A +  + V NTP  +S + AE A++ M +++R 
Sbjct: 57  VIDKEIGGNLKLIIRAGVGIDNIDISHAVKNNLSVTNTPSASSDSVAELALAHMFSVSRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I +AN +   G+W K  + G E 
Sbjct: 117 IGIANVTMRNGEWNKKKYQGFEL 139


>gi|299136357|ref|ZP_07029541.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
 gi|298602481|gb|EFI58635.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
          Length = 540

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 52/76 (68%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
            K++++GRAG+G DN+D   A+R GIVVMNTP  N++  AE  + LM+++ R IP AN +
Sbjct: 63  PKLRIIGRAGVGVDNIDANEATRRGIVVMNTPGANAVAVAELTLGLMISMCRAIPRANAA 122

Query: 66  THKGKWEKFNFMGVEA 81
            H GKWEK +  G E 
Sbjct: 123 LHVGKWEKKSLQGSEL 138


>gi|148546608|ref|YP_001266710.1| D-isomer specific 2-hydroxyacid dehydrogenase [Pseudomonas putida
           F1]
 gi|148510666|gb|ABQ77526.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pseudomonas putida F1]
          Length = 324

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ + K+++V R G G DNVD   A+  G+ V NTP  N  +  EH  +L+L++ R++P
Sbjct: 56  MIAASPKLRIVARHGAGYDNVDYKAAADHGVWVTNTPGANQRSVIEHVFALLLSLCRKLP 115

Query: 61  VANESTHKGKW--EKFNFMGVEA 81
           +A+E T    W  ++ +  G+E 
Sbjct: 116 LASEQTRNRVWAEDRLSLTGIEL 138


>gi|52081995|ref|YP_080786.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD binding
           domain-containing protein [Bacillus licheniformis ATCC
           14580]
 gi|52787382|ref|YP_093211.1| hypothetical protein BLi03698 [Bacillus licheniformis ATCC 14580]
 gi|319647859|ref|ZP_08002077.1| hypothetical protein HMPREF1012_03116 [Bacillus sp. BT1B_CT2]
 gi|52005206|gb|AAU25148.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
           [Bacillus licheniformis ATCC 14580]
 gi|52349884|gb|AAU42518.1| hypothetical protein BLi03698 [Bacillus licheniformis ATCC 14580]
 gi|317390200|gb|EFV71009.1| hypothetical protein HMPREF1012_03116 [Bacillus sp. BT1B_CT2]
          Length = 316

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+V + G+G DN+DL  A    + V N P  N    A+    LML+ ARQIP
Sbjct: 61  VLDRLPSLKIVCKHGVGVDNIDLHAAKERNVWVTNAPNANKHAVADFVFGLMLSAARQIP 120

Query: 61  VANESTHKGKWEK---FNFMGVEAG 82
            A+  T  GKW +    +  G   G
Sbjct: 121 AADRETKLGKWPRIFGSDVYGKTLG 145


>gi|89890023|ref|ZP_01201534.1| phosphoglycerate dehydrogenase [Flavobacteria bacterium BBFL7]
 gi|89518296|gb|EAS20952.1| phosphoglycerate dehydrogenase [Flavobacteria bacterium BBFL7]
          Length = 310

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  AK +K +GR G G +N+DL VA +  I   N P GN     EHA+ ++L++   + 
Sbjct: 57  FLIAAKNLKFIGRVGAGLENIDLDVAQKLHIECYNAPEGNRNAVGEHALGMLLSLFNHLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G W +    G+E 
Sbjct: 117 RADQEVRNGIWLREENRGLEL 137


>gi|315230890|ref|YP_004071326.1| glyoxylate reductase [Thermococcus barophilus MP]
 gi|315183918|gb|ADT84103.1| glyoxylate reductase [Thermococcus barophilus MP]
          Length = 336

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 48/75 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A +++++ +  +G DN+D+  A+R GI V NTP   +  TA+ A +L+LA ARQ+ 
Sbjct: 62  ILDNAPRLRIIAQYAVGYDNIDIEEATRRGIYVTNTPDVLTEATADFAWALLLATARQLV 121

Query: 61  VANESTHKGKWEKFN 75
            A++    G+W++  
Sbjct: 122 DADKFVRSGEWKRKG 136


>gi|331695673|ref|YP_004331912.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950362|gb|AEA24059.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 533

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ + ++KVV RAG+G DNVD+  A+  G++V+N P  N ++ AEHAI+L+LA AR + 
Sbjct: 63  VLAASTRLKVVARAGVGLDNVDVPAATARGVMVVNAPTSNIVSAAEHAIALLLAAARHVA 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +  +G+W++  + GVE 
Sbjct: 123 PADAALRQGQWKRSAYTGVEL 143


>gi|170046341|ref|XP_001850727.1| d-3-phosphoglycerate dehydrogenase [Culex quinquefasciatus]
 gi|167869148|gb|EDS32531.1| d-3-phosphoglycerate dehydrogenase [Culex quinquefasciatus]
          Length = 332

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   A  +K VGRAG G DN+D+  A+R  ++V+NTP GNSI+  E    L+ A+AR I
Sbjct: 62  ILDAGAGSLKAVGRAGAGVDNIDIQAATRNNVLVLNTPGGNSISACELTCFLIGALARPI 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A  S  +G+W++  + G E 
Sbjct: 122 CPAAGSMKEGRWDRKLYSGSEL 143


>gi|217968155|ref|YP_002353661.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dictyoglomus turgidum DSM 6724]
 gi|217337254|gb|ACK43047.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dictyoglomus turgidum DSM 6724]
          Length = 318

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+KV+ + G+G DN+DL  + R  IVV NTP  NS   AE  + L++ + R+I 
Sbjct: 66  VLKNANKLKVISKYGVGVDNIDLEESKRRNIVVTNTPGVNSNAVAELTVGLIINVLRKIN 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           ++++ T  G W +  F+G E 
Sbjct: 126 LSDKKTRGGNWNR--FIGNEL 144


>gi|195050492|ref|XP_001992905.1| GH13534 [Drosophila grimshawi]
 gi|193899964|gb|EDV98830.1| GH13534 [Drosophila grimshawi]
          Length = 332

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A  +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ A+AR +
Sbjct: 62  VLAAGAGSLKVVGRAGAGVDNIDVAAATTHNVVVLNTPGGNSISACELTCILIGALARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYSGSEL 143


>gi|145593787|ref|YP_001158084.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
 gi|145303124|gb|ABP53706.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
          Length = 531

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 54/80 (67%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KVV RAG+G DNV++  A+  G++V+N P  N ++ AE A++L+LA+AR    
Sbjct: 59  IAAAPRLKVVARAGVGLDNVEVPAATTRGVMVVNAPTSNIVSAAEQAVALLLAVARNTAS 118

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 119 ASTALKVGEWKRSKYTGVEV 138


>gi|317484262|ref|ZP_07943188.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
 gi|316924491|gb|EFV45651.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bilophila
           wadsworthia 3_1_6]
          Length = 394

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     ++ V + G+G D +D+  A    I+V NTP  N +  AEH  +L+L + RQ+P
Sbjct: 139 LLDALPNLRCVAKLGVGLDMIDIPAAVARDIIVCNTPGANDVAVAEHTFALLLGLLRQVP 198

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     GKWE+   +G E 
Sbjct: 199 RCDAGMRGGKWEQGAILGREV 219


>gi|319891908|ref|YP_004148783.1| Glyoxylate reductase / Glyoxylate reductase / Hydroxypyruvate
           reductase [Staphylococcus pseudintermedius HKU10-03]
 gi|317161604|gb|ADV05147.1| Glyoxylate reductase / Glyoxylate reductase / Hydroxypyruvate
           reductase [Staphylococcus pseudintermedius HKU10-03]
 gi|323465001|gb|ADX77154.1| glyoxylate reductase [Staphylococcus pseudintermedius ED99]
          Length = 321

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  +K+V    +G DN+DL  A++  + + NTP   + TTAE   +LM+A +R+I 
Sbjct: 61  LFEAAPNLKIVANMAVGFDNIDLQAAAQHEVEISNTPHVLTETTAELGFALMMATSRRIV 120

Query: 61  VANESTHKGKWEKFN 75
            A +    GKWE + 
Sbjct: 121 EAEKYVQDGKWESWG 135


>gi|163794481|ref|ZP_02188452.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase
           [alpha proteobacterium BAL199]
 gi|159180205|gb|EDP64728.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
           region:D-isomer specific 2-hydroxyacid dehydrogenase
           [alpha proteobacterium BAL199]
          Length = 313

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +++VGR G+G DN+D+  A   G+ V+     N  + AE+ I++ L + R   
Sbjct: 59  VLAAAPGLRIVGRLGVGLDNIDVAAARNRGVPVVPATGANDDSVAEYVIAMTLHLLRGAY 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW +   +G E 
Sbjct: 119 TASAEVAAGKWPRTRLIGREV 139


>gi|150019735|ref|YP_001311989.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Clostridium beijerinckii NCIMB 8052]
 gi|149906200|gb|ABR37033.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Clostridium beijerinckii NCIMB 8052]
          Length = 302

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 44/79 (55%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
                +K+  RAG+G DN+D+  A   G+ V NTP  +S + AE AI  M A+AR I ++
Sbjct: 61  EAGGNLKLAIRAGVGIDNIDIPAAQGKGVTVRNTPSASSDSVAELAIGHMFALARFIAIS 120

Query: 63  NESTHKGKWEKFNFMGVEA 81
           N +   G+W K  + G E 
Sbjct: 121 NYTMRNGEWNKKKYEGTEI 139


>gi|256380010|ref|YP_003103670.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
 gi|255924313|gb|ACU39824.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
          Length = 532

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 57/81 (70%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +   K+KVV RAG+G DNV++  A+  G++V+N P  N ++ AEHA++L+L++ARQIP
Sbjct: 62  VFAATSKLKVVARAGVGLDNVEVPAATERGVMVVNAPTSNIVSAAEHAVALLLSVARQIP 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   G W++ +F GVE 
Sbjct: 122 AAHATLAGGAWKRSSFNGVEL 142


>gi|291301774|ref|YP_003513052.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570994|gb|ADD43959.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 533

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 53/76 (69%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
            K++VV RAG+G DNVD+ VA+  G++V+N P  N ++ AE A++L+LA AR   +A+ S
Sbjct: 67  PKLQVVARAGVGLDNVDINVATERGVMVVNAPTSNIVSAAEQAVALLLATARNTTIADAS 126

Query: 66  THKGKWEKFNFMGVEA 81
             +G+W++  F GVE 
Sbjct: 127 LKRGEWKRSQFTGVEL 142


>gi|299069336|emb|CBJ40602.1| Glyoxylate reductase [Ralstonia solanacearum CMR15]
          Length = 331

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K V   G+G +N+D+   +  G+VV NTP   + TTA+   +LMLA AR+I 
Sbjct: 61  LLDACPQLKAVCNVGVGYNNIDVAACTARGVVVSNTPDVLTQTTADFGFALMLATARRIT 120

Query: 61  VANESTHKGKWEKFN 75
            +     +G+W+K  
Sbjct: 121 ESERFVRRGEWQKTG 135


>gi|17549166|ref|NP_522506.1| 2-hydroxyacid dehydrogenase [Ralstonia solanacearum GMI1000]
 gi|17431417|emb|CAD18096.1| probable dehydrogenase oxidoreductase protein [Ralstonia
           solanacearum GMI1000]
          Length = 331

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K V   G+G +N+D+   +  G+VV NTP   + TTA+   +LMLA AR+I 
Sbjct: 61  LLDACPQLKAVCNVGVGYNNIDVAACTARGVVVSNTPDVLTQTTADFGFALMLATARRIT 120

Query: 61  VANESTHKGKWEKFN 75
            +     +G+W+K  
Sbjct: 121 ESERFVRRGEWQKTG 135


>gi|261407384|ref|YP_003243625.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Paenibacillus sp. Y412MC10]
 gi|261283847|gb|ACX65818.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Paenibacillus sp. Y412MC10]
          Length = 322

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A +++ + R G+G DN+DL  A + GI V N P GN+   AE AI LM+++ R IP
Sbjct: 66  VFKLAPRLQGIARFGVGVDNIDLGAARKYGIQVTNVPRGNANAVAELAIGLMISVRRHIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + ST  G WE+  F+G E 
Sbjct: 126 ALDRSTKNGGWER--FVGSEL 144


>gi|242081631|ref|XP_002445584.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
 gi|241941934|gb|EES15079.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
          Length = 619

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 132 VLEAGRGRLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTVAAAEHGIALLASMARNV 191

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 192 SQADAALKAGKWQRNKYVGV 211


>gi|237799128|ref|ZP_04587589.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021983|gb|EGI02040.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 327

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +K++ + G+G D +D+  A+ + I V      N+ + AEHA +LM ++ARQ  
Sbjct: 62  MIQASGNLKIIAKHGVGYDTIDIQAAADSNIPVTIALGANAQSVAEHAFALMFSVARQTA 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W+K    GVE 
Sbjct: 122 ALDARMRAGHWDKATANGVEL 142


>gi|226529328|ref|NP_001147079.1| LOC100280688 [Zea mays]
 gi|195607108|gb|ACG25384.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 624

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ ++AR +
Sbjct: 136 VLEAGQGRLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTIAAAEHGIALLASMARNV 195

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 196 SQADAALKAGKWQRNKYVGV 215


>gi|194704786|gb|ACF86477.1| unknown [Zea mays]
          Length = 624

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+  G +V+N P  N+I  AEH I+L+ ++AR +
Sbjct: 136 VLEAGQGRLRVVGRAGVGIDNVDLQAATEVGCLVVNAPTANTIAAAEHGIALLASMARNV 195

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 196 SQADAALKAGKWQRNKYVGV 215


>gi|224476026|ref|YP_002633632.1| putative D-isomer specific 2-hydroxyacid dehydrogenase
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222420633|emb|CAL27447.1| putative D-isomer specific 2-hydroxyacid dehydrogenase
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 323

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 43/74 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A K+K++    +G DN+D+ +A   G+ V NTP   + TTAE   +LMLA AR+I  
Sbjct: 62  LDAAPKLKIIANLAVGYDNIDIPLAEERGVTVTNTPEVLTETTAELGFALMLATARRIVE 121

Query: 62  ANESTHKGKWEKFN 75
           A +    GKW+ + 
Sbjct: 122 AEQYIRDGKWKSWG 135


>gi|254172242|ref|ZP_04878918.1| glyoxylate reductase [Thermococcus sp. AM4]
 gi|214034138|gb|EEB74964.1| glyoxylate reductase [Thermococcus sp. AM4]
          Length = 333

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+     G D+VD+  A++ GI V       S   AE A+ L +A+ R+I 
Sbjct: 58  VLEKAERLKVISCHSAGYDHVDVETATKKGIYVTKVAGVLSEAVAEFAVGLTVALLRKIA 117

Query: 61  VANESTHKGKWE-----KFNFMGVE 80
            A+     GKW+        F G+E
Sbjct: 118 YADRFIRAGKWDSHRTVWSGFKGIE 142


>gi|330945504|gb|EGH47050.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 300

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  + ++  V + G+G D +D+  A+  G+ VM     N+ + AEHA +LM ++AR I 
Sbjct: 37  MIEASPRLNAVAKHGVGYDTIDIQAAAEKGVPVMIALGANAQSVAEHAFALMFSVARHIA 96

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +  T +G W+K    G+E 
Sbjct: 97  WLDARTRQGHWDKATANGIEL 117


>gi|90422674|ref|YP_531044.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodopseudomonas palustris BisB18]
 gi|90104688|gb|ABD86725.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodopseudomonas palustris BisB18]
          Length = 321

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  +  +KVV + G GT+++DL  A   G+ V+     N+ + AEHA  LMLA+ + + 
Sbjct: 63  LMKASPNLKVVAKHGAGTNDIDLAAAKALGVPVLAAVGANAHSVAEHAFMLMLALIKDVR 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W+K  + G E 
Sbjct: 123 NQDAYVRGGGWDKKGYRGREL 143


>gi|125561721|gb|EAZ07169.1| hypothetical protein OsI_29415 [Oryza sativa Indica Group]
          Length = 621

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 133 VLEAGRGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLASMARNV 192

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 193 SQADAALKAGKWQRTKYVGV 212


>gi|42408279|dbj|BAD09434.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|42409460|dbj|BAD09817.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|215769351|dbj|BAH01580.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 621

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 55/80 (68%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+ ++AR +
Sbjct: 133 VLEAGRGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLASMARNV 192

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 193 SQADAALKAGKWQRTKYVGV 212


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%)

Query: 4   HAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVAN 63
            A  +K VGRAG+G DN+D   A+  G+VVMNTP GN+I TAE   + ML  AR +P A 
Sbjct: 78  AAPTLKAVGRAGVGVDNIDSEAATDFGVVVMNTPGGNTIATAELTFTHMLCGARPVPQAA 137

Query: 64  ESTHKGKWEKFNFMGVEA 81
           +S  +G+W++  + G E 
Sbjct: 138 QSMREGRWDRKIYGGSEL 155


>gi|326501108|dbj|BAJ98785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504920|dbj|BAK06751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 616

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 54/80 (67%), Gaps = 1/80 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   + +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEH I+L+  +AR +
Sbjct: 129 VLEAGRGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHGIALLACMARNV 188

Query: 60  PVANESTHKGKWEKFNFMGV 79
             A+ +   GKW++  ++GV
Sbjct: 189 SQADAALKAGKWQRTKYVGV 208


>gi|226498082|ref|NP_001147127.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195607486|gb|ACG25573.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 612

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 50/73 (68%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           +++VVGRAG+G DNVDL  A+  G +V+N P  N++  AEH I+L+ A+A  I  A+ S 
Sbjct: 133 RLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLTAMAWNIAQADASL 192

Query: 67  HKGKWEKFNFMGV 79
             GKW++  ++GV
Sbjct: 193 KAGKWQRNKYVGV 205


>gi|159186584|ref|NP_396261.2| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Agrobacterium tumefaciens str. C58]
 gi|159141644|gb|AAK90702.2| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Agrobacterium tumefaciens str. C58]
          Length = 349

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A  ++V+ + G+G DN+D+  ASR  I V+     N+++ AEHAI+L+ A+ ++I  
Sbjct: 83  IKAAPSLRVLSKHGVGVDNIDVDAASRREIPVVVAAGANALSVAEHAITLLFAVVKRIVP 142

Query: 62  ANESTHKGKWEKFNFMGVEA 81
            +     G+WEK  + G E 
Sbjct: 143 LDSGIRAGRWEKAGYSGKEL 162


>gi|317121076|ref|YP_004101079.1| glyoxylate reductase [Thermaerobacter marianensis DSM 12885]
 gi|315591056|gb|ADU50352.1| Glyoxylate reductase [Thermaerobacter marianensis DSM 12885]
          Length = 325

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G DNVD+  A R G++V +TP   +  TA+ A +L+LA AR++P
Sbjct: 64  LLAAAPRLRVVSNCAVGYDNVDVAAARRRGVMVTHTPGVLTEATADLAFALILACARRLP 123

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            A      G+W  +    ++G+E 
Sbjct: 124 QAEADLRAGRWTTWHPLQWLGLEL 147


>gi|156937177|ref|YP_001434973.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Ignicoccus hospitalis KIN4/I]
 gi|156566161|gb|ABU81566.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Ignicoccus hospitalis KIN4/I]
          Length = 308

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ RAG G DN+DL  A   GI V+N P       AE  I +M+ +AR+  
Sbjct: 59  VIEAADKLKVIARAGSGLDNIDLEAAKEKGIKVVNAPDALKNAVAELVIGMMVVLARRAH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +     +G+WEK   MG E 
Sbjct: 119 YSYRKLLEGEWEK--VMGFEL 137


>gi|197103297|ref|YP_002128675.1| D-lactate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480573|gb|ACG80100.1| D-lactate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 338

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++++     G D++DL    +  + V N P     T AEHA +L+LA+ R +P
Sbjct: 58  VLRRFPRLELIATRSTGYDHIDLDYCRQHKVTVCNVPDYGDQTVAEHAFALLLALIRHVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +  + +    G E 
Sbjct: 118 EASARARQANFSQQGLRGFEL 138


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+   + +KV+ RAG+G DNVD+  A++ GI+V+N P GN +  AE  I L+ +I R IP
Sbjct: 57  MIKCGRNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELTIGLIFSIFRYIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S  +G + +  F GVE 
Sbjct: 117 QAYMSCKQGDFRRNKFKGVEL 137


>gi|268316298|ref|YP_003290017.1| Glyoxylate reductase [Rhodothermus marinus DSM 4252]
 gi|262333832|gb|ACY47629.1| Glyoxylate reductase [Rhodothermus marinus DSM 4252]
          Length = 322

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +  K+++V +  +G +N+DL  A   GIVV +TP   +  TA+   +L+LA+ R++ 
Sbjct: 63  VLENCPKLRIVAQHAVGYENIDLEAARARGIVVTHTPGVLTDATADFTFALLLALVRRVR 122

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            A+    +G ++++     +G + 
Sbjct: 123 EADRYVREGHFKRWETKLLLGHDL 146


>gi|289704780|ref|ZP_06501201.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
 gi|289558496|gb|EFD51766.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
          Length = 531

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 51/80 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE     +LA AR I  
Sbjct: 62  IAAAPQLKVIARAGVGLDNVDVPAATEAGVMVVNAPTSNIISAAELTCGHILAAARNIAA 121

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S   G+W++  + GVE 
Sbjct: 122 AHGSLKAGEWKRSKYTGVEL 141


>gi|149183086|ref|ZP_01861538.1| 2-hydroxyacid dehydrogenase [Bacillus sp. SG-1]
 gi|148849215|gb|EDL63413.1| 2-hydroxyacid dehydrogenase [Bacillus sp. SG-1]
          Length = 351

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   +  +KVV    +G DN+DL  A+   + V NTP   + TTA+    LM+A AR++ 
Sbjct: 88  LFEKSPNLKVVANLAVGFDNIDLKAANEKDVAVCNTPDVLTDTTADLTFGLMMAAARRLI 147

Query: 61  VANESTHKGKWEKFNFM---GVEA 81
            A++   +GKW+ ++ +   G + 
Sbjct: 148 EADKYVREGKWKSWSPLLMAGTDI 171


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+HA K+K + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ ML   R+ P
Sbjct: 59  LLTHATKLKAIVRAGVGVDNVDVPYCSQKGIVVMNVPTANTIAAVELTMAHMLNAVRRFP 118

Query: 61  VANESTHKGK-WEKFNFMGVEA 81
            AN+   + + W + ++ G E 
Sbjct: 119 GANKQLKQDRLWRREDWYGTEL 140


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L HAK++K + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ ML+  R+ P
Sbjct: 62  FLEHAKELKAIVRAGVGVDNVDIDGCSKRGIVVMNVPTANTIAAVELTMAHMLSCVRKFP 121

Query: 61  VANESTHKGK-WEKFNFMGVEA 81
            A+ +  + + W + ++ G E 
Sbjct: 122 YAHNNLKQDRIWRRQDWYGTEL 143


>gi|323693892|ref|ZP_08108080.1| hypothetical protein HMPREF9475_02943 [Clostridium symbiosum
           WAL-14673]
 gi|323502043|gb|EGB17917.1| hypothetical protein HMPREF9475_02943 [Clostridium symbiosum
           WAL-14673]
          Length = 318

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   K+KV+ R G+G DN+DL  A   GI V      N+ + AEH  +LMLA AR I 
Sbjct: 57  VIAAGTKLKVIARYGVGYDNIDLKAAEDMGIYVTIAKGCNTRSVAEHTAALMLACARNIT 116

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
              E   +G +  +    G+E 
Sbjct: 117 QIYEELKRGNFAIRNALPGMEL 138


>gi|323486317|ref|ZP_08091642.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Clostridium symbiosum WAL-14163]
 gi|323400299|gb|EGA92672.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Clostridium symbiosum WAL-14163]
          Length = 318

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   K+KV+ R G+G DN+DL  A   GI V      N+ + AEH  +LMLA AR I 
Sbjct: 57  VIAAGTKLKVIARYGVGYDNIDLKAAEDMGIYVTIAKGCNTRSVAEHTAALMLACARNIT 116

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
              E   +G +  +    G+E 
Sbjct: 117 QIYEELKRGNFAIRNALPGMEL 138


>gi|42522974|ref|NP_968354.1| phosphoglycerate dehydrogenase [Bdellovibrio bacteriovorus HD100]
 gi|39574170|emb|CAE79347.1| phosphoglycerate dehydrogenase [Bdellovibrio bacteriovorus HD100]
          Length = 328

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A++++++     G D++DL    + G+ VM+TP  N  + A+    L+L+    I 
Sbjct: 59  LLKKARQLQLIVTCTSGFDHIDLEATQKWGVTVMHTPTANIESAAQLTWGLVLSCVNNIQ 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++    G+W +    G+E 
Sbjct: 119 AAHKMVKAGEWNRDQITGIEL 139


>gi|260060931|ref|YP_003194011.1| putative D-3-phosphoglycerate dehydrogenase [Robiginitalea
           biformata HTCC2501]
 gi|88785063|gb|EAR16232.1| putative D-3-phosphoglycerate dehydrogenase [Robiginitalea
           biformata HTCC2501]
          Length = 315

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK ++ +GR G G +N+D   A   GI +   P GN     EHA+ ++L++  ++ 
Sbjct: 58  LLDRAKNLEFIGRVGAGLENIDTRAAGERGIFLAAAPEGNRNAVGEHALGMLLSLMNKLH 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    +G+W +    GVE 
Sbjct: 118 TADAEVREGRWRREANRGVEL 138


>gi|329922429|ref|ZP_08278087.1| putative glyoxylate reductase [Paenibacillus sp. HGF5]
 gi|328942157|gb|EGG38433.1| putative glyoxylate reductase [Paenibacillus sp. HGF5]
          Length = 322

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A +++ + R G+G DN+DL  A + GI V N P GN+   AE AI LM+++ R IP
Sbjct: 66  IFKLAPQLQGIARFGVGVDNIDLEAARKYGIQVTNVPRGNANAVAELAIGLMISVRRHIP 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + ST  G WE+  F+G E 
Sbjct: 126 ALDRSTKNGSWER--FVGSEL 144


>gi|114565585|ref|YP_752739.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336520|gb|ABI67368.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 530

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++K+VGRAG G DN+D+ V +R G++V NTP  N+I+ AE  ISL+L+  R   
Sbjct: 59  LIRRAKRLKIVGRAGNGIDNIDVDVCTRYGVIVANTPDSNTISAAEQTISLLLSSIRNTA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E    G W++  F GVE 
Sbjct: 119 WASEYLKGGTWDRKPFRGVEL 139


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K + RAG+G DN+D+  A+R GIVVMNTP GN+++TAEH ++L+LA++R I 
Sbjct: 64  VLRGQTRLKAIVRAGVGVDNIDVTTATRQGIVVMNTPGGNTLSTAEHTLALLLALSRNIA 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  S   G+W++  + G + 
Sbjct: 124 PACASLKAGRWDRSKYTGSQL 144


>gi|73663154|ref|YP_301935.1| putative dehydrogenase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72495669|dbj|BAE18990.1| putative dehydrogenase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 319

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A  +K++    +G DN+D+ + +  GI+  NTP   + TTAE   +LMLA+AR+I  
Sbjct: 62  LEAAPNLKIIANMAVGFDNIDIDLVNNKGIIATNTPSVLTETTAELGFTLMLAVARRIVE 121

Query: 62  ANESTHKGKWEKFN---FMGVEA 81
           A +    G+W+ +    F G + 
Sbjct: 122 AEKYVQNGEWQSWGPYLFAGKDL 144


>gi|118617543|ref|YP_905875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium ulcerans Agy99]
 gi|118569653|gb|ABL04404.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium ulcerans
           Agy99]
          Length = 528

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVDAATTRGVLVVNAPTSNIHSAAEHAMALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGAEI 139


>gi|296158264|ref|ZP_06841096.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia sp. Ch1-1]
 gi|295891600|gb|EFG71386.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia sp. Ch1-1]
          Length = 329

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMTAFNAANVLCTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      GKW+K+ + G   G
Sbjct: 118 ESEHWLRAGKWQKWTYDGF-LG 138


>gi|183981728|ref|YP_001850019.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
 gi|183175054|gb|ACC40164.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
          Length = 528

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP
Sbjct: 59  VLAAATKLKIVARAGVGLDNVDVDAATTRGVLVVNAPTSNIHSAAEHAMALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +  W++ +F G E 
Sbjct: 119 AADASLREHTWKRSSFSGAEI 139


>gi|161528766|ref|YP_001582592.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
           [Nitrosopumilus maritimus SCM1]
 gi|160340067|gb|ABX13154.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Nitrosopumilus maritimus SCM1]
          Length = 310

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 37/81 (45%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A   K++ R G+G DNVD   A    I V+N   G     AE  + LML++ARQ  
Sbjct: 61  MIDKADNCKIIARVGVGLDNVDQEAAKAKNIRVINAVEGAMNAVAELVLGLMLSLARQTA 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +      +W K    G E 
Sbjct: 121 RGDRGIRNEQWLKKELKGTEL 141


>gi|157109536|ref|XP_001650713.1| d-3-phosphoglycerate dehydrogenase [Aedes aegypti]
 gi|108878977|gb|EAT43202.1| d-3-phosphoglycerate dehydrogenase [Aedes aegypti]
          Length = 332

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L     K+K VGRAG G DN+D+V A+R  ++V+N P GNSI+  E    L+ A+AR  
Sbjct: 62  ILDAGSGKLKAVGRAGAGVDNIDIVAATRNNVIVLNAPGGNSISACELTCFLIGALARPF 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A  S  +G+W++  + G E 
Sbjct: 122 CPAASSMKEGRWDRKLYSGSEL 143


>gi|317154068|ref|YP_004122116.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316944319|gb|ADU63370.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 394

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 50/75 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           ++K+VGR G+GTDN+DL  A   G++V   P GN+  TAEHA+ LM AIAR++P A+ + 
Sbjct: 66  RLKIVGRGGVGTDNIDLEAAKELGVIVKFAPNGNTNATAEHALGLMFAIARRVPFAHHTL 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W K  F GVE 
Sbjct: 126 MDGVWHKKRFSGVEL 140


>gi|256820572|ref|YP_003141851.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Capnocytophaga ochracea DSM 7271]
 gi|256582155|gb|ACU93290.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Capnocytophaga ochracea DSM 7271]
          Length = 316

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A ++K +GR G G +N+D+  A   GI ++  P GN     EHA+ ++LA+  +  
Sbjct: 57  FLDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPEGNRNAVGEHALGMLLALLNKFK 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW +    G E 
Sbjct: 117 KANNEIKNGKWLREENRGWEL 137


>gi|313888546|ref|ZP_07822212.1| 4-phosphoerythronate dehydrogenase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845432|gb|EFR32827.1| 4-phosphoerythronate dehydrogenase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 315

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 38/81 (46%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K +     GT+++DL  A    I V N+P  N+   AE   + ML + R   
Sbjct: 57  VLDAAKNLKAIFVGSTGTNHIDLEYAKEKNIPVKNSPGQNANAVAELVFAKMLDLYRNSV 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G W K+ ++G E 
Sbjct: 117 QAQNEVKGGIWNKYRWIGREL 137


>gi|323704543|ref|ZP_08116121.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536005|gb|EGB25778.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 320

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   K+K++ R G+G DNVDL  A R G+VV NTP  N  + A+  I LML +AR + 
Sbjct: 66  VINAGTKLKIISRYGVGYDNVDLDAAKRKGVVVTNTPNTNDNSVADLTIGLMLVLARNLL 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G+W++   MG E 
Sbjct: 126 AVDRIVKGGEWKR--IMGTEI 144


>gi|297616224|ref|YP_003701383.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144061|gb|ADI00818.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 528

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++S   ++K+VGRAG G DN+D+   +R GI+V NTP  N+I+ AE  I+L+L+  R   
Sbjct: 59  LVSRGTRLKMVGRAGNGIDNIDVDACTRRGIIVANTPDSNTISAAEQTIALLLSSVRHTA 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     G W++  F GVE 
Sbjct: 119 EANAFLKGGNWDRKPFRGVEL 139


>gi|212224094|ref|YP_002307330.1| glyoxylate reductase [Thermococcus onnurineus NA1]
 gi|226740542|sp|B6YWH0|GYAR_THEON RecName: Full=Glyoxylate reductase
 gi|212009051|gb|ACJ16433.1| glyoxylate reductase [Thermococcus onnurineus NA1]
          Length = 334

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A ++K+V    +G DN+D+  A++ G+ + NTP   +  TA+ A  L+LA AR++ 
Sbjct: 61  VFDAAPRLKIVANYAVGYDNIDIEEATKMGVYITNTPDVLTNATADMAWVLLLATARRLI 120

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A++    G+W+K         F+G + 
Sbjct: 121 EADKFVRSGEWKKRGVAWHPLMFLGYDV 148


>gi|70989461|ref|XP_749580.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
 gi|66847211|gb|EAL87542.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
          Length = 635

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 58/105 (55%), Gaps = 24/105 (22%)

Query: 1   MLSHAKKMKVVGRAGIGTDNV------------------------DLVVASRAGIVVMNT 36
           +L  AK++KVV RAG+G DNV                        D+  A++ GIVV+N+
Sbjct: 64  LLRAAKQLKVVARAGVGVDNVGELAQPPLPPSPSLGSWPLTSHRTDVEEATKLGIVVVNS 123

Query: 37  PFGNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVEA 81
           P GN    AEH I+L++A+AR IP A  S   GKWE+  F+GVE 
Sbjct: 124 PSGNIGAAAEHTIALLMAMARNIPEACSSLKSGKWERSKFVGVEV 168


>gi|206578359|ref|YP_002236948.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Klebsiella pneumoniae 342]
 gi|288933904|ref|YP_003437963.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Klebsiella variicola At-22]
 gi|290511015|ref|ZP_06550384.1| D-3-phosphoglycerate dehydrogenase [Klebsiella sp. 1_1_55]
 gi|206567417|gb|ACI09193.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Klebsiella pneumoniae 342]
 gi|288888633|gb|ADC56951.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Klebsiella variicola At-22]
 gi|289776008|gb|EFD84007.1| D-3-phosphoglycerate dehydrogenase [Klebsiella sp. 1_1_55]
          Length = 315

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+ + G G D +D+  A+  GI+V      N+   +EH  +L+LA A+ + 
Sbjct: 62  VMDAAPALKVIAKHGSGIDVIDVEAATARGIMVRAATGANAAAVSEHTWALILACAKSVI 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +    +G W+K     +E 
Sbjct: 122 PLDRRLREGHWDKSTHKSLEL 142


>gi|297583472|ref|YP_003699252.1| glyoxylate reductase [Bacillus selenitireducens MLS10]
 gi|297141929|gb|ADH98686.1| Glyoxylate reductase [Bacillus selenitireducens MLS10]
          Length = 327

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KV+    +G DN+D+  A+  GIVV NTP   + TTA+   SL++A AR+IP
Sbjct: 63  LMDAAPNLKVIANLAVGFDNIDVEGATARGIVVSNTPNVLTDTTADLTFSLLMATARRIP 122

Query: 61  VANESTHKGKWEKFNFM---GVEA 81
            A     +G+W+ +  +   G + 
Sbjct: 123 EAVNYVREGQWKNWGPLLMAGTDI 146


>gi|164687429|ref|ZP_02211457.1| hypothetical protein CLOBAR_01070 [Clostridium bartlettii DSM
           16795]
 gi|164603203|gb|EDQ96668.1| hypothetical protein CLOBAR_01070 [Clostridium bartlettii DSM
           16795]
          Length = 313

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 4/85 (4%)

Query: 1   MLSHA----KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           ++  A     ++K++ R+G+G DN+D+  A++ GI VMNTP  ++ + AE  I  ++ IA
Sbjct: 59  IIDKALEGNARLKIIIRSGVGLDNIDVKYATKKGIKVMNTPCASTRSVAELTIGQIITIA 118

Query: 57  RQIPVANESTHKGKWEKFNFMGVEA 81
           R + +AN +   G+W K  ++G E 
Sbjct: 119 RFVNIANVTMRDGEWNKKKYIGTEI 143


>gi|331700574|ref|YP_004397533.1| Glyoxylate reductase [Lactobacillus buchneri NRRL B-30929]
 gi|329127917|gb|AEB72470.1| Glyoxylate reductase [Lactobacillus buchneri NRRL B-30929]
          Length = 324

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D   A   GI V NTP  ++ +TAE   +LM+++A ++ 
Sbjct: 62  VIDAAPNLKLIANYGAGFNNIDTDYAKSKGIPVTNTPKVSTTSTAEVTCALMISLAHRVV 121

Query: 61  VANESTH-KG--KWEKFNFMGVEA 81
             ++    KG   W    F+G E 
Sbjct: 122 EGDQLMRTKGFTGWAPLFFLGHEL 145


>gi|315223680|ref|ZP_07865531.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga ochracea F0287]
 gi|314946351|gb|EFS98349.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga ochracea F0287]
          Length = 320

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A ++K +GR G G +N+D+  A   GI ++  P GN     EHA+ ++LA+  +  
Sbjct: 57  FLDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPEGNKNAVGEHALGMLLALLNKFK 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW +    G E 
Sbjct: 117 KANNEIKNGKWLREENRGWEL 137


>gi|260429920|ref|ZP_05783895.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
 gi|260418843|gb|EEX12098.1| D-3-phosphoglycerate dehydrogenase [Citreicella sp. SE45]
          Length = 310

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++V+GR G+G DN+DL   +  G+VV      N+++ AE+ IS+ L++ R + 
Sbjct: 58  VLEAAPGLRVIGRLGVGLDNIDLGACAARGVVVHPATGANTLSVAEYVISVTLSLLRGVH 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +   G W +   +G E 
Sbjct: 118 GANAAMIAGSWPRNALIGAEV 138


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L   KK+K + RAG+G DNVD+   SR GI+ MN P  N+I   E  ++ MLA AR + 
Sbjct: 59  FLEAGKKLKAIVRAGVGVDNVDIDGCSRRGIIAMNVPTANTIAAVELTMAHMLAAARSLE 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+        W++  + GVE 
Sbjct: 119 YAHNDLKLDRIWKREKWYGVEL 140


>gi|305662806|ref|YP_003859094.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
 gi|304377375|gb|ADM27214.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
          Length = 338

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS AK +++V +  +G DN+D+  A+R GI V NTP   +  TAE   +L+L++AR+I 
Sbjct: 62  LLSQAKNLRIVAQLAVGYDNIDVECATRLGIYVTNTPGVLTEATAELTWALILSVARRIV 121

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A+     G+W +          +GVE 
Sbjct: 122 EADHYVRWGEWYRTKTGWHPLMMLGVEL 149


>gi|323698530|ref|ZP_08110442.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfovibrio sp. ND132]
 gi|323458462|gb|EGB14327.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfovibrio desulfuricans ND132]
          Length = 394

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/75 (50%), Positives = 50/75 (66%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K+VGR G+GTDN+DL  A   G++V   P GN+  TAEHA+ LM AIAR++P A+ + 
Sbjct: 66  KLKIVGRGGVGTDNIDLEAAKELGVIVKFAPNGNTNATAEHALGLMFAIARKVPFAHRTL 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W K  F GVE 
Sbjct: 126 MGGTWHKKRFKGVEL 140


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ AK +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ MLA AR  P
Sbjct: 59  FLNAAKNLKALVRAGVGVDNVDIDGCSKRGIIAMNVPTANTIAAVELTMAHMLAAARSFP 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+        W++  + GVE 
Sbjct: 119 YAHNDLKIDRIWKREKWYGVEL 140


>gi|269963389|ref|ZP_06177717.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269831868|gb|EEZ85999.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 320

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++  A  G +NVD+   +   I V N     + +  EH I+++ A+ R + 
Sbjct: 61  VLSQLPNLKMIAVAATGFNNVDINYCAEHNISVANVRGYATRSVPEHVIAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|242309368|ref|ZP_04808523.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523939|gb|EEQ63805.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 406

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  AKK++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLEAAKKLRAVVRAGVGVDNVDIEASSKKGVVVMNVPTANTIAAVELTCAHILSAIRTFP 120

Query: 61  VANESTHK-GKWEKFNFMGVEA 81
            AN       KW++ ++ G E 
Sbjct: 121 SANAQLKNERKWKREDWYGTEL 142


>gi|240168941|ref|ZP_04747600.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium kansasii ATCC
           12478]
          Length = 528

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 55/81 (67%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K+K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP
Sbjct: 59  VLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHAIALLLAAARQIP 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +     W++ +F G E 
Sbjct: 119 AADATLRVRTWKRSSFSGTEI 139


>gi|300693643|ref|YP_003749616.1| glyoxylate reductase [Ralstonia solanacearum PSI07]
 gi|299075680|emb|CBJ34977.1| Glyoxylate reductase [Ralstonia solanacearum PSI07]
          Length = 331

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K V   G+G +N+D+   +  G+VV NTP   + TTA+   +LMLA AR+I 
Sbjct: 61  LLDACPGLKAVCNVGVGYNNIDVAACTARGVVVTNTPDVLTQTTADFGFALMLATARRIT 120

Query: 61  VANESTHKGKWEKFN 75
            +     +G+W+K  
Sbjct: 121 ESERFVRRGEWQKTG 135


>gi|307730556|ref|YP_003907780.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Burkholderia sp. CCGE1003]
 gi|307585091|gb|ADN58489.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Burkholderia sp. CCGE1003]
          Length = 329

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      GKW+K+++ G   G
Sbjct: 118 ESEHWLRAGKWQKWSYDGF-LG 138


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LS  + +KV+GRAG+G DN+DL  AS+ GIVV+N P GN++   EH ++ ML   R +P
Sbjct: 59  FLSFCENLKVIGRAGVGVDNIDLDEASKRGIVVLNMPTGNTLAATEHTMTHMLNCLRFMP 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN     K KW++  +MG+E 
Sbjct: 119 NANYELKYKHKWDRKKWMGIEL 140


>gi|330825140|ref|YP_004388443.1| glycerate dehydrogenase [Alicycliphilus denitrificans K601]
 gi|329310512|gb|AEB84927.1| Glycerate dehydrogenase [Alicycliphilus denitrificans K601]
          Length = 320

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++++  A  GTDN+DL      GIVV N     + T  EH  +L+ A+ R I 
Sbjct: 58  VLAQAPRLRLIAVAATGTDNIDLAACQARGIVVSNIRGYATHTVPEHTFALIFALRRSIC 117

Query: 61  VANESTHKGKWEKFN 75
              ++   G+W++ +
Sbjct: 118 AYRDAVRAGRWQQAD 132


>gi|319763061|ref|YP_004126998.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Alicycliphilus denitrificans BC]
 gi|317117622|gb|ADV00111.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Alicycliphilus denitrificans BC]
          Length = 320

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++++  A  GTDN+DL      GIVV N     + T  EH  +L+ A+ R I 
Sbjct: 58  VLAQAPRLRLIAVAATGTDNIDLAACQARGIVVSNIRGYATHTVPEHTFALIFALRRSIC 117

Query: 61  VANESTHKGKWEKFN 75
              ++   G+W++ +
Sbjct: 118 AYRDAVRAGRWQQAD 132


>gi|116750557|ref|YP_847244.1| D-isomer specific 2-hydroxyacid dehydrogenase [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699621|gb|ABK18809.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Syntrophobacter fumaroxidans MPOB]
          Length = 317

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+GR G+G D +DL  A   G+ V+ TP  N+ + AEH + + + +A+ I 
Sbjct: 60  LIESAPRLKVIGRHGVGLDAIDLRCAKERGVKVVFTPTANTESVAEHFVGMAIMLAKMIR 119

Query: 61  VANESTHKGKW-EKFNFMGVEA 81
             + +   G W  +   +G E 
Sbjct: 120 TGDIALRTGDWAARNRLIGTEL 141


>gi|171058672|ref|YP_001791021.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Leptothrix cholodnii SP-6]
 gi|170776117|gb|ACB34256.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Leptothrix cholodnii SP-6]
          Length = 332

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V    +G +N+D+   +  G++  N P   + TTA+   +LM+A AR+I 
Sbjct: 67  VLAACPQLKAVCSMAVGYNNIDVPACTERGVLASNAPDVLTETTADFGFALMMATARRIT 126

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            +     +G+W K+    F G + 
Sbjct: 127 ESERFLRRGEWNKWAVDMFAGQDV 150


>gi|255534321|ref|YP_003094692.1| D-3-phosphoglycerate dehydrogenase [Flavobacteriaceae bacterium
           3519-10]
 gi|255340517|gb|ACU06630.1| D-3-phosphoglycerate dehydrogenase [Flavobacteriaceae bacterium
           3519-10]
          Length = 312

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            + HAK +K + R G G +N+D+  A R  I V+++P GN    AEH + ++L +  ++ 
Sbjct: 58  FIEHAKNLKFIARVGAGLENIDVEFAERNNIRVISSPEGNRDAVAEHVLGMLLILMHRLL 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +++     G W +    G E 
Sbjct: 118 ISSHEVKNGIWRREENRGDEL 138


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 59/81 (72%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK++K++ RAGIG +N+ +  A+  GIVV NTP G++ T AEHAI++M+++AR IP
Sbjct: 58  LIFAAKRLKIIARAGIGVENIAMDAANIKGIVVTNTPLGSTTTIAEHAIAMMMSLARLIP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ES  +GKW+   F+G + 
Sbjct: 118 QAHESMSQGKWQSTEFLGSDI 138


>gi|283833163|ref|ZP_06352904.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
 gi|291070794|gb|EFE08903.1| D-3-phosphoglycerate dehydrogenase [Citrobacter youngae ATCC 29220]
          Length = 316

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +K+V + G+G DN+DL      GI V N P  N    A+ A SL+L  ARQ+P
Sbjct: 61  LLAAAPNLKIVCKHGVGVDNIDLNATREKGIYVTNVPDANKHAVADFAFSLILNCARQLP 120

Query: 61  VANESTHKGKWEK 73
            A E T  G+W +
Sbjct: 121 QAIEQTRAGRWPR 133


>gi|240102622|ref|YP_002958931.1| D-isomer specific 2-hydroxyacid dehydrogenase [Thermococcus
           gammatolerans EJ3]
 gi|239910176|gb|ACS33067.1| D-isomer specific 2-hydroxyacid dehydrogenase [Thermococcus
           gammatolerans EJ3]
          Length = 333

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KV+     G D+VD+  A+R GI V       S   AE A+ L +A+ R+I 
Sbjct: 58  VLERAGRLKVISCHSAGYDHVDVETATRKGIYVTKVAGVLSEAVAEFAVGLTIALLRKIA 117

Query: 61  VANESTHKGKWE-----KFNFMGVE 80
            A+     GKW+        F G+E
Sbjct: 118 YADRFIRSGKWDSHRTVWSGFKGIE 142


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A +++VV RAG+G DNVD+  A++AG++V+N P  N I+ AE AI+L+LA AR    
Sbjct: 60  IAAASRLQVVARAGVGLDNVDVEAATKAGVLVVNAPTSNIISAAEQAINLLLASARNTAP 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ +   G+W++  + GVE 
Sbjct: 120 AHNALVNGEWKRSKYTGVEL 139


>gi|217077225|ref|YP_002334943.1| glyoxylate reductase [Thermosipho africanus TCF52B]
 gi|217037080|gb|ACJ75602.1| glyoxylate reductase [Thermosipho africanus TCF52B]
          Length = 317

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +   KK+K++    +G +N+D+  A + GI V NTP   +  TA+ A +L+LA+AR+I 
Sbjct: 59  FIDAGKKLKIIANYAVGFNNIDVEYAKQKGIYVTNTPDVLTEATADIAWALILAVARKII 118

Query: 61  VANESTHKGK---WEKFNFMGVEA 81
            A++ T +GK   W+   F+G E 
Sbjct: 119 PADKFTREGKFEGWKPNLFLGYEI 142


>gi|255635543|gb|ACU18122.1| unknown [Glycine max]
          Length = 313

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K+++V    +G D +DL      GI V NTP   +   A+ AI LMLA+ R+I 
Sbjct: 61  LIEALPKLEIVSSFSVGVDRIDLDRCKEKGIRVTNTPDVLTDEVADLAIGLMLALLRRIC 120

Query: 61  VANESTHKGKWEKFNFM 77
             +     GKW+K ++ 
Sbjct: 121 ECDRYVRSGKWKKGDYK 137


>gi|170696360|ref|ZP_02887490.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia graminis C4D1M]
 gi|170138766|gb|EDT06964.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia graminis C4D1M]
          Length = 329

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      GKW+K+++ G   G
Sbjct: 118 ESEHWLRAGKWQKWSYDGF-LG 138


>gi|313677279|ref|YP_004055275.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Marivirga tractuosa DSM 4126]
 gi|312943977|gb|ADR23167.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Marivirga tractuosa DSM 4126]
          Length = 312

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +AKK+  V RAG G DNV++    +  I ++N P GN    AEHA+ ++L +  +I 
Sbjct: 57  LLKNAKKLVFVARAGAGVDNVEVEELKKRNIELINAPEGNRDALAEHAMGMLLTLFNKIN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW++    GVE 
Sbjct: 117 TADLEVRSGKWDREGNRGVEL 137


>gi|312126740|ref|YP_003991614.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311776759|gb|ADQ06245.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 332

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K KV+GR G+G + +D+  A+  GI V+N P       ++HA++L+L +AR+I 
Sbjct: 62  VIESLPKCKVIGRYGVGVNTIDIEAATEKGICVVNVPDYCMDEVSDHALALILTLARKIV 121

Query: 61  VANESTHKGKWEKF 74
           + N S  KG W+  
Sbjct: 122 LLNNSVKKGIWDYK 135


>gi|195578477|ref|XP_002079092.1| GD22186 [Drosophila simulans]
 gi|194191101|gb|EDX04677.1| GD22186 [Drosophila simulans]
          Length = 332

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+     +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +
Sbjct: 62  VLAAGSGSLKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYAGTEL 143


>gi|194861776|ref|XP_001969855.1| GG10320 [Drosophila erecta]
 gi|190661722|gb|EDV58914.1| GG10320 [Drosophila erecta]
          Length = 332

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+     +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +
Sbjct: 62  VLAAGSGSLKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYAGTEL 143


>gi|195340089|ref|XP_002036649.1| GM11122 [Drosophila sechellia]
 gi|66803829|gb|AAY56642.1| unknown [Drosophila simulans]
 gi|194130529|gb|EDW52572.1| GM11122 [Drosophila sechellia]
          Length = 332

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+     +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +
Sbjct: 62  VLAAGSGSLKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYAGTEL 143


>gi|19921140|ref|NP_609496.1| CG6287 [Drosophila melanogaster]
 gi|7297831|gb|AAF53080.1| CG6287 [Drosophila melanogaster]
 gi|16182520|gb|AAL13511.1| GH03305p [Drosophila melanogaster]
 gi|66803815|gb|AAY56641.1| unknown [Drosophila melanogaster]
 gi|220947538|gb|ACL86312.1| CG6287-PA [synthetic construct]
 gi|220956928|gb|ACL91007.1| CG6287-PA [synthetic construct]
          Length = 332

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+     +KVVGRAG G DN+D+  A+   +VV+NTP GNSI+  E    L+ ++AR +
Sbjct: 62  VLAAGSGSLKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPV 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A +S  +G+W++  + G E 
Sbjct: 122 VPAGQSMKEGRWDRKLYAGTEL 143


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+  KK+K + RAG+G DNVD+   SR GI+ MN P  N+I   E  ++ MLA AR + 
Sbjct: 59  FLNAGKKLKAIVRAGVGVDNVDIDGCSRRGIIAMNVPTANTIAAVELTMAHMLAAARSLE 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+        W++  + GVE 
Sbjct: 119 YAHNDLKLNRIWKREKWYGVEL 140


>gi|157364619|ref|YP_001471386.1| phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
 gi|157315223|gb|ABV34322.1| Phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
          Length = 303

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  +K+KV+GRAG+G DN+D+  A + GI V+NTP  +SI+ AE    L+L+ +R I 
Sbjct: 58  LINKGEKLKVIGRAGVGLDNIDVTAAKQKGIKVLNTPGASSISVAELTFGLILSASRHIA 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                  KG W K    G E 
Sbjct: 118 RGTCDLKKGLWTKKELEGHEL 138


>gi|299782783|gb|ADJ40781.1| Glyoxylate reductase [Lactobacillus fermentum CECT 5716]
          Length = 323

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D   A + GI V NTPF +S+ TAE A  L +A++R+I 
Sbjct: 61  VIDAAPNLKLIANFGAGFNNIDTAYARKKGIDVTNTPFVSSVATAEIASGLAIALSRRIV 120

Query: 61  VANESTHK---GKWEKFNFMGVEA 81
             +          W    F G E 
Sbjct: 121 EGDHVMRTVGFDGWAPLFFRGHEL 144


>gi|284047458|ref|YP_003397797.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acidaminococcus fermentans DSM 20731]
 gi|283951679|gb|ADB46482.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acidaminococcus fermentans DSM 20731]
          Length = 319

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K++ R GIG +N+DL       + V      N+ + AEHAISLMLA  RQIP
Sbjct: 57  VVDAGKNLKIIARYGIGYENIDLAACDAKNVTVTLARGCNTYSVAEHAISLMLACFRQIP 116

Query: 61  VANESTHKGKWE 72
             N+   KG W+
Sbjct: 117 QLNQEVRKGNWK 128


>gi|227514270|ref|ZP_03944319.1| glyoxylate reductase [Lactobacillus fermentum ATCC 14931]
 gi|227087351|gb|EEI22663.1| glyoxylate reductase [Lactobacillus fermentum ATCC 14931]
          Length = 323

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D   A + GI V NTPF +S+ TAE A  L +A++R+I 
Sbjct: 61  VIDAAPNLKLIANFGAGFNNIDTAYARKKGIDVTNTPFVSSVATAEIASGLAIALSRRIV 120

Query: 61  VANESTHK---GKWEKFNFMGVEA 81
             +          W    F G E 
Sbjct: 121 EGDHVMRTVGFDGWAPLFFRGHEL 144


>gi|184154635|ref|YP_001842975.1| phosphoglycerate dehydrogenase [Lactobacillus fermentum IFO 3956]
 gi|260663684|ref|ZP_05864572.1| phosphoglycerate dehydrogenase [Lactobacillus fermentum 28-3-CHN]
 gi|183225979|dbj|BAG26495.1| phosphoglycerate dehydrogenase [Lactobacillus fermentum IFO 3956]
 gi|260551735|gb|EEX24851.1| phosphoglycerate dehydrogenase [Lactobacillus fermentum 28-3-CHN]
          Length = 323

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D   A + GI V NTPF +S+ TAE A  L +A++R+I 
Sbjct: 61  VIDAAPNLKLIANFGAGFNNIDTAYARKKGIDVTNTPFVSSVATAEIASGLAIALSRRIV 120

Query: 61  VANESTHK---GKWEKFNFMGVEA 81
             +          W    F G E 
Sbjct: 121 EGDHVMRTVGFDGWAPLFFRGHEL 144


>gi|253681089|ref|ZP_04861892.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum D str.
           1873]
 gi|253562938|gb|EES92384.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum D str.
           1873]
          Length = 315

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +KVVGRAG G DN+++  A++ GI+V NTP  N+I+  E  I+ +LA +R   
Sbjct: 59  LMERAINLKVVGRAGNGVDNINIEEATKRGIIVANTPDSNAISACEITIAHILAGSRNFT 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKWE+  FMG E 
Sbjct: 119 YADSYLKSGKWERDLFMGNEL 139


>gi|312375947|gb|EFR23183.1| hypothetical protein AND_13366 [Anopheles darlingi]
          Length = 1061

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   A ++K VGRAG G DN+++  A++  ++V+NTP GNSI+  E    L+ A+AR I
Sbjct: 62  ILDAGAGRVKAVGRAGAGVDNINIEAATKNNVLVLNTPGGNSISACELTCFLIGALARPI 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A  S  +G+W++  + G E 
Sbjct: 122 CPAATSMKEGRWDRKLYSGTEL 143


>gi|118576136|ref|YP_875879.1| phosphoglycerate dehydrogenase [Cenarchaeum symbiosum A]
 gi|118194657|gb|ABK77575.1| phosphoglycerate dehydrogenase [Cenarchaeum symbiosum A]
          Length = 310

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK  K++ R G+G DN+DL  A  AG+ V+N   G +   +E  + +ML +ARQIP
Sbjct: 61  IIRSAKDCKIIARVGVGLDNIDLAAAESAGVRVINAVEGATTAVSELVLGMMLCMARQIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     GKW K    G E 
Sbjct: 121 RADRGIRGGKWLKGELGGTEL 141


>gi|327403414|ref|YP_004344252.1| phosphoglycerate dehydrogenase [Fluviicola taffensis DSM 16823]
 gi|327318922|gb|AEA43414.1| Phosphoglycerate dehydrogenase [Fluviicola taffensis DSM 16823]
          Length = 315

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 40/76 (52%)

Query: 6   KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANES 65
             ++ + R+G G +N+D     + GI + N P GN     EHA+ ++L++  +I  AN  
Sbjct: 64  PNLQFIARSGAGMENIDEAYCQKRGIQLYNAPEGNRNAVGEHALGMLLSMMNKIHTANRD 123

Query: 66  THKGKWEKFNFMGVEA 81
             KG W++    GVE 
Sbjct: 124 VKKGIWDREGNRGVEL 139


>gi|269837241|ref|YP_003319469.1| glyoxylate reductase [Sphaerobacter thermophilus DSM 20745]
 gi|269786504|gb|ACZ38647.1| Glyoxylate reductase [Sphaerobacter thermophilus DSM 20745]
          Length = 324

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     ++VV    +G DN+D+   +  G+ V  TP   + TTA+ A  L+LA+AR+IP
Sbjct: 59  LLDRLPSVRVVSNMAVGFDNIDVAACTERGVAVCTTPDVLTETTADLAFGLLLAVARRIP 118

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + +   G W  +  MG   G
Sbjct: 119 EGHNAVRAGAWRTWEPMGY-LG 139


>gi|323526889|ref|YP_004229042.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Burkholderia sp. CCGE1001]
 gi|323383891|gb|ADX55982.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           protein [Burkholderia sp. CCGE1001]
          Length = 329

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      GKW+K+   +F+G + 
Sbjct: 118 ESEHWLRAGKWQKWSYDSFLGSDL 141


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 49/81 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A ++ +VGRAGIG DN+D+  A+  G++V N P GN    AEH +++  A+AR IP
Sbjct: 57  VFEAASELVIVGRAGIGVDNIDIEAATDHGVIVANAPEGNVRAAAEHTVAMTFAVARSIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W K  F+G E 
Sbjct: 117 QAHGRLLGGEWAKGEFLGTEV 137


>gi|94468936|gb|ABF18317.1| phosphoglycerate dehydrogenase [Aedes aegypti]
          Length = 332

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K VGRAG G DN+D+V A+R  ++V+N P GNSI+  E    L+ A+AR    A  S 
Sbjct: 69  KLKAVGRAGAGVDNIDIVAATRNNVIVLNAPGGNSISACELTCFLIGALARPFCPAASSM 128

Query: 67  HKGKWEKFNFMGVEA 81
            +G+W++  + G E 
Sbjct: 129 KEGRWDRKLYSGSEL 143


>gi|326390875|ref|ZP_08212427.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993134|gb|EGD51574.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 533

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVTAATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|306819975|ref|ZP_07453626.1| phosphoglycerate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304552011|gb|EFM39951.1| phosphoglycerate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 326

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +    K+K +G AGIG +++D+  A   GI + N P G++   +E AI  ML + R+I 
Sbjct: 76  FVDAGVKLKAIGMAGIGLNHIDVEYAKSKGIGIFNVPDGSTTAVSELAIGTMLNVLRKIG 135

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     G W+K  F G E 
Sbjct: 136 NANTYVKAGNWDKTGFTGNEI 156


>gi|163795807|ref|ZP_02189771.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159178840|gb|EDP63376.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 313

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 41/74 (55%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +     +KV+   G+G D VD+  A+  GI V NTP   S   A+ AI+L +A  R+IP 
Sbjct: 61  MDALPNVKVIAHHGVGYDGVDVAAATARGIKVSNTPDVLSDEVADFAIALTMATCRRIPQ 120

Query: 62  ANESTHKGKWEKFN 75
           A+    +G+WE+  
Sbjct: 121 ADRYVREGRWEREG 134


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LS AK +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ MLA AR  P
Sbjct: 59  FLSAAKNLKALVRAGVGVDNVDMDGCSKRGIIAMNVPTANTIAAVELTMAHMLAAARSFP 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+        W++  + GVE 
Sbjct: 119 YAHNDLKIDRIWKREKWYGVEL 140


>gi|149911721|ref|ZP_01900328.1| D-lactate dehydrogenase [Moritella sp. PE36]
 gi|149805194|gb|EDM65212.1| D-lactate dehydrogenase [Moritella sp. PE36]
          Length = 317

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  A  GT+N+DL    +  I V N     + +  EH +++M A+ R + 
Sbjct: 59  VLSQCPQLKMIAVAATGTNNIDLEYCRQHKITVSNIQDYATNSVPEHVVAMMFALKRNLV 118

Query: 61  VANESTHKGKWEKFN 75
             ++    G W++  
Sbjct: 119 GYHKDIQAGVWQQQK 133


>gi|227115489|ref|ZP_03829145.1| glyoxylate reductase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 316

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA ++K+V + G+G DN+DL       I V N P  N    A+ A SL+L  ARQI 
Sbjct: 61  LLKHAPQLKIVCKHGVGVDNIDLDATKNRNIFVTNVPNANKHAVADFAFSLLLNCARQIS 120

Query: 61  VANESTHKGKWEK 73
            A + T  G W +
Sbjct: 121 QAEKQTRAGNWPR 133


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ ML+  R+ P
Sbjct: 61  FLNAAVNLKAIIRAGVGYDNVDMEGCSKRGIIAMNVPTANTIAAVELTMTHMLSCMRKFP 120

Query: 61  VANESTHK-GKWEKFNFMGVEA 81
            A+        W++ ++ G E 
Sbjct: 121 YAHNQLKNERVWKREDWYGNEL 142


>gi|189347380|ref|YP_001943909.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chlorobium limicola DSM 245]
 gi|189341527|gb|ACD90930.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Chlorobium limicola DSM 245]
          Length = 305

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 49/82 (59%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +   ++ + R G+G D+VDL  A + GIVV NTP G + + AE  I++ LA+ R++P
Sbjct: 64  VMDNLPNLRCISRVGVGMDSVDLDYAKQKGIVVTNTPDGPTRSVAELTIAMTLALLRKVP 123

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+ +  +G W+K      E G
Sbjct: 124 QAHMNIKQGVWKK------EIG 139


>gi|168206154|ref|ZP_02632159.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens E str. JGS1987]
 gi|170662347|gb|EDT15030.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens E str. JGS1987]
          Length = 301

 Score = 77.2 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|319647638|ref|ZP_08001856.1| hypothetical protein HMPREF1012_02895 [Bacillus sp. BT1B_CT2]
 gi|317389979|gb|EFV70788.1| hypothetical protein HMPREF1012_02895 [Bacillus sp. BT1B_CT2]
          Length = 320

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN+D+  A +  ++  NTP   + +TA+   +L++A AR+I 
Sbjct: 63  LLKGAPHLKVVANLAVGYDNIDVEAAQKHRVICCNTPGVLTESTADLTFALLMASARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A++   +GKW  + 
Sbjct: 123 EASDWIRQGKWTGWG 137


>gi|313672171|ref|YP_004050282.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938927|gb|ADR18119.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 316

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 52/84 (61%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +AKK+K++    +G +N+D+V A   GIVV NTP   + TTAE A +LM+++AR++ 
Sbjct: 59  LIDNAKKLKIIVNYAVGFNNIDVVYAKEKGIVVCNTPHILTETTAELAFALMISVARRVV 118

Query: 61  VANESTHKGK---WEKFNFMGVEA 81
            A+  T  G+   W    F+G + 
Sbjct: 119 EADRFTRGGRFKGWTPNLFLGTDL 142


>gi|91784738|ref|YP_559944.1| putative 2-ketogluconate reductase [Burkholderia xenovorans LB400]
 gi|91688692|gb|ABE31892.1| Putative 2-ketogluconate reductase [Burkholderia xenovorans LB400]
          Length = 329

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMTAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      GKW+K+ + G   G
Sbjct: 118 ESEHWLRAGKWQKWTYDGF-LG 138


>gi|52081721|ref|YP_080512.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD binding
           domain-containing protein [Bacillus licheniformis ATCC
           14580]
 gi|52787107|ref|YP_092936.1| hypothetical protein BLi03415 [Bacillus licheniformis ATCC 14580]
 gi|52004932|gb|AAU24874.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain,D-isomer specific 2-hydroxyacid dehydrogenase,
           NAD binding domain [Bacillus licheniformis ATCC 14580]
 gi|52349609|gb|AAU42243.1| putative protein [Bacillus licheniformis ATCC 14580]
          Length = 320

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN+D+  A +  ++  NTP   + +TA+   +L++A AR+I 
Sbjct: 63  LLKGAPHLKVVANLAVGYDNIDVEAAQKHRVICCNTPGVLTESTADLTFALLMASARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A++   +GKW  + 
Sbjct: 123 EASDWIRQGKWTGWG 137


>gi|311031760|ref|ZP_07709850.1| 2-hydroxyacid dehydrogenase [Bacillus sp. m3-13]
          Length = 321

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN+D++ AS  G+ V NTP   + TTA+   +LMLA AR+I 
Sbjct: 63  LLESAPNLKVVANLAVGYDNIDVMAASERGVTVCNTPDVLTETTADLTFALMLATARRIT 122

Query: 61  VANESTHKGKWEKFN 75
            + E   +G+W+ ++
Sbjct: 123 ESQEFVKEGRWQSWS 137


>gi|58392734|ref|XP_319591.2| AGAP008849-PA [Anopheles gambiae str. PEST]
 gi|55235140|gb|EAA14798.3| AGAP008849-PA [Anopheles gambiae str. PEST]
          Length = 332

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L   A ++K VGRAG G DN+++  A+R  ++V+NTP GNSI+  E    L+ A+AR I
Sbjct: 62  ILDAGAGRVKAVGRAGAGVDNINIEAATRNNVLVLNTPGGNSISACELTCFLIGALARPI 121

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A  S  +G+W++  + G E 
Sbjct: 122 CPAATSMKEGRWDRKLYSGSEL 143


>gi|300697533|ref|YP_003748194.1| glyoxylate reductase [Ralstonia solanacearum CFBP2957]
 gi|299074257|emb|CBJ53802.1| Glyoxylate reductase [Ralstonia solanacearum CFBP2957]
          Length = 331

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K V   G+G +NVD+   +  G+VV NTP   + TTA+   +LMLA AR+I 
Sbjct: 61  LLDACPGLKAVCNVGVGYNNVDVAACTARGVVVTNTPDVLTQTTADFGFALMLATARRIT 120

Query: 61  VANESTHKGKWEKFN 75
            +     +G+W+K  
Sbjct: 121 ESERFVRRGEWQKTG 135


>gi|83747876|ref|ZP_00944908.1| 2-hydroxyacid dehydrogenase [Ralstonia solanacearum UW551]
 gi|207739265|ref|YP_002257658.1| dehydrogenase protein [Ralstonia solanacearum IPO1609]
 gi|83725409|gb|EAP72555.1| 2-hydroxyacid dehydrogenase [Ralstonia solanacearum UW551]
 gi|206592638|emb|CAQ59544.1| dehydrogenase protein [Ralstonia solanacearum IPO1609]
          Length = 331

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K V   G+G +NVD+   +  G+VV NTP   + TTA+   +LMLA AR+I 
Sbjct: 61  LLDACPGLKAVCNVGVGYNNVDVAACTARGVVVTNTPDVLTQTTADFGFALMLATARRIT 120

Query: 61  VANESTHKGKWEKFN 75
            +     +G+W+K  
Sbjct: 121 ESERFVRRGEWQKTG 135


>gi|226225601|ref|YP_002759707.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
 gi|226088792|dbj|BAH37237.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
          Length = 534

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K+KVVGRAG+G DN++L VA+  GI ++N P GN++  AE     ++ + RQ+ 
Sbjct: 59  LLKAGGKLKVVGRAGVGVDNIELDVATSLGIAIINAPAGNTVAVAELFFGTVIGLLRQLH 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G+W++  FMG E 
Sbjct: 119 TAAAAMGDGRWDRAKFMGREL 139


>gi|206575919|ref|YP_002238583.1| glyoxylate reductase [Klebsiella pneumoniae 342]
 gi|206564977|gb|ACI06753.1| glyoxylate reductase [Klebsiella pneumoniae 342]
          Length = 316

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 38/73 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++K+V + G+G DN+DL    +  I V N P  N    A+ A  L+L  ARQI 
Sbjct: 61  LLEKAPRLKIVCKHGVGVDNIDLNATRQRNIFVTNVPDANKHAVADFAFGLILNTARQIS 120

Query: 61  VANESTHKGKWEK 73
            A   T  G W +
Sbjct: 121 QAISETKAGNWPR 133


>gi|253576601|ref|ZP_04853929.1| gluconate 2-dehydrogenase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251844015|gb|EES72035.1| gluconate 2-dehydrogenase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 332

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 39/73 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G +N DL      G++  NT    + T A+   +LML +AR++ 
Sbjct: 60  LLDHAPKLKVVSNISVGYNNFDLEAMKARGVLGTNTSAVLNDTVADLIFALMLDVARRVS 119

Query: 61  VANESTHKGKWEK 73
             +     GKW++
Sbjct: 120 ELDRYVKAGKWKR 132


>gi|153956400|ref|YP_001397165.1| phosphoglycerate dehydrogenase [Clostridium kluyveri DSM 555]
 gi|219856713|ref|YP_002473835.1| hypothetical protein CKR_3370 [Clostridium kluyveri NBRC 12016]
 gi|146349258|gb|EDK35794.1| Predicted phosphoglycerate dehydrogenase [Clostridium kluyveri DSM
           555]
 gi|219570437|dbj|BAH08421.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 310

 Score = 76.8 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 1   MLSHAK--KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++  AK  K+K++ R G+G DN+D+  A + GIVV NTP  ++ + AE  ++ M AI+R 
Sbjct: 57  LIDAAKDGKLKLIIRGGVGVDNIDVDYALQNGIVVKNTPNASAASVAELTLAHMFAISRY 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           + ++N +    +W K  + GVE 
Sbjct: 117 VNISNVTMRNNEWHKSQYKGVEL 139


>gi|332178869|gb|AEE14558.1| Glyoxylate reductase [Thermodesulfobium narugense DSM 14796]
          Length = 322

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 38/74 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK+KVV +  +G DN+D+   +   I V NTP      TAE    L++  AR I 
Sbjct: 62  LLEDAKKLKVVSQCAVGYDNIDVNYCTERKIPVCNTPHVVVEATAELTYGLLICAARDII 121

Query: 61  VANESTHKGKWEKF 74
            A     +GKW K 
Sbjct: 122 NAVNYVKEGKWIKN 135


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L+ AR   
Sbjct: 60  FLNHAKKLKALIRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLSSARSFV 119

Query: 61  VANESTHK-GKWEKFNFMGVEA 81
            A+       KWE+  + GVE 
Sbjct: 120 NAHNFLKNERKWEREKWYGVEL 141


>gi|78358728|ref|YP_390177.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78221133|gb|ABB40482.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 305

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +KV+ R G G DNVD+  A   GI V NTP G +   AE  + L L + RQ+ 
Sbjct: 63  VMDALPGLKVISRCGTGMDNVDMEAARARGIAVRNTPDGPTQAVAELTLGLALDLMRQVS 122

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G W+K   MG   G
Sbjct: 123 RMDRELRSGVWKKR--MGNLLG 142


>gi|329889676|ref|ZP_08268019.1| glyoxylate reductase [Brevundimonas diminuta ATCC 11568]
 gi|328844977|gb|EGF94541.1| glyoxylate reductase [Brevundimonas diminuta ATCC 11568]
          Length = 347

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++++V     G D++DL      G+ V N P     T AEHA +L+LA++R + 
Sbjct: 58  VIAALPRLRLVATRSTGFDHIDLEACRARGVAVCNVPDYGDPTVAEHAFALLLAVSRHVV 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A + T +G +      G + 
Sbjct: 118 EAADRTRRGDFHVEGLRGFDL 138


>gi|289579412|ref|YP_003478039.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
 gi|289529125|gb|ADD03477.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
          Length = 533

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  + LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNIVAAAELTVGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|297545554|ref|YP_003677856.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843329|gb|ADH61845.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 533

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +K+KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  + LMLAIAR IP
Sbjct: 56  LIEKGEKLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNIVAAAELTVGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L+ AR   
Sbjct: 60  FLNHAKKLKALIRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLSSARSFV 119

Query: 61  VANESTHK-GKWEKFNFMGVEA 81
            A+       KWE+  + GVE 
Sbjct: 120 NAHNFLKNERKWEREKWYGVEL 141


>gi|288557127|ref|YP_003429194.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bacillus
           pseudofirmus OF4]
 gi|288548421|gb|ADC52302.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bacillus
           pseudofirmus OF4]
          Length = 328

 Score = 76.8 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 49/77 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+    +G +N+D+  A+  GI+V NTP   + TTA+   +L++A AR++ 
Sbjct: 62  LLNKANNLKVISNMAVGYNNIDVEAATNKGIIVSNTPDVLTETTADITFALLMATARRLV 121

Query: 61  VANESTHKGKWEKFNFM 77
            A++   +GKW+ ++ M
Sbjct: 122 EASDYLREGKWKTWSPM 138


>gi|289642877|ref|ZP_06475013.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
 gi|289507354|gb|EFD28317.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
          Length = 529

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 60/81 (74%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A+ +KVV RAGIG DNVD+V A+  G++V+N P  N ++ AEHA++L+ A+AR+IP
Sbjct: 57  VLAAARSLKVVARAGIGLDNVDVVTATTRGVMVVNAPLSNIVSAAEHAVALLAAVARRIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN +   G+W++  ++GVE 
Sbjct: 117 AANAALRGGEWKRSKYVGVEL 137


>gi|307692725|ref|ZP_07634962.1| D-3-phosphoglycerate dehydrogenase [Ruminococcaceae bacterium D16]
          Length = 312

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +KV+G   +G +++D+  A   GI   N P  N+   AE   S ML ++R   
Sbjct: 56  ILDAAKNLKVIGVCSVGLNHIDMDTAKAKGIQAFNAPGMNANAVAELTFSKMLDLSRHTI 115

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN        W+K+ F+G E 
Sbjct: 116 PANYDVKVNKNWDKYKFVGREL 137


>gi|269968013|ref|ZP_06182051.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827370|gb|EEZ81666.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 320

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++++  A  G +NVD+   +   I V N     + +  EH ++++ A+ R + 
Sbjct: 61  VLEQLPKLRMIAVAATGFNNVDVNYCANHDIAVANVRGYATRSVPEHVMAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNQ 135


>gi|240103924|ref|YP_002960233.1| glyoxylate reductase [Thermococcus gammatolerans EJ3]
 gi|259647698|sp|C5A1V0|GYAR_THEGJ RecName: Full=Glyoxylate reductase
 gi|239911478|gb|ACS34369.1| Glyoxylate reductase (gyaR) [Thermococcus gammatolerans EJ3]
          Length = 334

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A ++++V    +G DNVD+  A+R GI V NTP   +  TA+ A +L+LA AR++ 
Sbjct: 61  VFDNAPRLRIVANYAVGYDNVDVEEATRRGIYVTNTPDVLTNATADFAWTLLLATARRLI 120

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A+  T  G+W++         F+G + 
Sbjct: 121 EADSFTRSGEWKRKGIAWHPLMFLGHDV 148


>gi|291562620|emb|CBL41436.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [butyrate-producing bacterium SS3/4]
          Length = 319

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +KV+G  G+G D VD+  AS   + V+ TP  NS++ AEH ++LM A A+ + 
Sbjct: 56  VIDACPNLKVIGITGVGYDRVDVAHASGKKLPVVFTPGANSLSVAEHTVALMFAAAKNLS 115

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
            ++E   KG W+ +     +E 
Sbjct: 116 ESDEELRKGNWKIRDAGKAIEL 137


>gi|111025626|ref|YP_708046.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110824605|gb|ABG99888.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 325

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++V+ RAG+G DN+D+  A+ AG+VV+     N+I+ AEH I + LA  R+  
Sbjct: 65  LIEACPSLRVIARAGVGLDNIDVKCANEAGVVVVAPLGANAISVAEHTIGMALAAVRRTV 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +    +G WE+    G E 
Sbjct: 125 ELDADCRRGGWERTP--GREL 143


>gi|124266704|ref|YP_001020708.1| putative 2-hydroxyacid dehydrogenase [Methylibium petroleiphilum
           PM1]
 gi|124259479|gb|ABM94473.1| putative 2-hydroxyacid dehydrogenase [Methylibium petroleiphilum
           PM1]
          Length = 330

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 45/76 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++ V    +G +N+D+   +  G++V NTP   + TTA+   +LM+A AR+I 
Sbjct: 60  VLAACPQLRAVCNMAVGYNNIDVAACTARGVIVTNTPDVLTETTADFGFALMMAAARRIA 119

Query: 61  VANESTHKGKWEKFNF 76
            +     +G+W K+++
Sbjct: 120 ESEHYLRRGEWTKWHY 135


>gi|269925391|ref|YP_003322014.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789051|gb|ACZ41192.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 324

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 37/71 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ RAG+G D+VDL  A   G+ V N P       A HA +++L++ R + 
Sbjct: 62  VIHALPNLKLISRAGVGVDSVDLDAAKEKGVWVANVPDYGVHEVASHAAAMILSLLRHVC 121

Query: 61  VANESTHKGKW 71
             +    +G W
Sbjct: 122 FLDRKVREGVW 132


>gi|91225594|ref|ZP_01260668.1| D-lactate dehydrogenase [Vibrio alginolyticus 12G01]
 gi|91189714|gb|EAS75988.1| D-lactate dehydrogenase [Vibrio alginolyticus 12G01]
          Length = 320

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    K++++  A  G +NVD+   +   I V N     + +  EH ++++ A+ R + 
Sbjct: 61  VLEQLPKLRMIAVAATGFNNVDVNYCANHDIAVANVRGYATRSVPEHVMAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNQ 135


>gi|296394457|ref|YP_003659341.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
 gi|296181604|gb|ADG98510.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
          Length = 531

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+    +K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHA++L+LA ARQIP 
Sbjct: 63  LAAGANLKIVARAGVGLDNVDVEAATANGVLVVNAPTSNIHSAAEHAVALLLAAARQIPP 122

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN++TH G+W++ +++GVE 
Sbjct: 123 ANDTTHAGQWKRSSYLGVEL 142


>gi|56199498|gb|AAV84238.1| phosphoglycerate dehydrogenase [Culicoides sonorensis]
          Length = 331

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L+  A K+K VGRAG G DN+++  A++  +VV+N P GNSI+  E    L+ ++AR +
Sbjct: 61  VLNAGAGKLKAVGRAGAGVDNINVDAATKNNVVVLNAPGGNSISACELTCLLIASLARPV 120

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A ES  +G W++  + G E 
Sbjct: 121 CPAAESMKRGAWDRKLYAGSEL 142


>gi|313903578|ref|ZP_07836968.1| Glyoxylate reductase [Thermaerobacter subterraneus DSM 13965]
 gi|313466131|gb|EFR61655.1| Glyoxylate reductase [Thermaerobacter subterraneus DSM 13965]
          Length = 324

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G DNVD+  A R GI+V +TP   +  TA+ A++L+LA AR++P
Sbjct: 63  LLAGAPRLRVVSNCAVGYDNVDVQAAQRRGILVTHTPGVLTEATADLAMALILACARRLP 122

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            A      G+W  +    ++G+E 
Sbjct: 123 QAEADLRAGRWTTWHPLQWLGLEL 146


>gi|149180910|ref|ZP_01859412.1| hypothetical protein BSG1_00725 [Bacillus sp. SG-1]
 gi|148851429|gb|EDL65577.1| hypothetical protein BSG1_00725 [Bacillus sp. SG-1]
          Length = 322

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+ R GIG DN+DL  AS  GI+V N PF N    AEH ++L+L+ +RQ+ 
Sbjct: 58  VIEKASKLKVIARHGIGVDNIDLEAASDRGILVTNAPFANVNAVAEHVLTLILSGSRQLI 117

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
             + +   G +E +    G+E 
Sbjct: 118 QVDSALRNGDFEVRNRKFGIEL 139


>gi|317494533|ref|ZP_07952946.1| D-isomer specific 2-hydroxyacid dehydrogenase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917463|gb|EFV38809.1| D-isomer specific 2-hydroxyacid dehydrogenase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 326

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K++ V    +G DN D+   +R  I++M+TP   + T A+  + LMLA AR+IP
Sbjct: 60  LLAQAPKLRAVSTISVGYDNFDVDEMTRRHILLMHTPTVLTETVADTLMGLMLATARRIP 119

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
             +     G W       + G + 
Sbjct: 120 ELDAWVRAGHWNDSLDAKYYGTDV 143


>gi|23100299|ref|NP_693766.1| hypothetical protein OB2844 [Oceanobacillus iheyensis HTE831]
 gi|22778531|dbj|BAC14800.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 319

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A ++K++ R GIG DN+D+  A++ GI V NTP  N    AE  ++ MLA  R + 
Sbjct: 58  VLENANRLKIIARHGIGVDNIDVKAATKYGIKVTNTPSANINAVAELVLTFMLASTRHLL 117

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
             +E+   G ++ +    G E 
Sbjct: 118 PIDEAVRAGNFDIRNQLFGYEL 139


>gi|169343398|ref|ZP_02864402.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens C str. JGS1495]
 gi|169298484|gb|EDS80570.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens C str. JGS1495]
          Length = 301

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++G+E 
Sbjct: 126 KAGLWKKKDYVGIEL 140


>gi|227499028|ref|ZP_03929165.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidaminococcus sp.
           D21]
 gi|226904477|gb|EEH90395.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidaminococcus sp.
           D21]
          Length = 318

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 42/72 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+ +K++ R GIG +N++L    + G+ V      N+ + AEHAI+LMLA  RQI 
Sbjct: 57  VIKAARNLKIIARYGIGYENINLEACDKKGVTVTLARGCNTYSVAEHAITLMLAALRQIS 116

Query: 61  VANESTHKGKWE 72
             +    KG W+
Sbjct: 117 QLDREVRKGDWK 128


>gi|213962550|ref|ZP_03390812.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga sputigena Capno]
 gi|213954876|gb|EEB66196.1| D-3-phosphoglycerate dehydrogenase [Capnocytophaga sputigena Capno]
          Length = 320

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A ++K +GR G G +N+D   A   GI ++  P GN     EHA+ ++LA+  +  
Sbjct: 57  FLDKATRLKFIGRVGAGLENIDCNYAESKGITLIAAPEGNRNAVGEHALGMLLALLNKFK 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     GKW +    G E 
Sbjct: 117 KANNEIKNGKWLREENRGWEL 137


>gi|307265064|ref|ZP_07546624.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919862|gb|EFN50076.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 533

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN++  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPTGNTVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A ++KVV RAG+G DNVD+  A++AG++V+N P  N  + AE AI+L+LA AR IP 
Sbjct: 66  LAVAGQLKVVARAGVGLDNVDVGAATKAGVMVVNAPTSNITSAAELAIALLLATARHIPK 125

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN S   GKWE+  F GVE 
Sbjct: 126 ANASLKSGKWERSKFTGVEL 145


>gi|150391336|ref|YP_001321385.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Alkaliphilus metalliredigens QYMF]
 gi|149951198|gb|ABR49726.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Alkaliphilus metalliredigens QYMF]
          Length = 304

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K++++ RAG+G DN+D   A + GI V NTP  + ++ AE  I+ ML IAR++  +N + 
Sbjct: 66  KLRLIIRAGVGLDNIDGAYAMKNGITVRNTPDASKVSVAELTIAHMLMIARKLQQSNVTM 125

Query: 67  HKGKWEKFNFMGVEA 81
            +GKW K  + GVE 
Sbjct: 126 RQGKWLKKEYRGVEI 140


>gi|146340801|ref|YP_001205849.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium
           sp. ORS278]
 gi|146193607|emb|CAL77624.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium
           sp. ORS278]
          Length = 335

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  ++K+K + + G+G DN+D+  A R GI V      NS + AE A +LM A+AR+IP
Sbjct: 71  VIGASQKLKAIAKHGVGYDNIDVEAADRRGIPVFVARGANSQSVAELAFALMFAVAREIP 130

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W+K    G + 
Sbjct: 131 HLDARIKTGHWDKATTKGAQL 151


>gi|300313735|ref|YP_003777827.1| D-3-phosphoglycerate dehydrogenase [Herbaspirillum seropedicae
           SmR1]
 gi|300076520|gb|ADJ65919.1| D-3-phosphoglycerate dehydrogenase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 308

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++V+ + G G D++D   A + GI V      N+   AEH  +L++A A+ + 
Sbjct: 64  VMDAAPILRVISKHGTGIDSIDSQAAQQRGIAVKAAAGANAPAVAEHTWALIMACAKNVV 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K     +E 
Sbjct: 124 GLDQRMREGHWDKSTHKSLEL 144


>gi|258512114|ref|YP_003185548.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257478840|gb|ACV59159.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 328

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV   A +G D+ DL    R  I+  +TP     T A+  ++LMLA+AR+I 
Sbjct: 59  LLEQAPHLKVASTASVGYDHFDLAAMRRRRILGAHTPHVLDDTVADLGMALMLAVARRIV 118

Query: 61  VANESTHKGKWEK 73
             +    +G+W+K
Sbjct: 119 ELDGYVRRGEWKK 131


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 22  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 81

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 82  NAHNFLKIERKWEREKWYGIEL 103


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A K++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLDSASKLRAVVRAGVGVDNVDIEGSSKKGVVVMNVPTANTIAAVELTCAHILSAIRNFP 120

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN     + KW++ ++ G E 
Sbjct: 121 DANAQLKVERKWKREDWYGTEL 142


>gi|254172865|ref|ZP_04879539.1| glyoxylate reductase [Thermococcus sp. AM4]
 gi|214033021|gb|EEB73849.1| glyoxylate reductase [Thermococcus sp. AM4]
          Length = 334

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 50/88 (56%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +  +A K+++V    +G DN+D+  A+R GI V NTP   +  TA+ A +L+LA AR++ 
Sbjct: 61  VFDNAPKLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLI 120

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A+  T  G+W+K         F+G + 
Sbjct: 121 EADNFTRSGEWKKRGIAWHPRWFLGYDV 148


>gi|254169129|ref|ZP_04875966.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Aciduliprofundum boonei T469]
 gi|197621968|gb|EDY34546.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Aciduliprofundum boonei T469]
          Length = 316

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 47/77 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+KV+G   +G +N+D+  A + GI+V NTP   +  TA+   +L+LA AR++ 
Sbjct: 60  IIDSAPKLKVIGNYAVGYNNIDVKYAKKKGIIVTNTPGVLTDATADLTFALILAAARRVV 119

Query: 61  VANESTHKGKWEKFNFM 77
             ++   +GK++ +  M
Sbjct: 120 EGDKFMRQGKFKGWAPM 136


>gi|121534893|ref|ZP_01666712.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosinus carboxydivorans Nor1]
 gi|121306492|gb|EAX47415.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosinus carboxydivorans Nor1]
          Length = 324

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   K+K++   G G +N+D+  A+   I V NTP  ++  TA+    L++AIAR+I 
Sbjct: 61  VIASNPKLKIIANYGAGYNNIDVAAATARKIPVTNTPGVSTDATADLTWGLIIAIARRIV 120

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
             +++T  G++  +     +GVE 
Sbjct: 121 EGDKNTRAGRFTGWAPLYHLGVEV 144


>gi|58337241|ref|YP_193826.1| glyoxylate reductase [Lactobacillus acidophilus NCFM]
 gi|58254558|gb|AAV42795.1| glyoxylate reductase [Lactobacillus acidophilus NCFM]
          Length = 321

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 42/71 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+   G+G D++D+  A   GIVV N P      TAE A+++++A AR+I 
Sbjct: 63  IIDAAKNLKVISTYGVGFDHIDIDYAREKGIVVTNCPNSVLRPTAELALTMIMASARRIR 122

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 123 YYDHALREGVF 133


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|315636539|ref|ZP_07891775.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
 gi|315479188|gb|EFU69885.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
          Length = 528

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ ML+  R+ P
Sbjct: 61  FLNAAVNLKALIRAGVGYDNVDIDGCSKRGIIAMNVPTANTIAAVELTMTHMLSCMRKFP 120

Query: 61  VANESTHKGK-WEKFNFMGVEA 81
            A+      + W++ ++ G E 
Sbjct: 121 YAHNQLKNDRVWKREDWYGNEL 142


>gi|167036576|ref|YP_001664154.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115004|ref|YP_004185163.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855410|gb|ABY93818.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928095|gb|ADV78780.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 531

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 53/81 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KVVGRAG G DN+D+  A+  GI+V+NTP GN++  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVVGRAGNGVDNIDVTAATEKGILVVNTPAGNTVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|295692855|ref|YP_003601465.1| d-isomer specific 2-hydroxyacid dehydrogenase, nad-binding
           [Lactobacillus crispatus ST1]
 gi|295030961|emb|CBL50440.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Lactobacillus crispatus ST1]
          Length = 321

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  AK +K++   G+G D+VD+  A   GIVV N P      TAE A ++++A AR++ 
Sbjct: 63  MIDAAKNLKIISTYGVGFDHVDVEYAKEKGIVVSNCPKSVLRPTAELAWTMIMASARRLH 122

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 123 YYDHALREGVF 133


>gi|18309036|ref|NP_560970.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens str. 13]
 gi|18143711|dbj|BAB79760.1| D-3-phosphoglycerate dehydrogenase [Clostridium perfringens str.
           13]
          Length = 301

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 48/75 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  KLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|227879070|ref|ZP_03996959.1| glyoxylate reductase [Lactobacillus crispatus JV-V01]
 gi|256843060|ref|ZP_05548548.1| glyoxylate reductase [Lactobacillus crispatus 125-2-CHN]
 gi|256850288|ref|ZP_05555717.1| glyoxylate reductase [Lactobacillus crispatus MV-1A-US]
 gi|293381299|ref|ZP_06627302.1| putative glyoxylate reductase [Lactobacillus crispatus 214-1]
 gi|312977246|ref|ZP_07788994.1| glyoxylate reductase, NADH-dependent [Lactobacillus crispatus
           CTV-05]
 gi|227861311|gb|EEJ68941.1| glyoxylate reductase [Lactobacillus crispatus JV-V01]
 gi|256614480|gb|EEU19681.1| glyoxylate reductase [Lactobacillus crispatus 125-2-CHN]
 gi|256712925|gb|EEU27917.1| glyoxylate reductase [Lactobacillus crispatus MV-1A-US]
 gi|290922115|gb|EFD99114.1| putative glyoxylate reductase [Lactobacillus crispatus 214-1]
 gi|310895677|gb|EFQ44743.1| glyoxylate reductase, NADH-dependent [Lactobacillus crispatus
           CTV-05]
          Length = 321

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 42/71 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  AK +K++   G+G D+VD+  A   GIVV N P      TAE A ++++A AR++ 
Sbjct: 63  MIDAAKNLKIISTYGVGFDHVDVEYAKEKGIVVSNCPKSVLRPTAELAWTMIMASARRLH 122

Query: 61  VANESTHKGKW 71
             +++  +G +
Sbjct: 123 YYDDALREGVF 133


>gi|254229276|ref|ZP_04922694.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Vibrio sp. Ex25]
 gi|262393168|ref|YP_003285022.1| D-lactate dehydrogenase [Vibrio sp. Ex25]
 gi|151938200|gb|EDN57040.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Vibrio sp. Ex25]
 gi|262336762|gb|ACY50557.1| D-lactate dehydrogenase [Vibrio sp. Ex25]
          Length = 320

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++++  A  G +NVD+   ++  I V N     + +  EH I+++ A+ R + 
Sbjct: 61  ILEQLPQLRMIAVAATGFNNVDVDYCAKHDIAVANVRGYATRSVPEHVIAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|110638032|ref|YP_678240.1| phosphoglycerate dehydrogenase [Cytophaga hutchinsonii ATCC 33406]
 gi|110280713|gb|ABG58899.1| phosphoglycerate dehydrogenase [Cytophaga hutchinsonii ATCC 33406]
          Length = 314

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 35/81 (43%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K++ + RAG G DN+D        I + +   GN +   EH + L+LA+   I 
Sbjct: 60  IIDSCTKLQFIARAGAGVDNIDKEYLKEKNIALFHASEGNRVAVGEHTLGLILALINNIV 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++       W +    G E 
Sbjct: 120 RSDTEVKDAIWLREENRGYEL 140


>gi|209521143|ref|ZP_03269870.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia sp. H160]
 gi|209498418|gb|EDZ98546.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia sp. H160]
          Length = 329

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      G W+K+++ G   G
Sbjct: 118 ESEHWLRAGHWQKWSYDGF-LG 138


>gi|262046033|ref|ZP_06018997.1| glyoxylate reductase [Lactobacillus crispatus MV-3A-US]
 gi|260573992|gb|EEX30548.1| glyoxylate reductase [Lactobacillus crispatus MV-3A-US]
          Length = 321

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  AK +K++   G+G D+VD+  A   GIVV N P      TAE A ++++A AR++ 
Sbjct: 63  MIDAAKNLKIISTYGVGFDHVDVEYAKEKGIVVSNCPKSVLRPTAELAWTMIMASARRLH 122

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 123 YYDHALREGVF 133


>gi|167040920|ref|YP_001663905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300913871|ref|ZP_07131188.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307725445|ref|YP_003905196.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166855160|gb|ABY93569.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300890556|gb|EFK85701.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307582506|gb|ADN55905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 531

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|317508269|ref|ZP_07965949.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
 gi|316253444|gb|EFV12834.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
          Length = 523

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 57/80 (71%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+    +K+V RAG+G DNVD+  A+  G++V+N P  N  + AEHAI+L+LA ARQIP 
Sbjct: 55  LAAGSNLKIVARAGVGLDNVDVQAATANGVLVVNAPTSNIHSAAEHAIALLLAAARQIPP 114

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN +T  G+W++ +++GVE 
Sbjct: 115 ANATTQAGEWKRSSYLGVEL 134


>gi|313896802|ref|ZP_07830350.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974719|gb|EFR40186.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
           protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 161

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 53/69 (76%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A+ +K++GRAG+G DN+D+  A+  GI+V+N+P GN+I   EH +++ML++AR IP
Sbjct: 56  VIARAENLKIIGRAGVGVDNIDVKAATERGIIVINSPGGNTIAATEHTMAMMLSMARNIP 115

Query: 61  VANESTHKG 69
            A+E+  +G
Sbjct: 116 AADETMQRG 124


>gi|288960666|ref|YP_003451006.1| D-3-phosphoglycerate dehydrogenase [Azospirillum sp. B510]
 gi|288912974|dbj|BAI74462.1| D-3-phosphoglycerate dehydrogenase [Azospirillum sp. B510]
          Length = 327

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ + K++ + + G+G DN+D   A+R GI V+     NS + AE A +LM  +AR + 
Sbjct: 63  VIAASPKLRAIAKHGVGYDNIDAEAAARRGIPVLVARGANSQSVAELAFALMFGVARHLA 122

Query: 61  VANESTHKGKWEKF-----NFMGVEAG 82
             +E    G W+K         G   G
Sbjct: 123 HLHERMKAGFWDKATTSGLQLRGRSLG 149


>gi|256751636|ref|ZP_05492511.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256749445|gb|EEU62474.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 531

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 52/81 (64%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   +++KV+GRAG G DN+D+  A+  GI+V+NTP GN +  AE  I LMLAIAR IP
Sbjct: 56  LIEKGERLKVIGRAGNGVDNIDVSSATEKGILVVNTPAGNIVAAAELTIGLMLAIARNIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A  +   G + +  F GVE 
Sbjct: 116 QAYHAGLNGDFRRDKFKGVEL 136


>gi|226940728|ref|YP_002795802.1| glycerate dehydrogenase [Laribacter hongkongensis HLHK9]
 gi|226715655|gb|ACO74793.1| Probable glycerate dehydrogenase [Laribacter hongkongensis HLHK9]
          Length = 315

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++++V  +  G +NVDL      GI V N     + T AEHA  LM+ + RQ+ 
Sbjct: 57  LLEQLPRLRLVAVSATGVNNVDLAACRARGIPVCNVRNYGADTVAEHAFMLMMVLRRQLA 116

Query: 61  VANESTHKGKWEKFN 75
               +   G+W++  
Sbjct: 117 AYQRAVRAGEWQRSE 131


>gi|305662807|ref|YP_003859095.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
 gi|304377376|gb|ADM27215.1| Glyoxylate reductase [Ignisphaera aggregans DSM 17230]
          Length = 328

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 6/86 (6%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++ R G+G D +D+  A+  GI V   P  N+ T AEH I+L++A+A+++ 
Sbjct: 61  VLESAPKLKIIARHGVGYDKIDVNAANELGIWVTIAP-VNASTVAEHTIALIMALAKKLF 119

Query: 61  VANESTHKGKWEKFN-----FMGVEA 81
             +     G W K        +G++ 
Sbjct: 120 KLDRFVRDGVWYKERMEFPDLLGIDL 145


>gi|260900300|ref|ZP_05908695.1| glycerate dehydrogenase [Vibrio parahaemolyticus AQ4037]
 gi|308107589|gb|EFO45129.1| glycerate dehydrogenase [Vibrio parahaemolyticus AQ4037]
          Length = 320

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  A  G +NVD+      GI V N     + +  EH I+++ A+ R + 
Sbjct: 61  VLSQLPQLKMIAVAATGFNNVDVNYCVEHGIAVANVRGYATRSVPEHVIAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|238894661|ref|YP_002919395.1| D-isomer specific 2-hydroxyacid dehydrogenase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238546977|dbj|BAH63328.1| D-isomer specific 2-hydroxyacid dehydrogenase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 316

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 39/73 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++K+V + G+G DN+DL    +  I V N P  N    A+ A  L+L  ARQI 
Sbjct: 61  LLAKAPRLKIVCKHGVGVDNIDLNATRQRKIFVTNVPDANKHAVADFAFGLILNTARQIC 120

Query: 61  VANESTHKGKWEK 73
            A   T  G W +
Sbjct: 121 QAISETKAGNWPR 133


>gi|327396368|dbj|BAK13790.1| glycerate dehydrogenase HprA [Pantoea ananatis AJ13355]
          Length = 321

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 11/93 (11%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K V  A  G D +D+       I V N       T  EH  +L+ A+ R I 
Sbjct: 61  LIAQAPNLKFVAVAATGFDAIDIDACKARNIPVSNIRGYALDTVPEHTFALIFALRRSIT 120

Query: 61  VANESTHKGKWEK-----------FNFMGVEAG 82
             +++  KG+W++            N  G   G
Sbjct: 121 AYHQAVQKGRWQQAGQFCFFDFSIKNLAGSTLG 153


>gi|299770043|ref|YP_003732069.1| phosphoglycerate dehydrogenase [Acinetobacter sp. DR1]
 gi|298700131|gb|ADI90696.1| phosphoglycerate dehydrogenase [Acinetobacter sp. DR1]
          Length = 325

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +KV+ + G+G D +D   A+   I V      N+ + AEHA +LM  +ARQ+ 
Sbjct: 62  MIFASDNLKVIAKHGVGFDTIDTQAAAERKIPVTIAVGANAQSVAEHAFALMFNVARQVT 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K +  GVE 
Sbjct: 122 WLDQRIREGHWDKASANGVEL 142


>gi|194015653|ref|ZP_03054269.1| glyoxylate reductase (Glycolate reductase) [Bacillus pumilus ATCC
           7061]
 gi|194013057|gb|EDW22623.1| glyoxylate reductase (Glycolate reductase) [Bacillus pumilus ATCC
           7061]
          Length = 327

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 44/75 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+    +G DN+DL  A++  I + +TP   + +TA+ A +L++  AR+I 
Sbjct: 63  LLSKAPHVKVIANLAVGYDNIDLEAANKRNITICHTPDVLTESTADLAFALLMTSARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A++   +G W  + 
Sbjct: 123 EASDWIKEGNWTGWG 137


>gi|186475576|ref|YP_001857046.1| D-isomer specific 2-hydroxyacid dehydrogenase [Burkholderia
           phymatum STM815]
 gi|184192035|gb|ACC70000.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia phymatum STM815]
          Length = 329

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + + ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAVAPRLRVVSNMAVGYNNFDMAAFNASNVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      GKW+K+++ G   G
Sbjct: 118 ESEHWLRAGKWDKWSYDGF-LG 138


>gi|57640618|ref|YP_183096.1| glyoxylate reductase [Thermococcus kodakarensis KOD1]
 gi|73919725|sp|Q5JEZ2|GYAR_PYRKO RecName: Full=Glyoxylate reductase
 gi|57158942|dbj|BAD84872.1| glyoxylate reductase [Thermococcus kodakarensis KOD1]
          Length = 333

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A ++++V    +G DN+D+  A+R GI V NTP   +  TA+ A +L+LA AR++ 
Sbjct: 61  VFDAAPRLRIVANYAVGYDNIDVEEATRRGIYVTNTPDVLTDATADFAWTLLLATARRLI 120

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A+  T  G+W++         F+G + 
Sbjct: 121 EADHFTRSGEWKRRGIAWHPRWFLGYDV 148


>gi|149193714|ref|ZP_01870812.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
 gi|149135667|gb|EDM24145.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
          Length = 522

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LSHAKK+K + RAG+G DNVD+   S+ GIVVMN P  N++   E  ++ +L  AR   
Sbjct: 58  FLSHAKKLKAIVRAGVGVDNVDIEACSKRGIVVMNIPTANTLAAVELTMAHLLTAARSFT 117

Query: 61  VANEST-HKGKWEKFNFMGVEA 81
            A  +   + +W +  ++G+E 
Sbjct: 118 NAVWNLKKEHEWNREKWLGIEL 139


>gi|294500280|ref|YP_003563980.1| glyoxylate reductase [Bacillus megaterium QM B1551]
 gi|294350217|gb|ADE70546.1| glyoxylate reductase [Bacillus megaterium QM B1551]
          Length = 321

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 40/72 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++V+ ++G+G D+VD+   ++ G+   NTP      TA+    L+L+ AR+I 
Sbjct: 62  LLEAAPNLRVISQSGVGYDSVDVEACTKKGVPFSNTPGVLVEATADLTFGLLLSAARRIH 121

Query: 61  VANESTHKGKWE 72
              E   +G WE
Sbjct: 122 EGYEKVKQGNWE 133


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|312375314|gb|EFR22711.1| hypothetical protein AND_14315 [Anopheles darlingi]
          Length = 372

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +L  A   +KV+    +G D++D+    + GI V  TP   +  TAE  ++L+LA AR++
Sbjct: 113 LLDQAGPNLKVISTISVGYDHIDVKECKQRGIRVGYTPDVLTDATAELTVALLLATARRM 172

Query: 60  PVANESTHKGKWEKFNFM 77
             AN+  H G W+ ++ M
Sbjct: 173 FEANKQVHTGGWKSWSPM 190


>gi|157693642|ref|YP_001488104.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bacillus pumilus
           SAFR-032]
 gi|157682400|gb|ABV63544.1| D-isomer specific 2-hydroxyacid dehydrogenase [Bacillus pumilus
           SAFR-032]
          Length = 327

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +KV+    +G DN+D+  A +  I + +TP   + +TA+ A +L++A AR+I 
Sbjct: 63  LLSKAPHVKVIANLAVGYDNIDVEAAKKQNITICHTPDVLTESTADLAFALLMASARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A++    G W  + 
Sbjct: 123 EASDWVKDGNWTGWG 137


>gi|328471411|gb|EGF42306.1| D-lactate dehydrogenase [Vibrio parahaemolyticus 10329]
          Length = 320

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  A  G +NVD+   +  GI V N     + +  EH I+++ A+ R + 
Sbjct: 61  VLSQLPQLKMIAVAATGFNNVDVNYCAEHGIAVANVRGYATRSVPEHVIAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|293608024|ref|ZP_06690327.1| predicted protein [Acinetobacter sp. SH024]
 gi|292828597|gb|EFF86959.1| predicted protein [Acinetobacter sp. SH024]
          Length = 325

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +KV+ + G+G D +D   A+   I V      N+ + AEHA +LM  +ARQ+ 
Sbjct: 62  MIFASDNLKVIAKHGVGFDTIDTQAAAERKIPVTIAVGANAQSVAEHAFALMFNVARQVT 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K +  GVE 
Sbjct: 122 WLDQRIREGHWDKASANGVEL 142


>gi|239504247|ref|ZP_04663557.1| phosphoglycerate dehydrogenase [Acinetobacter baumannii AB900]
          Length = 325

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +KV+ + G+G D +D   A+   I V      N+ + AEHA +LM  +ARQ+ 
Sbjct: 62  MIFASDNLKVIAKHGVGFDTIDTQAAAERKIPVTIAVGANAQSVAEHAFALMFNVARQVT 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K +  GVE 
Sbjct: 122 WLDQRIREGHWDKASANGVEL 142


>gi|227903825|ref|ZP_04021630.1| glyoxylate reductase [Lactobacillus acidophilus ATCC 4796]
 gi|227868712|gb|EEJ76133.1| glyoxylate reductase [Lactobacillus acidophilus ATCC 4796]
          Length = 330

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 42/71 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +KV+   G+G D++D+  A   GIVV N P      TAE A+++++A AR+I 
Sbjct: 72  IIDAAKNLKVISTYGVGFDHIDIDYAREKGIVVTNCPNSVLRPTAELALTMIMASARRIR 131

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 132 YYDHALREGVF 142


>gi|28899452|ref|NP_799057.1| D-lactate dehydrogenase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363380|ref|ZP_05776232.1| glycerate dehydrogenase [Vibrio parahaemolyticus K5030]
 gi|260879314|ref|ZP_05891669.1| glycerate dehydrogenase [Vibrio parahaemolyticus AN-5034]
 gi|260895727|ref|ZP_05904223.1| glycerate dehydrogenase [Vibrio parahaemolyticus Peru-466]
 gi|28807688|dbj|BAC60941.1| 2-hydroxyacid dehydrogenase family protein [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308087393|gb|EFO37088.1| glycerate dehydrogenase [Vibrio parahaemolyticus Peru-466]
 gi|308093141|gb|EFO42836.1| glycerate dehydrogenase [Vibrio parahaemolyticus AN-5034]
 gi|308111181|gb|EFO48721.1| glycerate dehydrogenase [Vibrio parahaemolyticus K5030]
          Length = 320

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  A  G +NVD+   +  GI V N     + +  EH I+++ A+ R + 
Sbjct: 61  VLSQLPQLKMIAVAATGFNNVDVNYCAEHGIAVANVRGYATRSVPEHVIAMLFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|325122339|gb|ADY81862.1| putative D-3-phosphoglycerate dehydrogenase (PgdH) [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 329

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +KV+ + G+G D +D   A+   I V      N+ + AEHA +LM  +ARQ+ 
Sbjct: 66  MIFASDNLKVIAKHGVGFDTIDTQAAAERKIPVTIAVGANAQSVAEHAFALMFNVARQVT 125

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K +  GVE 
Sbjct: 126 WLDQRIREGHWDKASANGVEL 146


>gi|184158215|ref|YP_001846554.1| phosphoglycerate dehydrogenase [Acinetobacter baumannii ACICU]
 gi|294843835|ref|ZP_06788518.1| phosphoglycerate dehydrogenase [Acinetobacter sp. 6014059]
 gi|183209809|gb|ACC57207.1| Phosphoglycerate dehydrogenase [Acinetobacter baumannii ACICU]
 gi|322508536|gb|ADX03990.1| Putative D-3-phosphoglycerate dehydrogenase [Acinetobacter
           baumannii 1656-2]
 gi|323518153|gb|ADX92534.1| phosphoglycerate dehydrogenase [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 325

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  +  +KV+ + G+G D +D   A+   I V      N+ + AEHA +LM  +ARQ+ 
Sbjct: 62  MIFASDNLKVIAKHGVGFDTIDTQAAAERKIPVTIAVGANAQSVAEHAFALMFNVARQVT 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++   +G W+K +  GVE 
Sbjct: 122 WLDQRIREGHWDKASANGVEL 142


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 61/81 (75%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  + +++++GRAG+G DNVD+  A++ G++V+N+P GN+I  AEHA++L+LA++R IP
Sbjct: 57  VIEASDRLRIIGRAGVGVDNVDVPAATKRGVLVVNSPGGNTIAAAEHALALLLALSRNIP 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G WE+  ++G E 
Sbjct: 117 QAHSSTFGGLWERKKYVGNEL 137


>gi|227508261|ref|ZP_03938310.1| possible glyoxylate reductase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227192490|gb|EEI72557.1| possible glyoxylate reductase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 323

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D+  A   GI V NTP  ++++TAE    LM+A++ ++ 
Sbjct: 62  VIDKAPNLKLIANYGAGFNNIDVDYAKSKGIPVTNTPKVSTVSTAEVTCGLMIALSHRMM 121

Query: 61  VANESTH-KG--KWEKFNFMGVEA 81
             +     +G   W    F+G E 
Sbjct: 122 EGDTLMRHEGFSGWAPLFFLGHEL 145


>gi|239814780|ref|YP_002943690.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Variovorax paradoxus S110]
 gi|239801357|gb|ACS18424.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Variovorax paradoxus S110]
          Length = 328

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 40/76 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K+     +G +N D+   +  G++  N P   + TTA+   +L++A AR+I 
Sbjct: 62  LLDACPDLKICANMAVGYNNFDVDAMAAHGVLGTNAPDVLTETTADFGFALLMATARRIT 121

Query: 61  VANESTHKGKWEKFNF 76
            +      GKW+K++F
Sbjct: 122 ESEHFLRAGKWQKWSF 137


>gi|159041365|ref|YP_001540617.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Caldivirga maquilingensis IC-167]
 gi|157920200|gb|ABW01627.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Caldivirga maquilingensis IC-167]
          Length = 317

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++ RAG+G DN+D+  A + G+ ++N+P   + + AE  +SLML I+R + 
Sbjct: 65  VIDRGASLKIIARAGVGLDNIDVDYALKRGLTIVNSPNAATYSAAELTLSLMLIISRNLH 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +       GKW K  + G+E 
Sbjct: 125 LHLIDVKNGKWSKGLYHGIEL 145


>gi|118580582|ref|YP_901832.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pelobacter propionicus DSM 2379]
 gi|118503292|gb|ABK99774.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Pelobacter propionicus DSM 2379]
          Length = 357

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++K++ RAG G DN+D+  A + G+ ++  P  ++   AE A + MLA++R++ 
Sbjct: 79  LMGCAPRLKLLVRAGSGMDNLDVEYARKRGVQLVRIPQPSARAVAEMAFAFMLALSRRLL 138

Query: 61  VANESTHKGKWEKFNFMGV 79
            A+ S   G+WEK  F G 
Sbjct: 139 EADRSMRNGRWEKHEFSGY 157


>gi|302338646|ref|YP_003803852.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
 gi|301635831|gb|ADK81258.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
          Length = 295

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  AKK+K++ R G+G DN+D   A   GI+V NTP  +SI  AE A +LM+ I  +I  
Sbjct: 49  IDQAKKLKLIIRGGVGIDNIDKTYAESKGIIVRNTPKASSIAVAELAFALMIQIPNRIIE 108

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+    +GKW K      E 
Sbjct: 109 AHNGMQEGKWLKKELKRTEL 128


>gi|156975907|ref|YP_001446814.1| hypothetical protein VIBHAR_03673 [Vibrio harveyi ATCC BAA-1116]
 gi|156527501|gb|ABU72587.1| hypothetical protein VIBHAR_03673 [Vibrio harveyi ATCC BAA-1116]
          Length = 320

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 36/74 (48%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           LS    +K++  A  G +NVD+   +   + V N     + +  EH I+++ A+ R +  
Sbjct: 62  LSQLPNLKMIAVAATGFNNVDINYCAEHNVAVANVRGYATRSVPEHVIAMLFALRRNLFG 121

Query: 62  ANESTHKGKWEKFN 75
            ++    G+W++  
Sbjct: 122 YHQDIAAGEWQRNK 135


>gi|291616123|ref|YP_003518865.1| HprA [Pantoea ananatis LMG 20103]
 gi|291151153|gb|ADD75737.1| HprA [Pantoea ananatis LMG 20103]
          Length = 336

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 11/93 (11%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K V  A  G D +D+       I V N       T  EH  +L+ A+ R I 
Sbjct: 76  LIAQAPNLKFVAVAATGFDAIDIDACKARNIPVSNIRGYALDTVPEHTFALIFALRRSIT 135

Query: 61  VANESTHKGKWEK-----------FNFMGVEAG 82
             +++  KG+W++            N  G   G
Sbjct: 136 AYHQAVQKGRWQQAGQFCFFDFSIKNLAGSTLG 168


>gi|237745829|ref|ZP_04576309.1| dehydrogenase [Oxalobacter formigenes HOxBLS]
 gi|229377180|gb|EEO27271.1| dehydrogenase [Oxalobacter formigenes HOxBLS]
          Length = 322

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +   ++K++ R G G DNVDL  A+R G+ V N P   +   A HA++LMLAI R+I 
Sbjct: 62  VFAALPRLKMIVRYGDGVDNVDLEAATRHGVQVCNVPDYGTSEVANHALALMLAITRKIC 121

Query: 61  VANESTHKGKWE 72
            AN+    G+W 
Sbjct: 122 QANDQVRAGRWN 133


>gi|218288901|ref|ZP_03493152.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218240990|gb|EED08167.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 333

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KV   A +G D+ DL    R  I+  +TP     T A+  ++LMLA+AR+I 
Sbjct: 59  LLEQAPDLKVASTASVGYDHFDLAAMRRRRILGAHTPHVLDDTVADLGMALMLAVARRIV 118

Query: 61  VANESTHKGKWEK 73
             +    +G+W+K
Sbjct: 119 ELDGYVRRGEWKK 131


>gi|288573147|ref|ZP_06391504.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568888|gb|EFC90445.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 299

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 45/80 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A  +K++ R G+GTDN+D   A+  GI V NTP  +S+  AE A ++MLA+  ++  
Sbjct: 49  IEKASNLKLIIRGGVGTDNIDKEFAASKGISVRNTPKASSVAVAELAFAMMLAVPNRLVE 108

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A+ S   G WEK      E 
Sbjct: 109 AHNSMASGAWEKKKLKRTEL 128


>gi|295656030|ref|YP_003257116.2| putative phosphoglycerate dehydrogenase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|292806713|gb|ACX83973.2| putative phosphoglycerate dehydrogenase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 321

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 50/80 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AKK++ + R G G +N+D   A +  I +++TP GN  + AEHAI+++L+I   + 
Sbjct: 59  LLKEAKKLRFIARIGSGVENIDKDYAYKNKITLISTPEGNRDSVAEHAIAMLLSIMNHLF 118

Query: 61  VANESTHKGKWEKFNFMGVE 80
           ++N+   KGKW + +  G E
Sbjct: 119 ISNQEIRKGKWNRESNRGRE 138


>gi|284990928|ref|YP_003409482.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase protein
           [Geodermatophilus obscurus DSM 43160]
 gi|284064173|gb|ADB75111.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Geodermatophilus obscurus DSM 43160]
          Length = 322

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 40/72 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++++V R G+G D VD   A   G+ V N P   +   A HA++++LA+ R +P
Sbjct: 64  VLDALPRLRLVSRYGVGVDVVDTDAARARGVWVCNVPDYGTTEVALHAVAVLLALLRNLP 123

Query: 61  VANESTHKGKWE 72
             +   H G+W+
Sbjct: 124 EHDRQVHAGRWD 135


>gi|302338187|ref|YP_003803393.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
 gi|301635372|gb|ADK80799.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Spirochaeta smaragdinae DSM 11293]
          Length = 327

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +     +KV+ R G+G DNVD+  A+  GI V+  P  NS + AEH I+LM A ++ +  
Sbjct: 58  IEACPDLKVITRPGVGVDNVDVQAATEHGIPVVICPAANSRSVAEHTIALMFAASKNLIE 117

Query: 62  ANESTHKGKW-EKFNFMGVEA 81
           ++  T KG +  +  +  VE 
Sbjct: 118 SDRETRKGNFGIRNKYAAVEL 138


>gi|313683520|ref|YP_004061258.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Sulfuricurvum kujiense DSM 16994]
 gi|313156380|gb|ADR35058.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sulfuricurvum kujiense DSM 16994]
          Length = 306

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K++ + G+G +N+DL    + G+ +  T   N ++ AE A+  ML + R + 
Sbjct: 62  ILSACPNLKIISKYGVGLNNIDLDACRKRGVQIGWTGGVNRLSVAEMALGYMLMLCRNLY 121

Query: 61  VANESTHKGKWEKFN 75
           + +     G W K  
Sbjct: 122 ITSNELKNGIWNKSG 136


>gi|269929321|ref|YP_003321642.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
 gi|269788678|gb|ACZ40820.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
          Length = 348

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L    +++++     G D++DL   +  G+VV N P+    T AEH   L+LA++R I  
Sbjct: 68  LERLPRLRLIATRSTGYDHIDLAACAERGVVVTNVPYYGENTVAEHTFGLILALSRNIHR 127

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A   T +G +      G + 
Sbjct: 128 AYVRTQRGDFSLAGLEGFDL 147


>gi|324328783|gb|ADY24043.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein;
           possible gluconate 2-dehydrogenase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 330

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     GKW        E G
Sbjct: 130 ELDSYVKNGKWN------AEIG 145


>gi|229199053|ref|ZP_04325736.1| 2-ketogluconate reductase [Bacillus cereus m1293]
 gi|228584324|gb|EEK42459.1| 2-ketogluconate reductase [Bacillus cereus m1293]
          Length = 330

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     GKW        E G
Sbjct: 130 ELDSYVKNGKWN------AEIG 145


>gi|222098357|ref|YP_002532415.1| d-isomer specific 2-hydroxyacid dehydrogenase family protein;
           gluconate 2-dehydrogenase [Bacillus cereus Q1]
 gi|221242416|gb|ACM15126.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein;
           possible gluconate 2-dehydrogenase [Bacillus cereus Q1]
          Length = 330

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     GKW        E G
Sbjct: 130 ELDSYVKNGKWN------AEIG 145


>gi|206976427|ref|ZP_03237334.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus H3081.97]
 gi|217962370|ref|YP_002340942.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus AH187]
 gi|229141621|ref|ZP_04270152.1| 2-ketogluconate reductase [Bacillus cereus BDRD-ST26]
 gi|206745351|gb|EDZ56751.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus H3081.97]
 gi|217063162|gb|ACJ77412.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus AH187]
 gi|228641819|gb|EEK98119.1| 2-ketogluconate reductase [Bacillus cereus BDRD-ST26]
          Length = 330

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     GKW        E G
Sbjct: 130 ELDSYVKNGKWN------AEIG 145


>gi|160879610|ref|YP_001558578.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium phytofermentans ISDg]
 gi|160428276|gb|ABX41839.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Clostridium phytofermentans ISDg]
          Length = 316

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  +KV+GR G+G DN+D+  A+  GI V  TP  N+ + AEH I L+LA A+ I 
Sbjct: 58  VFDAAPHLKVIGRHGVGYDNIDIAEATAQGIKVCYTPLANANSVAEHTIMLLLACAKNIV 117

Query: 61  VANESTHKGKWE-KFNFMGVEA 81
           +A++   +G +E +    G++ 
Sbjct: 118 IADKELRQGNYEIRNQMPGIDV 139


>gi|293605535|ref|ZP_06687916.1| D-isomer specific 2-hydroxyacid dehydrogenase [Achromobacter
           piechaudii ATCC 43553]
 gi|292816060|gb|EFF75160.1| D-isomer specific 2-hydroxyacid dehydrogenase [Achromobacter
           piechaudii ATCC 43553]
          Length = 318

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++   K+++V   G+G +N+DL  A   GI V N P  N+++ A+HA++L+L +AR +P 
Sbjct: 62  MAAMPKLELVCSLGVGYENIDLAAAHARGITVTNGPGANAVSVADHAMALLLGVARHLPQ 121

Query: 62  ANESTHKGKWEKFNFMG 78
           A+    +G W    FMG
Sbjct: 122 ADAWVRQGHW--SGFMG 136


>gi|268679255|ref|YP_003303686.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617286|gb|ACZ11651.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 528

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD    SR GI+ MN P  N+I   E  ++ ML  AR  P
Sbjct: 61  FLNAATNLKAIVRAGVGVDNVDQEGCSRRGIIAMNVPTANTIAAVELTMAHMLGCARSFP 120

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN        W +  + GVE 
Sbjct: 121 NANNHLKIDRIWNREKWYGVEL 142


>gi|121595008|ref|YP_986904.1| D-isomer specific 2-hydroxyacid dehydrogenase [Acidovorax sp. JS42]
 gi|330825285|ref|YP_004388588.1| phosphoglycerate dehydrogenase [Alicycliphilus denitrificans K601]
 gi|120607088|gb|ABM42828.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Acidovorax sp. JS42]
 gi|329310657|gb|AEB85072.1| Phosphoglycerate dehydrogenase [Alicycliphilus denitrificans K601]
          Length = 339

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++++V     G D++DL    + GI V + P   S + AEHA +L+L + R + 
Sbjct: 65  VLRMLPRLRLVATRSAGFDHIDLEACRKRGIAVCHVPDYGSASVAEHAFALLLGVTRHLT 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E   +G +      G E 
Sbjct: 125 QAHERARQGSFAYRGLTGFEL 145


>gi|168217766|ref|ZP_02643391.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens NCTC 8239]
 gi|182380202|gb|EDT77681.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens NCTC 8239]
          Length = 301

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITL 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|241763999|ref|ZP_04762039.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Acidovorax delafieldii 2AN]
 gi|241366673|gb|EER61138.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Acidovorax delafieldii 2AN]
          Length = 339

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++++V     G D++DL    + GI V + P   S + AEHA +L+L + R + 
Sbjct: 65  VLRMLPRLRLVATRSAGFDHIDLEACRKRGIAVCHVPDYGSASVAEHAFALLLGVTRHLT 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E   +G +      G E 
Sbjct: 125 QAHERARQGSFAYRGLTGFEL 145


>gi|121533554|ref|ZP_01665382.1| Phosphoglycerate dehydrogenase [Thermosinus carboxydivorans Nor1]
 gi|121308113|gb|EAX49027.1| Phosphoglycerate dehydrogenase [Thermosinus carboxydivorans Nor1]
          Length = 326

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 46/77 (59%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++ + G+G DN+DL  A   GI V NTP GN+ + AE  + +++ + R+I 
Sbjct: 60  LIQKAPKLKMIQKTGVGVDNIDLAAAKTLGIPVANTPGGNATSVAELTLGMIINLYRKIN 119

Query: 61  VANESTHKGKWEKFNFM 77
           + +  T KG W  + F 
Sbjct: 120 ILDRETKKGNWMSWEFR 136


>gi|77465409|ref|YP_354912.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Rhodobacter sphaeroides 2.4.1]
 gi|77389827|gb|ABA81011.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding subunit
           [Rhodobacter sphaeroides 2.4.1]
          Length = 316

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G W++   +G + G
Sbjct: 118 QGHASVTSGGWDRR--IGTQLG 137


>gi|256372302|ref|YP_003110126.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008886|gb|ACU54453.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 527

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/81 (45%), Positives = 56/81 (69%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + VVGRAGIG DNVD+  A++ G++V+N P  N ++ AEH ++L+LA+AR +P
Sbjct: 58  VLEAAHHLVVVGRAGIGLDNVDVETATKRGVMVVNAPQSNIVSAAEHTLALLLALARHVP 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S  +G+W +  F GVE 
Sbjct: 118 QAHASVQRGEWRRSAFQGVEL 138


>gi|88801791|ref|ZP_01117319.1| phosphoglycerate dehydrogenase SerA [Polaribacter irgensii 23-P]
 gi|88782449|gb|EAR13626.1| phosphoglycerate dehydrogenase SerA [Polaribacter irgensii 23-P]
          Length = 313

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K +GR G G +N+D   A R GI ++  P GN     EHA+ ++L++  ++ 
Sbjct: 57  FLNKATALKFIGRVGAGLENIDCDHAKRRGITLIAAPEGNKNAVGEHALGMLLSLFNKLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A++   +GKW +    G+E 
Sbjct: 117 KADKEIRQGKWLREENRGIEL 137


>gi|168213983|ref|ZP_02639608.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens CPE str. F4969]
 gi|170714513|gb|EDT26695.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens CPE str. F4969]
          Length = 301

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 46/75 (61%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V N P  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGLDNIDVQYAEQNGIKVRNNPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|221369409|ref|YP_002520505.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
 gi|221162461|gb|ACM03432.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
          Length = 316

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G W++   +G + G
Sbjct: 118 QGHASVTSGGWDRR--IGTQLG 137


>gi|310659117|ref|YP_003936838.1| phosphoglycerate dehydrogenase [Clostridium sticklandii DSM 519]
 gi|308825895|emb|CBH21933.1| Predicted phosphoglycerate dehydrogenase [Clostridium sticklandii]
          Length = 303

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 1   MLSHAKK--MKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           +L+      +K++ RAG+GTDN+D+  A++  I V NTP  ++ + AE A+  +L +AR 
Sbjct: 56  LLAKGHNGLLKMIVRAGVGTDNIDMDYANQLRIEVYNTPNASTDSVAELALGHLLVLARN 115

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  +  S   G+W K  ++G E 
Sbjct: 116 INKSIVSLRNGQWNKAAYLGTEI 138


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 54  FLNHAKKLKALVRAGVGVDNVDISECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 113

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 114 NAHNFLKIERKWEREKWYGIEL 135


>gi|168210531|ref|ZP_02636156.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens B str. ATCC 3626]
 gi|170711426|gb|EDT23608.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens B str. ATCC 3626]
          Length = 301

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGLDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNVTM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|156744237|ref|YP_001434366.1| glyoxylate reductase [Roseiflexus castenholzii DSM 13941]
 gi|156235565|gb|ABU60348.1| Glyoxylate reductase [Roseiflexus castenholzii DSM 13941]
          Length = 341

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A ++KVV    +G DNVDL   +  G+++ NTP   + TTA+   +L+LA +R++ 
Sbjct: 62  LLDAAPRLKVVANMAVGYDNVDLPALTARGVLLTNTPDVLTETTADLVWALILAASRRVV 121

Query: 61  VANESTHKGKWEKFNFM 77
             +     G W  ++ M
Sbjct: 122 EGHRLIAAGGWSTWSPM 138


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ ++  AR   
Sbjct: 60  FLKHAKKLKALVRAGVGVDNVDIPNCSKQGVIVMNVPTANTIAAVELTMAHLITSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|182625373|ref|ZP_02953146.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Clostridium perfringens
           D str. JGS1721]
 gi|177909370|gb|EDT71822.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Clostridium perfringens
           D str. JGS1721]
          Length = 301

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
            +K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  NLKLIIRGGVGLDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KAGLWKKKDYVGVEL 140


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ ++  AR   
Sbjct: 60  FLKHAKKLKALVRAGVGVDNVDIPNCSKQGVIVMNVPTANTIAAVELTMAHLITSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|153840396|ref|ZP_01993063.1| glycerate dehydrogenase [Vibrio parahaemolyticus AQ3810]
 gi|149745943|gb|EDM57073.1| glycerate dehydrogenase [Vibrio parahaemolyticus AQ3810]
          Length = 320

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  A  G +NVD+   +  GI V N     + +  EH I+++ A+ R + 
Sbjct: 61  VLSQLPQLKMIAVAATGFNNVDVNYCAEHGIAVANVRGYATRSVPEHVIAMLFALRRNLL 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|18976742|ref|NP_578099.1| 2-hydroxyacid dehydrogenase [Pyrococcus furiosus DSM 3638]
 gi|18892329|gb|AAL80494.1| phosphoglycerate dehydrogenase [Pyrococcus furiosus DSM 3638]
          Length = 333

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 5/85 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+     G D++D+  A+R GI V       S   AE A+ L++ + R+I 
Sbjct: 58  VLEKAERLKVISCHSAGYDHIDVEEATRKGIYVTKVSGLLSEAVAEFAVGLLINLMRKIH 117

Query: 61  VANESTHKGKWE-----KFNFMGVE 80
            A++   +G+WE        F G+E
Sbjct: 118 YADKLIRRGEWESHVKIWTGFKGIE 142


>gi|299536965|ref|ZP_07050270.1| glyoxylate reductase [Lysinibacillus fusiformis ZC1]
 gi|298727545|gb|EFI68115.1| glyoxylate reductase [Lysinibacillus fusiformis ZC1]
          Length = 320

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHA  +K+V    +G +N+D+    + GI+  NTP   + TTA+    L+LA AR+IP
Sbjct: 62  LLSHAPNLKLVTNLAVGYNNIDVKALKKRGIMATNTPGVLTNTTADLVFGLLLATARRIP 121

Query: 61  VANESTHKGKWEKFNFM 77
            +     +GKW+ +  M
Sbjct: 122 ESERYLREGKWKSWYPM 138


>gi|300775321|ref|ZP_07085183.1| D-3-phosphoglycerate dehydrogenase [Chryseobacterium gleum ATCC
           35910]
 gi|300506061|gb|EFK37197.1| D-3-phosphoglycerate dehydrogenase [Chryseobacterium gleum ATCC
           35910]
          Length = 309

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L   K +K + R G G +N+D+ VA R GI ++N+P GN  + AEH + ++L I  ++ 
Sbjct: 57  FLEKGKNLKFIARVGAGMENIDIPVAERLGIQLINSPEGNRDSVAEHVVGMLLVIMNRLF 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           +A++    G W++    G E 
Sbjct: 117 IASQEVKNGIWKREENRGDEL 137


>gi|209886661|ref|YP_002290518.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Oligotropha
           carboxidovorans OM5]
 gi|209874857|gb|ACI94653.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Oligotropha
           carboxidovorans OM5]
          Length = 303

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A K++V+GR G+G DN+D+       I V      N ++ AE+ I+  + + R   
Sbjct: 50  VLAAATKLEVIGRLGVGLDNIDVEACRARNIKVYPASGANDVSVAEYVIATAMVLLRGAY 109

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A      G+W +   +G E 
Sbjct: 110 QATPELVAGQWPRNRLVGREI 130


>gi|302557784|ref|ZP_07310126.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoflavus
           Tu4000]
 gi|302475402|gb|EFL38495.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoflavus
           Tu4000]
          Length = 319

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+GTD +D+  A   GI V+  P  NS   AE+   L+L  AR+I 
Sbjct: 68  VMDAAPRLKVIAKHGVGTDTIDVAAARDRGIPVVFAPGSNSRAVAEYTFGLVLDAARRIS 127

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++ +  +G W K    G E 
Sbjct: 128 ASHTAVTEGGWPK--LFGPEL 146


>gi|187780257|ref|ZP_02996730.1| hypothetical protein CLOSPO_03853 [Clostridium sporogenes ATCC
           15579]
 gi|187773882|gb|EDU37684.1| hypothetical protein CLOSPO_03853 [Clostridium sporogenes ATCC
           15579]
          Length = 317

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++     + +K+V RAG+G DNVDL  A   G++V NTP  +S++ AE  I  ML I+R 
Sbjct: 60  IIDAGIKRNLKLVVRAGVGLDNVDLEYAKEKGVIVFNTPKASSVSVAELTIGHMLCISRF 119

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 120 INTANVTMLEGKWEKKKYKGTEI 142


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKALVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMTHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|157738251|ref|YP_001490935.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
 gi|157700105|gb|ABV68265.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
          Length = 528

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ A  +K + RAG+G DNVD+   S+ GI+ MN P  N+I   E  ++ ML+  R+ P
Sbjct: 61  FLNAAVNLKALIRAGVGYDNVDIDGCSKRGIIAMNVPTANTIAAVELTMTHMLSCMRKFP 120

Query: 61  VANESTHK-GKWEKFNFMGVEA 81
            A+        W++ ++ G E 
Sbjct: 121 YAHNQLKNERVWKREDWYGNEL 142


>gi|52140625|ref|YP_086208.1| gluconate 2-dehydrogenase [Bacillus cereus E33L]
 gi|51974094|gb|AAU15644.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein;
           possible gluconate 2-dehydrogenase [Bacillus cereus
           E33L]
          Length = 330

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|42784088|ref|NP_981335.1| gluconate 2-dehydrogenase [Bacillus cereus ATCC 10987]
 gi|42740019|gb|AAS43943.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus ATCC 10987]
          Length = 320

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 60  LLEAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 119

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 120 ELDSYVKNGEWN------AEIG 135


>gi|227511275|ref|ZP_03941324.1| possible glyoxylate reductase [Lactobacillus buchneri ATCC 11577]
 gi|227085428|gb|EEI20740.1| possible glyoxylate reductase [Lactobacillus buchneri ATCC 11577]
          Length = 323

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D+  A   GI V NTP  ++++TAE    LM+A++ ++ 
Sbjct: 62  IIDKAPNLKLIANYGAGFNNIDVDYAKSKGIPVTNTPKVSTVSTAEVTCGLMIALSHRMM 121

Query: 61  VANESTH-KG--KWEKFNFMGVEA 81
             +     +G   W    F+G E 
Sbjct: 122 EGDTLMRHEGFSGWAPLFFLGHEL 145


>gi|295677206|ref|YP_003605730.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Burkholderia sp. CCGE1002]
 gi|295437049|gb|ADG16219.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Burkholderia sp. CCGE1002]
          Length = 329

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            +      G W+K+++ G   G
Sbjct: 118 ESEHWLRAGLWQKWSYDGF-LG 138


>gi|212223717|ref|YP_002306953.1| D-isomer specific 2-hydroxyacid dehydrogenase [Thermococcus
           onnurineus NA1]
 gi|212008674|gb|ACJ16056.1| D-isomer specific 2-hydroxyacid dehydrogenase [Thermococcus
           onnurineus NA1]
          Length = 333

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 38/72 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+KV+     G D+VD+  A+  GI V       S   AE A+ LM+A+ R+I 
Sbjct: 58  VIERAEKLKVISCHSAGYDHVDVKAATERGIYVTKVSGVLSEAVAEFAVGLMIALLRRIV 117

Query: 61  VANESTHKGKWE 72
             +     GKWE
Sbjct: 118 YTDRFIRAGKWE 129


>gi|152977197|ref|YP_001376714.1| gluconate 2-dehydrogenase [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152025949|gb|ABS23719.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Bacillus
           cytotoxicus NVH 391-98]
          Length = 320

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 36/72 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    R  ++  NTP+    T A+   +LML+ +R++ 
Sbjct: 60  LLQAAPNLKVVSNISVGYDNFDLKAMKRRNVIGTNTPYVLDDTVADLVFALMLSASRRVC 119

Query: 61  VANESTHKGKWE 72
             +     G W+
Sbjct: 120 ELDSYVKNGNWD 131


>gi|157693860|ref|YP_001488322.1| gluconate 2-dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157682618|gb|ABV63762.1| gluconate 2-dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 323

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 41/73 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+ V  + G++  +TP     T A+ A SL+L+ AR+I 
Sbjct: 60  LLDHAPKLKVVSNNSVGYDNFDIEVMRQRGVIGTHTPHTLDHTVADLAFSLILSSARRIA 119

Query: 61  VANESTHKGKWEK 73
             +    +G W K
Sbjct: 120 ELDRFIREGNWTK 132


>gi|149190307|ref|ZP_01868581.1| D-lactate dehydrogenase [Vibrio shilonii AK1]
 gi|148835914|gb|EDL52877.1| D-lactate dehydrogenase [Vibrio shilonii AK1]
          Length = 320

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK++K +  A  G +NV+L   ++ GI V N     + +  EH I+L+  + R IP
Sbjct: 61  ILEQAKQVKHIAVAATGVNNVELDYCAQRGITVTNVQGYATQSVPEHVIALLFTLMRNIP 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++ N
Sbjct: 121 AYHNDIRNGEWQRQN 135


>gi|126731962|ref|ZP_01747765.1| 2-hydroxyacid dehydrogenase [Sagittula stellata E-37]
 gi|126707494|gb|EBA06557.1| 2-hydroxyacid dehydrogenase [Sagittula stellata E-37]
          Length = 314

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++++   G+G D VD+  A   G+ V NTP   +   AE  ++LMLA+A ++P
Sbjct: 61  IIEALPDLEIISSFGVGYDAVDVEAAKEHGVRVTNTPDVLNDCVAEVTLALMLALAHRVP 120

Query: 61  VANESTHKGKWEKFNFM 77
            ++     G+WE    M
Sbjct: 121 ESHAYVRDGRWETEGAM 137


>gi|126463811|ref|YP_001044924.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126105622|gb|ABN78152.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 316

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K V + G+G DN+D+   + AG+ V NTP  N+   AE A+ LM A+AR IP
Sbjct: 58  VLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMARFIP 117

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             + S   G W++   +G + G
Sbjct: 118 QGHASVTSGGWDRR--IGTQLG 137


>gi|227523482|ref|ZP_03953531.1| possible glyoxylate reductase [Lactobacillus hilgardii ATCC 8290]
 gi|227089357|gb|EEI24669.1| possible glyoxylate reductase [Lactobacillus hilgardii ATCC 8290]
          Length = 326

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +N+D+  A   GI V NTP  ++++TAE    LM+A++ ++ 
Sbjct: 65  IIDKAPNLKLIANYGAGFNNIDVDYAKSKGIPVTNTPKVSTVSTAEVTCGLMIALSHRMM 124

Query: 61  VANESTH-KG--KWEKFNFMGVEA 81
             +     +G   W    F+G E 
Sbjct: 125 EGDTLMRHEGFSGWAPLFFLGHEL 148


>gi|300310960|ref|YP_003775052.1| dehydrogenase oxidoreductase [Herbaspirillum seropedicae SmR1]
 gi|124483470|emb|CAM32608.1| Dehydrogenase oxidoreductase protein [Herbaspirillum seropedicae]
 gi|300073745|gb|ADJ63144.1| dehydrogenase oxidoreductase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 326

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +   ++K V    +G +N+D+  A++AG++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 61  LFAANPQLKAVCNMAVGYNNIDVAAATQAGVMATNTPDVLNETTADFGWALMMAAARRIT 120

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      GKW+K+   +F+G + 
Sbjct: 121 ESEHFLRAGKWKKWSYDSFVGPDI 144


>gi|110799921|ref|YP_694527.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens ATCC 13124]
 gi|110674568|gb|ABG83555.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens ATCC 13124]
          Length = 301

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 48/75 (64%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  KLKLIIRGGVGLDNIDVQYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K +++GVE 
Sbjct: 126 KDGLWKKKDYVGVEL 140


>gi|116490150|ref|YP_809687.1| lactate dehydrogenase related enzyme [Oenococcus oeni PSU-1]
 gi|290889545|ref|ZP_06552635.1| hypothetical protein AWRIB429_0025 [Oenococcus oeni AWRIB429]
 gi|116090875|gb|ABJ56029.1| Lactate dehydrogenase related enzyme [Oenococcus oeni PSU-1]
 gi|290480743|gb|EFD89377.1| hypothetical protein AWRIB429_0025 [Oenococcus oeni AWRIB429]
          Length = 319

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A K+K++   G G +N+D+  A    I V NTPF ++ + AE    L+++++ ++ 
Sbjct: 61  VINAAPKLKLIANFGAGFNNIDINSARAKEISVTNTPFVSTTSVAEVTAGLIISLSHRLV 120

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
             +   H   +  ++   F+G E 
Sbjct: 121 EGDNLMHDQGFNGWSPLFFLGHEL 144


>gi|301056393|ref|YP_003794604.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis CI]
 gi|300378562|gb|ADK07466.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus biovar anthracis str. CI]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|300119695|ref|ZP_07057235.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus SJ1]
 gi|298722923|gb|EFI63825.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus SJ1]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|254761386|ref|ZP_05213407.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Australia 94]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|254725249|ref|ZP_05187032.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A1055]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|228936192|ref|ZP_04098992.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228823439|gb|EEM69271.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|228988148|ref|ZP_04148246.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228771559|gb|EEM20027.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|229094001|ref|ZP_04225088.1| 2-ketogluconate reductase [Bacillus cereus Rock3-42]
 gi|228689385|gb|EEL43201.1| 2-ketogluconate reductase [Bacillus cereus Rock3-42]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|229158505|ref|ZP_04286565.1| 2-ketogluconate reductase [Bacillus cereus ATCC 4342]
 gi|228624941|gb|EEK81708.1| 2-ketogluconate reductase [Bacillus cereus ATCC 4342]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|225866878|ref|YP_002752256.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus 03BB102]
 gi|225787433|gb|ACO27650.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus 03BB102]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|196040532|ref|ZP_03107832.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus NVH0597-99]
 gi|196028664|gb|EDX67271.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus NVH0597-99]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|218906102|ref|YP_002453936.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus AH820]
 gi|218535124|gb|ACK87522.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus AH820]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|118479997|ref|YP_897148.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus thuringiensis str. Al Hakam]
 gi|196043869|ref|ZP_03111106.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus 03BB108]
 gi|229187144|ref|ZP_04314290.1| 2-ketogluconate reductase [Bacillus cereus BGSC 6E1]
 gi|118419222|gb|ABK87641.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus thuringiensis str. Al Hakam]
 gi|196025205|gb|EDX63875.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus 03BB108]
 gi|228596313|gb|EEK53987.1| 2-ketogluconate reductase [Bacillus cereus BGSC 6E1]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|49480979|ref|YP_038924.1| gluconate 2-dehydrogenase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|49332535|gb|AAT63181.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein;
           possible gluconate 2-dehydrogenase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|47566937|ref|ZP_00237654.1| 2-ketogluconate 6-phosphate reductase [Bacillus cereus G9241]
 gi|47556255|gb|EAL14589.1| 2-ketogluconate 6-phosphate reductase [Bacillus cereus G9241]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|30264944|ref|NP_847321.1| gluconate 2-dehydrogenase [Bacillus anthracis str. Ames]
 gi|47530440|ref|YP_021789.1| gluconate 2-dehydrogenase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187763|ref|YP_031016.1| gluconate 2-dehydrogenase [Bacillus anthracis str. Sterne]
 gi|65316894|ref|ZP_00389853.1| COG1052: Lactate dehydrogenase and related dehydrogenases [Bacillus
           anthracis str. A2012]
 gi|165870928|ref|ZP_02215580.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0488]
 gi|167635015|ref|ZP_02393333.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0442]
 gi|167640059|ref|ZP_02398327.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0193]
 gi|170685617|ref|ZP_02876840.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0465]
 gi|170706985|ref|ZP_02897442.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0389]
 gi|177652298|ref|ZP_02934801.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0174]
 gi|190567158|ref|ZP_03020073.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis Tsiankovskii-I]
 gi|196032733|ref|ZP_03100146.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus W]
 gi|227817672|ref|YP_002817681.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. CDC 684]
 gi|228917532|ref|ZP_04081077.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228929930|ref|ZP_04092944.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228948626|ref|ZP_04110904.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229124446|ref|ZP_04253633.1| 2-ketogluconate reductase [Bacillus cereus 95/8201]
 gi|229603171|ref|YP_002869147.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0248]
 gi|254687236|ref|ZP_05151093.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. CNEVA-9066]
 gi|254735427|ref|ZP_05193135.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Western North America USA6153]
 gi|254740694|ref|ZP_05198385.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Kruger B]
 gi|254753044|ref|ZP_05205080.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Vollum]
 gi|30259619|gb|AAP28807.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Ames]
 gi|47505588|gb|AAT34264.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181690|gb|AAT57066.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. Sterne]
 gi|164713437|gb|EDR18962.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0488]
 gi|167512140|gb|EDR87518.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0193]
 gi|167529765|gb|EDR92514.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0442]
 gi|170128088|gb|EDS96958.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0389]
 gi|170670081|gb|EDT20821.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0465]
 gi|172082304|gb|EDT67370.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0174]
 gi|190561662|gb|EDV15632.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis Tsiankovskii-I]
 gi|195994162|gb|EDX58117.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus cereus W]
 gi|227004466|gb|ACP14209.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. CDC 684]
 gi|228658994|gb|EEL14647.1| 2-ketogluconate reductase [Bacillus cereus 95/8201]
 gi|228810933|gb|EEM57276.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228829727|gb|EEM75350.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842099|gb|EEM87201.1| 2-ketogluconate reductase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229267579|gb|ACQ49216.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Bacillus anthracis str. A0248]
          Length = 330

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL   ++  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 70  LLEAAPNLKVVSNISVGYDNFDLQAMAKHNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 129

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 130 ELDSYVKNGEWN------AEIG 145


>gi|224824327|ref|ZP_03697435.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Lutiella
           nitroferrum 2002]
 gi|224603746|gb|EEG09921.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Lutiella
           nitroferrum 2002]
          Length = 338

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 56/81 (69%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A++++++ RAG+GTDN+DL  A+  GI V+NTP  ++ + AE A+ ++LA+AR+IP 
Sbjct: 95  LAAAQRLRLIVRAGVGTDNIDLAAAASQGIAVLNTPKASTGSVAELALGMLLALARRIPQ 154

Query: 62  ANESTHKGKWEKFNFM-GVEA 81
           A+ +   G W K  F  G+E 
Sbjct: 155 ADAAVKSGGWPKKEFSDGIEL 175


>gi|297566922|ref|YP_003685894.1| glyoxylate reductase [Meiothermus silvanus DSM 9946]
 gi|296851371|gb|ADH64386.1| Glyoxylate reductase [Meiothermus silvanus DSM 9946]
          Length = 318

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++  A   ++V+    +G +N+DL  A   GI V NTP  N   TA+ A SL+ A+AR+I
Sbjct: 60  VMDAAGPGLRVIANYAVGVNNIDLNAARTRGIRVTNTPGVNMEATADLAFSLLCAVARRI 119

Query: 60  PVANESTHKGKWEKFN---FMGVEA 81
               +   +G+W+ ++    +G E 
Sbjct: 120 VEGVDYVRRGEWKTWHPELLLGTEL 144


>gi|255319472|ref|ZP_05360686.1| 2-ketogluconate reductase [Acinetobacter radioresistens SK82]
 gi|262378504|ref|ZP_06071661.1| 2-keto-D-gluconate reductase [Acinetobacter radioresistens SH164]
 gi|255303412|gb|EET82615.1| 2-ketogluconate reductase [Acinetobacter radioresistens SK82]
 gi|262299789|gb|EEY87701.1| 2-keto-D-gluconate reductase [Acinetobacter radioresistens SH164]
          Length = 323

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A+++K++    +G DN D+   ++  I + NTP   + TTA+ A SL+++ AR++P 
Sbjct: 62  LASAQQLKIISTVSVGYDNYDVDYLNQKKIWLSNTPHVLTETTADLAFSLLMSAARRVPY 121

Query: 62  ANESTHKGKWEKFNFMGVE 80
            ++ T +G+W++    G E
Sbjct: 122 LDQWTKQGQWKRTA--GTE 138


>gi|269836442|ref|YP_003318670.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
 gi|269785705|gb|ACZ37848.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Sphaerobacter thermophilus DSM 20745]
          Length = 318

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LSHA ++KV+  AG+G D++D+  A+R GI V N    N+ + AE A  +M+ ++R I 
Sbjct: 65  VLSHANRLKVISAAGVGFDHIDVEEATRRGIAVCNCHGCNNHSVAELAFGMMIGLSRSIY 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             +     G W    F G E 
Sbjct: 125 TLDRQIRNGGWGPVPF-GPEL 144


>gi|168182980|ref|ZP_02617644.1| phosphoglycerate dehydrogenase [Clostridium botulinum Bf]
 gi|237794419|ref|YP_002861971.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum Ba4 str. 657]
 gi|182673831|gb|EDT85792.1| phosphoglycerate dehydrogenase [Clostridium botulinum Bf]
 gi|229263963|gb|ACQ54996.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum Ba4 str. 657]
          Length = 314

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  M  I+R 
Sbjct: 57  IIDAGVKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMFCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|323691598|ref|ZP_08105861.1| hypothetical protein HMPREF9475_00723 [Clostridium symbiosum
           WAL-14673]
 gi|323504324|gb|EGB20123.1| hypothetical protein HMPREF9475_00723 [Clostridium symbiosum
           WAL-14673]
          Length = 315

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++G   +G +++D   A   GI + N P  N+   AE   S ML I+R   
Sbjct: 58  VLDAAKNLKIIGVCSVGLNHIDTEYAKEKGIQIFNAPGMNANAVAELTFSKMLDISRGTF 117

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN     K +W+K+ F+G E 
Sbjct: 118 TANYDVKVKHEWDKYKFVGREL 139


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 5/86 (5%)

Query: 1   MLSHA----KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIA 56
           +L  A    KK+K + RAG+G DNVD+   S  G+VVMN P  N+I   E  ++ +L+  
Sbjct: 60  LLESAYKDSKKLKAIVRAGVGVDNVDIDACSYRGVVVMNVPTANTIAAVELTMTHLLSAI 119

Query: 57  RQIPVANESTH-KGKWEKFNFMGVEA 81
           R+ P A+     + KW++ ++ G+E 
Sbjct: 120 RRFPSAHTQLKVERKWKREDWYGIEL 145


>gi|308188748|ref|YP_003932879.1| 2-ketogluconate reductase [Pantoea vagans C9-1]
 gi|308059258|gb|ADO11430.1| 2-ketogluconate reductase [Pantoea vagans C9-1]
          Length = 324

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 41/74 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++V     +G DN D+   ++  +V+M+TP   + T A+  ++L+L+ AR++P
Sbjct: 60  LLAKMPNLRVCSSVSVGYDNFDVDALNQRHVVLMHTPTVLTETVADTMMALVLSTARRVP 119

Query: 61  VANESTHKGKWEKF 74
             +     G W+K 
Sbjct: 120 ELDAWVKAGNWQKS 133


>gi|239917378|ref|YP_002956936.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|281414138|ref|ZP_06245880.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|239838585|gb|ACS30382.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
          Length = 531

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 51/80 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A ++KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE     +LA AR I  
Sbjct: 62  IAAAPQLKVIARAGVGLDNVDVPAATEAGVMVVNAPTSNIISAAELTCGHILAAARNIAA 121

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN S   G+W++  + G+E 
Sbjct: 122 ANGSLKAGEWKRSKYTGLEL 141


>gi|323482966|ref|ZP_08088364.1| D-3-phosphoglycerate dehydrogenase [Clostridium symbiosum
           WAL-14163]
 gi|323403746|gb|EGA96046.1| D-3-phosphoglycerate dehydrogenase [Clostridium symbiosum
           WAL-14163]
          Length = 315

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K++G   +G +++D   A   GI + N P  N+   AE   S ML I+R   
Sbjct: 58  VLDAAKNLKIIGVCSVGLNHIDTEYAKEKGIQIFNAPGMNANAVAELTFSKMLDISRGTF 117

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN     K +W+K+ F+G E 
Sbjct: 118 TANYDVKVKHEWDKYKFVGREL 139


>gi|307265932|ref|ZP_07547480.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918996|gb|EFN49222.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 331

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++      KV+ R G+G D +D+  A+  GI V+N P       ++HA++L+L  AR++ 
Sbjct: 62  VIEALDNCKVIARYGVGVDTIDIKAATARGICVVNVPDYCMDEVSDHALALLLGCARKVV 121

Query: 61  VANESTHKGKWE 72
           + N +   G W+
Sbjct: 122 LMNNAVKAGTWD 133


>gi|302383425|ref|YP_003819248.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302194053|gb|ADL01625.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 311

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L H   +K++     G D +DL   +  G+ V + P  N    A+HA+ L+LA  RQI 
Sbjct: 57  VLEHLPNLKLIACFTSGYDGIDLDWCAARGVPVTHAPAVNHEDVADHALGLILAARRQIV 116

Query: 61  VANESTHKGKW 71
             + +   G W
Sbjct: 117 TGDRTVKAGDW 127


>gi|254507379|ref|ZP_05119514.1| glyoxylate reductase (Glycolate reductase) [Vibrio parahaemolyticus
           16]
 gi|219549635|gb|EED26625.1| glyoxylate reductase (Glycolate reductase) [Vibrio parahaemolyticus
           16]
          Length = 325

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 36/74 (48%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L    ++K++  +  G +N+D+   +  GI V N     + +  EH I+++ A+ R +  
Sbjct: 67  LRQLPELKLIAVSATGFNNIDIDYCADNGIAVTNVQGYATQSVPEHVIAMIFALKRNLFA 126

Query: 62  ANESTHKGKWEKFN 75
            +     G+W++  
Sbjct: 127 YHNDIAAGEWQRNK 140


>gi|194015765|ref|ZP_03054381.1| glyoxylate reductase (Glycolate reductase) [Bacillus pumilus ATCC
           7061]
 gi|194013169|gb|EDW22735.1| glyoxylate reductase (Glycolate reductase) [Bacillus pumilus ATCC
           7061]
          Length = 325

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 42/73 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+ +  + G++  +TP     T A+ A SL+L+ AR+I 
Sbjct: 60  LLDHAPKLKVVSNNSVGYDNFDIELMRQRGVIGTHTPHTLDHTVADLAFSLILSSARRIA 119

Query: 61  VANESTHKGKWEK 73
             +    +GKW K
Sbjct: 120 ELDRFIREGKWTK 132


>gi|157364548|ref|YP_001471315.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga lettingae TMO]
 gi|157315152|gb|ABV34251.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga lettingae TMO]
          Length = 327

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 53/85 (62%), Gaps = 4/85 (4%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++  A K++KV+    +G +N+D+  A++ GI+V NTP   + TTA+ A +LM++IAR+I
Sbjct: 62  VMEAAGKQLKVIANYAVGYNNIDIEEATKRGIMVTNTPGVLTETTADLAWALMMSIARRI 121

Query: 60  PVANESTHKGKWEKFNFM---GVEA 81
             +++   +GK+  +  M   G + 
Sbjct: 122 VESDKFVREGKFNGWQPMLMLGTDI 146


>gi|195953212|ref|YP_002121502.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932824|gb|ACG57524.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 332

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++     G D++D+  A+  GI V N P     + +E+AI LMLA+AR++ 
Sbjct: 59  VIDSLPDLKLIATRSTGFDHIDVAYANSKGITVCNVPSYGEESVSEYAIMLMLALARKLR 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
              ++  KG ++  N  G+E 
Sbjct: 119 ETIDNVEKGVYKTSNLRGIEL 139


>gi|330448798|ref|ZP_08312445.1| glycerate dehydrogenase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492989|dbj|GAA06942.1| glycerate dehydrogenase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 317

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   K+K +     GT+NVD+    +  + V N     + +  EH I+++ A+ R I 
Sbjct: 59  ILSQLPKLKFIAIGATGTNNVDIDYCHQHHLPVANIRGYATRSVPEHVIAMIFALKRNIV 118

Query: 61  VANESTHKGKWEK 73
              +    G+W+K
Sbjct: 119 GYQQDIIAGEWQK 131


>gi|296134977|ref|YP_003642219.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thiomonas intermedia K12]
 gi|295795099|gb|ADG29889.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thiomonas intermedia K12]
          Length = 328

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++ VV    +G D++DL   +  G++V + P   + TTA+   +L+LA ARQ+ 
Sbjct: 68  LLDACPQLLVVSTMTVGVDHIDLAACAERGVIVTHAPDVLTETTADFGFALLLAAARQVG 127

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            A      G+W+K++   F G + 
Sbjct: 128 EAERYLRAGQWKKWSVDLFAGADV 151


>gi|312884627|ref|ZP_07744330.1| D-lactate dehydrogenase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367719|gb|EFP95268.1| D-lactate dehydrogenase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 320

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 34/75 (45%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++  A  G +NVD+    +  I + N     + +  EH I LM A+ R + 
Sbjct: 61  ILRDLPSLKMIAIAATGYNNVDVEYCRKHNIAITNVQGYANQSVPEHVIGLMFALQRNLV 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 121 GYHNDIANGEWQRNK 135


>gi|294338962|emb|CAZ87306.1| putative glyoxylate reductase (Glycolate reductase) [Thiomonas sp.
           3As]
          Length = 327

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++ VV    +G D++DL   +  G+ V + P   + TTA+   +L+LA ARQ+ 
Sbjct: 68  LLDACPQLLVVSTMTVGVDHIDLAACAERGVTVTHAPDVLTETTADFGFALLLAAARQVG 127

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            A      G+W+K++   F G + 
Sbjct: 128 EAERYLRAGQWKKWSVDLFAGADV 151


>gi|330810168|ref|YP_004354630.1| putative glyoxylate reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378276|gb|AEA69626.1| putative glyoxylate reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 317

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++    +K++   G G + VDL  A   GIVV N    N+ + A+HA++L+LA+ R IP 
Sbjct: 62  IAALPNLKIICVIGAGYEQVDLQAARHRGIVVTNGAGVNASSVADHAMALLLALVRDIPH 121

Query: 62  ANESTHKGKWE---KFNFMGVEAG 82
           ++ +  +G+W    + +  G   G
Sbjct: 122 SDAALRRGEWPRVARPSLAGKRLG 145


>gi|148379114|ref|YP_001253655.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           ATCC 3502]
 gi|148288598|emb|CAL82679.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           A str. ATCC 3502]
          Length = 314

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A    + V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKEVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|110803818|ref|YP_697406.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens SM101]
 gi|110684319|gb|ABG87689.1| putative D-3-phosphoglycerate dehydrogenase [Clostridium
           perfringens SM101]
          Length = 301

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%)

Query: 7   KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANEST 66
           K+K++ R G+G DN+D+  A + GI V NTP  +S + AE  ++ M ++AR +  +N + 
Sbjct: 66  KLKLIIRGGVGLDNIDVKYAEQNGIKVRNTPNASSSSVAEIILAHMFSLARFLNQSNITM 125

Query: 67  HKGKWEKFNFMGVEA 81
             G W+K  ++GVE 
Sbjct: 126 KAGLWKKKEYVGVEL 140


>gi|116624217|ref|YP_826373.1| D-isomer specific 2-hydroxyacid dehydrogenase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116227379|gb|ABJ86088.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 312

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 48/73 (65%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           + +   K+++V   G GTD+VDL  A+R G+ V NTP   + + AEH ++L+ A+ARQIP
Sbjct: 65  VFAACPKLRMVSIWGTGTDHVDLAAAARHGVTVANTPGVAARSIAEHTLALLFAVARQIP 124

Query: 61  VANESTHKGKWEK 73
             + +T +G WE+
Sbjct: 125 HMDAATRRGAWER 137


>gi|319761710|ref|YP_004125647.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Alicycliphilus denitrificans BC]
 gi|317116271|gb|ADU98759.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Alicycliphilus denitrificans BC]
          Length = 318

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 36/74 (48%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A ++++V  A  GTDNVD+      GIVV N       T  EH  +L+ A+ R I  
Sbjct: 59  IEAAPRLRLVAVAATGTDNVDIAACRERGIVVSNIRNYAVNTVPEHTFALIFALRRSICA 118

Query: 62  ANESTHKGKWEKFN 75
             ++   G+W+   
Sbjct: 119 YRDAVRAGRWQDSG 132


>gi|146298601|ref|YP_001193192.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Flavobacterium johnsoniae UW101]
 gi|146153019|gb|ABQ03873.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Flavobacterium johnsoniae UW101]
          Length = 314

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 40/81 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  ++ + R G G +++D   A   GI ++  P GN    AEH++ ++L++   + 
Sbjct: 59  FLDKAVNLQFIARVGAGLESIDCDYAETKGIRLIAAPEGNRNAVAEHSLGVILSLFNNLN 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G+W + +  G E 
Sbjct: 119 QADAEVKAGQWNRESNRGHEL 139


>gi|262341059|ref|YP_003283914.1| phosphoglycerate dehydrogenase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272396|gb|ACY40304.1| phosphoglycerate dehydrogenase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 315

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  AK +K + R G G +N+D     + GIV++++P GN    AEHAI ++L     I 
Sbjct: 57  FIKKAKNLKFIARIGSGIENIDTDYVLKKGIVLISSPEGNKDAVAEHAIGMLLCAMNHIL 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +++   KGKW + N  G+E 
Sbjct: 117 RSHQQIKKGKWYRENNRGMEI 137


>gi|56962002|ref|YP_173724.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56908236|dbj|BAD62763.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 316

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 45/72 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +K++ + G+G DN+D+  A + G+ V N P  N    A+ A SL+L++ARQIP
Sbjct: 61  VLAQLPDLKIIAKHGVGVDNIDVDAAKKHGVTVTNVPNANKHAVADFAFSLLLSLARQIP 120

Query: 61  VANESTHKGKWE 72
             NE T KGKW 
Sbjct: 121 TGNEKTKKGKWP 132


>gi|254252876|ref|ZP_04946194.1| Lactate dehydrogenase [Burkholderia dolosa AUO158]
 gi|124895485|gb|EAY69365.1| Lactate dehydrogenase [Burkholderia dolosa AUO158]
          Length = 331

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 61  LAAAPRLRVVSNMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIAE 120

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G+W+K+ + G   G
Sbjct: 121 SEHWLRAGRWQKWAYDGF-LG 140


>gi|47116739|sp|Q9C4M5|GYAR_THELI RecName: Full=Glyoxylate reductase
 gi|13516509|dbj|BAB40320.1| glyoxylate reductase [Thermococcus litoralis]
          Length = 331

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 5/82 (6%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A K+K++ +  +G DN+D+  A++ GI V NTP   +  TA+ A +L+LA+AR+I 
Sbjct: 61  LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
            A+     G+W+K      E G
Sbjct: 121 EADAFVRSGEWKKS-----EVG 137


>gi|323496131|ref|ZP_08101191.1| D-lactate dehydrogenase [Vibrio sinaloensis DSM 21326]
 gi|323318875|gb|EGA71826.1| D-lactate dehydrogenase [Vibrio sinaloensis DSM 21326]
          Length = 325

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 36/74 (48%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           LS    +K++  +  G +NVD+   +  GI V N     + +  EH I+++ A+ R +  
Sbjct: 67  LSQLPDLKLIAVSATGFNNVDIDYCAERGIAVTNVQGYATQSVPEHVIAMIFALKRNLMA 126

Query: 62  ANESTHKGKWEKFN 75
            +     G+W++  
Sbjct: 127 YHNDIAAGEWQRNK 140


>gi|260772178|ref|ZP_05881095.1| hydroxypyruvate reductase [Vibrio metschnikovii CIP 69.14]
 gi|260613045|gb|EEX38247.1| hydroxypyruvate reductase [Vibrio metschnikovii CIP 69.14]
          Length = 320

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K+K+V  +  GT+NVDL       I V N     + +  EH I++M A+ R + 
Sbjct: 61  ILAQLPKLKLVAISATGTNNVDLPACRELNIAVCNVQGYATQSVPEHVIAMMFALRRNLF 120

Query: 61  VANESTHKGKWEKFN 75
             ++    G+W++  
Sbjct: 121 GYHQDIAAGEWQRNK 135


>gi|88856753|ref|ZP_01131408.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
 gi|88814050|gb|EAR23917.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
          Length = 530

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 49/73 (67%)

Query: 9   KVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVANESTHK 68
           KV+ RAG+G DNVD+  A+ AG++V+N P  N I+ AE  +  +L++AR IP A+ +  +
Sbjct: 67  KVIARAGVGLDNVDIKAATAAGVMVVNAPTSNIISAAELTVGHILSLARHIPAAHGALAQ 126

Query: 69  GKWEKFNFMGVEA 81
           G+W++  + G E 
Sbjct: 127 GQWKRSQYSGTEL 139


>gi|315179047|gb|ADT85961.1| 2-hydroxyacid dehydrogenase family protein [Vibrio furnissii NCTC
           11218]
          Length = 320

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 36/75 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K++++  +  G +NVD+       I V N     + +  EH +++M A+ R + 
Sbjct: 61  ILAQLPKVRLIAVSATGFNNVDIDYCRAHHIAVCNVQGYATQSVPEHVVAMMFALRRNLM 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 121 GYHHDIAAGEWQRNK 135


>gi|260771001|ref|ZP_05879930.1| hydroxypyruvate reductase [Vibrio furnissii CIP 102972]
 gi|260614238|gb|EEX39428.1| hydroxypyruvate reductase [Vibrio furnissii CIP 102972]
          Length = 320

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 36/75 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   K++++  +  G +NVD+       I V N     + +  EH +++M A+ R + 
Sbjct: 61  ILAQLPKVRLIAVSATGFNNVDIDYCRAHHIAVCNVQGYATQSVPEHVVAMMFALRRNLM 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 121 GYHHDIAAGEWQRNK 135


>gi|325954638|ref|YP_004238298.1| phosphoglycerate dehydrogenase [Weeksella virosa DSM 16922]
 gi|323437256|gb|ADX67720.1| Phosphoglycerate dehydrogenase [Weeksella virosa DSM 16922]
          Length = 316

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A K+K +GR G G +N+D   A+  GIV+ N+P GN  +  EHAI ++L +   + 
Sbjct: 57  FIEKATKLKWIGRVGAGLENIDESFAAEKGIVLFNSPEGNRTSVGEHAIGMLLMLMHHLR 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+     G W +    G E 
Sbjct: 117 RADLEVRNGIWRREQNRGDEL 137


>gi|289550095|ref|YP_003470999.1| Glyoxylate reductase/Glyoxylate reductase/Hydroxypyruvate reductase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315659272|ref|ZP_07912136.1| glyoxylate reductase [Staphylococcus lugdunensis M23590]
 gi|289179627|gb|ADC86872.1| Glyoxylate reductase/Glyoxylate reductase/Hydroxypyruvate reductase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315495697|gb|EFU84028.1| glyoxylate reductase [Staphylococcus lugdunensis M23590]
          Length = 318

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +NVD+  A    I V NTP  ++  TAE    L+LA+AR+I 
Sbjct: 61  VIDAANNLKIIANYGAGFNNVDVDYAREKNIDVTNTPKASTNATAELTFGLVLAVARRIV 120

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
             ++ +    ++ +    F G E 
Sbjct: 121 EGDKLSRTQGFDGWAPLFFRGREV 144


>gi|317405026|gb|EFV85378.1| D-isomer specific 2-hydroxyacid dehydrogenase [Achromobacter
           xylosoxidans C54]
          Length = 315

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 2/77 (2%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++   ++ ++   G+G +N+DL  A   G+ V + P  N+ + A+HA++L+L +AR +P 
Sbjct: 62  MAALPRLSLICSLGVGFENIDLAAARARGVQVTHGPGANATSVADHAMALLLGVARHLPQ 121

Query: 62  ANESTHKGKWEKFNFMG 78
           A+    +G W    FMG
Sbjct: 122 ADAWVRQGHW--SGFMG 136


>gi|305664166|ref|YP_003860454.1| D-3-phosphoglycerate dehydrogenase [Ignisphaera aggregans DSM
           17230]
 gi|304378735|gb|ADM28574.1| D-3-phosphoglycerate dehydrogenase [Ignisphaera aggregans DSM
           17230]
          Length = 310

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++++ R GIG DNVD+  A + GI V+N P  ++I+ AE  + L++ I R + 
Sbjct: 62  LIDKGHNLRILARYGIGLDNVDIDYAIKKGIAVVNAPNASTISVAELTLGLIIMIFRNLY 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
              E   +G W K  F+G E 
Sbjct: 122 NYIEHVKRGLWPKGKFIGREL 142


>gi|304398047|ref|ZP_07379922.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Pantoea
           sp. aB]
 gi|304354333|gb|EFM18705.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Pantoea
           sp. aB]
          Length = 324

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 41/74 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    ++V     +G DN D+   ++  +V+M+TP   + T A+  ++L+L+ AR++P
Sbjct: 60  LLAKMPNLRVCSSVSVGYDNFDVDALNQRNVVLMHTPTVLTETVADTMMALVLSTARRVP 119

Query: 61  VANESTHKGKWEKF 74
             +     G W+K 
Sbjct: 120 ELDAWVKAGNWQKS 133


>gi|153939399|ref|YP_001390479.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|152935295|gb|ABS40793.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|295318562|gb|ADF98939.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum F str.
           230613]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|167563563|ref|ZP_02356479.1| glyoxylate reductase [Burkholderia oklahomensis EO147]
 gi|167570722|ref|ZP_02363596.1| glyoxylate reductase [Burkholderia oklahomensis C6786]
          Length = 329

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFNAAHVLGTNTPDVLNETTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGQWRKWSYDSFLGADI 141


>gi|317053303|ref|YP_004119070.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pantoea sp. At-9b]
 gi|316953042|gb|ADU72514.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pantoea sp. At-9b]
          Length = 330

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ A+++K+V R G+G D+VD+   +   I +      NS++ AEHA+S++LA+A+++  
Sbjct: 59  IASAQQLKIVSRHGVGYDSVDVEALTERNIPLTIVGDVNSLSVAEHALSMLLALAKRVTW 118

Query: 62  ANESTHKGKW-EKFNFMGVEA 81
            + S  +G+W ++  F  VE 
Sbjct: 119 FDRSIREGRWNQRNTFSAVEI 139


>gi|226948399|ref|YP_002803490.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A2 str. Kyoto]
 gi|226842088|gb|ACO84754.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A2 str. Kyoto]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|284049355|ref|YP_003399694.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
 gi|283953576|gb|ADB48379.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
          Length = 529

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 48/79 (60%)

Query: 3   SHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPVA 62
             A+ +KVVGRAG G DN+D+  A++ GI+V+NTP  N I+ AEH I LMLA  R    A
Sbjct: 63  QAARNLKVVGRAGNGVDNIDIEGATKRGIIVVNTPEANVISAAEHTIGLMLASCRNTVKA 122

Query: 63  NESTHKGKWEKFNFMGVEA 81
            +      W++ N  GVE 
Sbjct: 123 QKMIESRVWDRKNLKGVEL 141


>gi|322805452|emb|CBZ03016.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum H04402
           065]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|170758864|ref|YP_001786515.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169405853|gb|ACA54264.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|229087415|ref|ZP_04219549.1| 2-ketogluconate reductase [Bacillus cereus Rock3-44]
 gi|228695837|gb|EEL48688.1| 2-ketogluconate reductase [Bacillus cereus Rock3-44]
          Length = 320

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    R  I+  NTP+    T A+   +LMLA  R++ 
Sbjct: 60  LLQAAPHLKVVSNISVGYDNFDLEAMKRKSIIGTNTPYVLDDTVADLVFALMLATGRRVC 119

Query: 61  VANESTHKGKWE---KFNFMGVEA 81
             +    +GKW+   K    G++ 
Sbjct: 120 ELDSYVKQGKWDDEIKKEHFGLDI 143


>gi|168178548|ref|ZP_02613212.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum NCTC
           2916]
 gi|182670771|gb|EDT82745.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum NCTC
           2916]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|325981433|ref|YP_004293835.1| phosphoglycerate dehydrogenase [Nitrosomonas sp. AL212]
 gi|325530952|gb|ADZ25673.1| Phosphoglycerate dehydrogenase [Nitrosomonas sp. AL212]
          Length = 309

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 41/75 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A  +KV+ R G G D+VDL  A   GI V+NTP   +   AE  +  +L++ RQI 
Sbjct: 65  VFQAAPNLKVISRCGTGLDSVDLSAAGNRGIAVLNTPEAPAQAVAELTLGFILSLLRQIG 124

Query: 61  VANESTHKGKWEKFN 75
             +++  KG+W +  
Sbjct: 125 TIDQAVRKGEWPRTQ 139


>gi|83652415|gb|ABC36478.1| glyoxylate reductase [Burkholderia thailandensis E264]
          Length = 353

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 82  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIA 141

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 142 ESEHWLRAGRWRKWSYDSFLGADI 165


>gi|182420228|ref|ZP_02951458.1| glycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237665942|ref|ZP_04525930.1| glycerate dehydrogenase [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182375926|gb|EDT73517.1| glycerate dehydrogenase [Clostridium butyricum 5521]
 gi|237658889|gb|EEP56441.1| glycerate dehydrogenase [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++  A  G D+VD+      GI V N    +++  A+    L++ I R I 
Sbjct: 64  VIEKCPNLKMICVAFTGVDHVDIDYCKDRGITVCNCAGYSTVAVADLVFGLLINIYRNIV 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             N  T KG   K   +G E 
Sbjct: 124 ECNIVTRKGG-TKNGLVGFEL 143


>gi|170756982|ref|YP_001780756.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum B1 str.
           Okra]
 gi|169122194|gb|ACA46030.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum B1 str. Okra]
          Length = 314

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A   G+ V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKGVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYKGTEI 139


>gi|107022180|ref|YP_620507.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Burkholderia cenocepacia AU 1054]
 gi|116689126|ref|YP_834749.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Burkholderia cenocepacia HI2424]
 gi|105892369|gb|ABF75534.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Burkholderia cenocepacia AU 1054]
 gi|116647215|gb|ABK07856.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Burkholderia cenocepacia HI2424]
          Length = 329

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVANMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIAE 118

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G W+K+ + G   G
Sbjct: 119 SEHWLRAGHWQKWAYDGF-LG 138


>gi|260779408|ref|ZP_05888299.1| D-lactate dehydrogenase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604498|gb|EEX30798.1| D-lactate dehydrogenase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 320

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 34/75 (45%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++  +  G +N+D+       I V N     + +  EH I ++ A+ R + 
Sbjct: 61  VLRQLPDLKLIAVSATGFNNIDIDYCREQNIAVTNVQGYATQSVPEHVIGMIFALKRNLM 120

Query: 61  VANESTHKGKWEKFN 75
             +    KG+W++  
Sbjct: 121 GYHNDIAKGEWQRNK 135


>gi|167837380|ref|ZP_02464263.1| 2-hydroxyacid dehydrogenase [Burkholderia thailandensis MSMB43]
          Length = 331

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+   + A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 60  VLAAAPRLRVVSNMAVGYNNFDIGAFNAAHVLGTNTPDVLTETTADFGWALMMAAARRIA 119

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 120 ESEHWLRAGQWRKWSYDSFLGADI 143


>gi|323492964|ref|ZP_08098102.1| hypothetical protein VIBR0546_19347 [Vibrio brasiliensis LMG 20546]
 gi|323312795|gb|EGA65921.1| hypothetical protein VIBR0546_19347 [Vibrio brasiliensis LMG 20546]
          Length = 320

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K+V  +  G +NVD+    + GI V N     + +  EH +++M A+ R + 
Sbjct: 61  ILSQLTNLKLVAVSATGFNNVDIDYCRQHGIAVTNVQGYATQSVPEHVVAMMFALKRNLK 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 121 GYHNDIAAGEWQRNK 135


>gi|221632802|ref|YP_002522024.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
 gi|221156297|gb|ACM05424.1| glyoxylate reductase [Thermomicrobium roseum DSM 5159]
          Length = 328

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +KVV    +G DN+D+   +R G+VV  TP   + TTA+   +LMLA+AR++ 
Sbjct: 60  LLNALPTVKVVSNMAVGFDNIDVDACTRRGVVVCITPDVLTETTADFTWALMLAVARRVC 119

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            A ES   G W  +    F+G + 
Sbjct: 120 EAAESVRAGTWRTWEPLGFLGRDL 143


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD+   S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 60  FLNHAKKLKTLVRAGVGVDNVDIPECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 119

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 120 NAHNFLKIERKWEREKWYGIEL 141


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+HAKK+K + RAG+G DNVD++  S+ G++VMN P  N+I   E  ++ +L  AR   
Sbjct: 62  FLNHAKKLKALVRAGVGVDNVDILECSKRGVIVMNVPTANTIAAVELTMAHLLTSARSFV 121

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + KWE+  + G+E 
Sbjct: 122 NAHNFLKIERKWEREKWYGIEL 143


>gi|54307621|ref|YP_128641.1| D-lactate dehydrogenase [Photobacterium profundum SS9]
 gi|46912044|emb|CAG18839.1| putative 2-hydroxyacid dehydrogenase family protein [Photobacterium
           profundum SS9]
          Length = 334

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  +  GT+NVDL    +  I V N     + +  EH I++M A+ R + 
Sbjct: 76  VLSQLPQLKMIAISATGTNNVDLAYCHQHKITVANIRGYATNSVPEHVIAMMFALKRNLM 135

Query: 61  VANESTHKGKWEKFN 75
             ++    G W++  
Sbjct: 136 GYHQDIQAGVWQQKK 150


>gi|90411939|ref|ZP_01219947.1| D-lactate dehydrogenase [Photobacterium profundum 3TCK]
 gi|90327197|gb|EAS43569.1| D-lactate dehydrogenase [Photobacterium profundum 3TCK]
          Length = 334

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   ++K++  +  GT+NVDL    +  I V N     + +  EH I++M A+ R + 
Sbjct: 76  VLSQLPQLKMIAISATGTNNVDLAYCHQHNITVANIRGYATDSVPEHVIAMMFALKRNLM 135

Query: 61  VANESTHKGKWEKFN 75
             ++    G W++  
Sbjct: 136 GYHQDIQAGVWQQKK 150


>gi|332112143|gb|EGJ12119.1| putative 2-hydroxyacid dehydrogenase [Rubrivivax benzoatilyticus
           JA2]
          Length = 328

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 42/76 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    +++VV    +G +N+D+   +  G++  NTP   + TTA+    LMLA AR++ 
Sbjct: 62  LLDACPQLRVVANMAVGYNNLDIAAFNVRGVLATNTPDVLTETTADFGFGLMLAAARRMS 121

Query: 61  VANESTHKGKWEKFNF 76
            +      G+W+++ +
Sbjct: 122 ESERFLRAGQWKRWRY 137


>gi|269839039|ref|YP_003323731.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269790769|gb|ACZ42909.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 319

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A +++ + + G+G DN+DL  A R GIVV  TP     + A+  + L++A+ARQI 
Sbjct: 69  VIEAAGRLRTIAKHGVGLDNIDLEAARRRGIVVTATPGAIHDSVADLTMGLIIAVARQIV 128

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ ST  G+W   NF+G+E 
Sbjct: 129 PAHNSTVAGEW--RNFVGLEL 147


>gi|153932143|ref|YP_001383494.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           ATCC 19397]
 gi|153935586|ref|YP_001387043.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum A str.
           Hall]
 gi|152928187|gb|ABS33687.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A str. ATCC 19397]
 gi|152931500|gb|ABS36999.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Clostridium botulinum A str. Hall]
          Length = 314

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++       +K+V RAG+G DNVDL  A    + V NTP  +S++ AE  +  ML I+R 
Sbjct: 57  IIDAGIKGNLKLVVRAGVGLDNVDLEYAKEKEVKVFNTPKASSVSVAELTLGHMLCISRF 116

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           I  AN +  +GKWEK  + G E 
Sbjct: 117 INTANVTMLQGKWEKKKYNGTEI 139


>gi|170732414|ref|YP_001764361.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia cenocepacia MC0-3]
 gi|169815656|gb|ACA90239.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia cenocepacia MC0-3]
          Length = 329

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVANMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIAE 118

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G W+K+ + G   G
Sbjct: 119 SEHWLRAGHWQKWAYDGF-LG 138


>gi|309777488|ref|ZP_07672442.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Erysipelotrichaceae
           bacterium 3_1_53]
 gi|308914728|gb|EFP60514.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Erysipelotrichaceae
           bacterium 3_1_53]
          Length = 310

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+    K+K V + G+GTDN+DL  A    I V      NS + AEH +S+M   A+ + 
Sbjct: 63  MMEGCPKLKAVCKFGVGTDNIDLEYAKEHNIYVGRCVGSNSRSVAEHVLSMMFMEAKNLY 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +     +  W K    G E 
Sbjct: 123 TSVRDVKEHGWNK--PTGREI 141


>gi|116694562|ref|YP_728773.1| glycerate dehydrogenase [Ralstonia eutropha H16]
 gi|113529061|emb|CAJ95408.1| glycerate dehydrogenase [Ralstonia eutropha H16]
          Length = 318

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 39/74 (52%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  A  +K++  A  GTD VDL   +  GIVV N       T  EH  +L++A+ R +  
Sbjct: 59  LEQAPNLKLIAIAATGTDVVDLQACAARGIVVSNIRNYAVHTVPEHTFALIVALRRSLAA 118

Query: 62  ANESTHKGKWEKFN 75
            +++  +G+W++  
Sbjct: 119 YHDAVRRGRWQESG 132


>gi|91773558|ref|YP_566250.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Methanococcoides burtonii DSM 6242]
 gi|91712573|gb|ABE52500.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
          Length = 317

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A  +K++ R G+G D V+  + ++ GI V  TP   ++  AE  + ++L ++R+I 
Sbjct: 63  VIKNAPNLKLISRVGVGLDGVNFELCNKYGIKVTYTPDAPTMAVAELCVGIILDLSRKIS 122

Query: 61  VANESTHKGKWEKFNFMGV 79
             + +  KG W++  +MG 
Sbjct: 123 YTDRNVRKGVWDR--YMGN 139


>gi|146303041|ref|YP_001190357.1| glyoxylate reductase [Metallosphaera sedula DSM 5348]
 gi|145701291|gb|ABP94433.1| Glyoxylate reductase [Metallosphaera sedula DSM 5348]
          Length = 315

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +KV+    +G D++D+  A   GI V NTP   +  TA+    L+LA+AR+I 
Sbjct: 60  VIDAGVNLKVISTYSVGFDHIDVKYALSKGIRVTNTPDVLTDATADLIFGLLLAVARRIV 119

Query: 61  VANESTHKGKWE----KFNFMGVEA 81
             +     GKW         +G E 
Sbjct: 120 EGDRLIRDGKWNLPWYPEFMLGKEV 144


>gi|300812700|ref|ZP_07093109.1| putative glyoxylate reductase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496327|gb|EFK31440.1| putative glyoxylate reductase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 316

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V   G+G D++D+  AS  GI+V N P      TAE A +L+LA++R++ 
Sbjct: 58  LLDAGKKLKIVSATGVGYDHIDVDYASSQGIIVSNCPASVMQPTAEMAFTLLLALSRKLA 117

Query: 61  VANESTHKGKW 71
           + N+   +GK+
Sbjct: 118 LYNQEMRQGKF 128


>gi|284045769|ref|YP_003396109.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Conexibacter woesei DSM 14684]
 gi|283949990|gb|ADB52734.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Conexibacter woesei DSM 14684]
          Length = 324

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 42/79 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    +++V+ R G G D VD+  A   GI V+  P       A+H ++L+LA AR++P
Sbjct: 63  LMDRLPQLRVIARCGSGYDKVDVEGAYARGIEVVYVPDYGVDDVADHTLALLLACARRVP 122

Query: 61  VANESTHKGKWEKFNFMGV 79
            ++ +   G W  +  +G 
Sbjct: 123 SSDRAMRAGLWPPYADLGT 141


>gi|261253958|ref|ZP_05946531.1| hydroxypyruvate reductase [Vibrio orientalis CIP 102891]
 gi|260937349|gb|EEX93338.1| hydroxypyruvate reductase [Vibrio orientalis CIP 102891]
          Length = 320

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS   K+K++  A  G +NVD+      GI V N     + +  EH I++M A+ R + 
Sbjct: 61  VLSQLPKLKMIAIAATGFNNVDVQCCQELGIAVANVQGYATQSVPEHVIAMMFALKRNLK 120

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 121 GYHNDIAAGEWQRNK 135


>gi|295401385|ref|ZP_06811356.1| Glyoxylate reductase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109655|ref|YP_003987971.1| glyoxylate reductase [Geobacillus sp. Y4.1MC1]
 gi|294976600|gb|EFG52207.1| Glyoxylate reductase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214756|gb|ADP73360.1| Glyoxylate reductase [Geobacillus sp. Y4.1MC1]
          Length = 326

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV   G+G DN+D+  A++ GI V NTP   + TTA+   +L+LA AR++ 
Sbjct: 63  ILEAGKSLKVVANMGVGFDNIDIPAATKHGIAVCNTPDVLTDTTADLTFALLLATARRVV 122

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 123 EAAQWIKEGKWKSWS 137


>gi|148654397|ref|YP_001274602.1| glyoxylate reductase [Roseiflexus sp. RS-1]
 gi|148566507|gb|ABQ88652.1| Glyoxylate reductase [Roseiflexus sp. RS-1]
          Length = 340

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A ++KVV    +G DNVDL   +  G+++ NTP   + TTA+   +L+LA +R++ 
Sbjct: 62  LLAAAPRLKVVANMAVGYDNVDLPALTARGVLLTNTPDVLTETTADLVWALILAASRRVV 121

Query: 61  VANESTHKGKWEKFNFM 77
             +     G W  ++ M
Sbjct: 122 EGHRLIAAGGWTTWSPM 138


>gi|145588571|ref|YP_001155168.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145046977|gb|ABP33604.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 338

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ AK +K+V    +G +N D+   + AG++  NTP   + TTA+   +L++A AR+I  
Sbjct: 73  LAQAKDLKIVANISVGYNNFDVPAITTAGVMATNTPDVLTDTTADFGFALLMATARRITE 132

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      GKW+K++ +    G
Sbjct: 133 SEHWIRAGKWDKWSIVNNPLG 153


>gi|323489737|ref|ZP_08094963.1| 2-ketogluconate reductase [Planococcus donghaensis MPA1U2]
 gi|323396567|gb|EGA89387.1| 2-ketogluconate reductase [Planococcus donghaensis MPA1U2]
          Length = 330

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ HA K+K V     G DN+DL   +  GIV  NTP     TTA+    LML+ AR+IP
Sbjct: 56  LVDHAPKLKFVANISAGYDNLDLEELTARGIVATNTPDVLVETTADLVFGLMLSAARRIP 115

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             ++    GKW     +  E 
Sbjct: 116 ELDQYVKSGKWSGK--ISNEL 134


>gi|291166719|gb|EFE28765.1| phosphoglycerate dehydrogenase [Filifactor alocis ATCC 35896]
          Length = 303

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 1   MLSHA--KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQ 58
           ++      K K++ RAG+G DN+D   A+   I V NTP  ++   AE  +  M  +AR 
Sbjct: 59  LIDAMAKGKTKLIIRAGVGLDNIDTAYAAEKNIAVKNTPNSSANAVAELVLGQMFNLARF 118

Query: 59  IPVANESTHKGKWEKFNFMGVEA 81
           + +AN +  +G+W K  + G+E 
Sbjct: 119 LNLANITMKQGEWNKKAYTGMEL 141


>gi|126651023|ref|ZP_01723234.1| hypothetical protein BB14905_20250 [Bacillus sp. B14905]
 gi|126592224|gb|EAZ86273.1| hypothetical protein BB14905_20250 [Bacillus sp. B14905]
          Length = 320

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A  +K+V    +G +N+D+    + GI+  NTP   + TTA+    L+LA AR+IP
Sbjct: 62  LLSQAPNLKLVTNLAVGFNNIDVKALRKRGIMATNTPGVLTNTTADLVFGLLLATARRIP 121

Query: 61  VANESTHKGKWEKFNFM 77
            +     +GKW+ +  M
Sbjct: 122 ESERYLREGKWKSWYPM 138


>gi|330684926|gb|EGG96608.1| 4-phosphoerythronate dehydrogenase [Staphylococcus epidermidis
           VCU121]
          Length = 198

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/74 (37%), Positives = 47/74 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L++A  +K++    +G DN+D+ +A++ GI V NTP   + TTAE   +LMLA AR+I  
Sbjct: 62  LANAPHLKIIANMAVGYDNIDVNLANQKGIKVTNTPEVLTETTAELGFTLMLATARRIVE 121

Query: 62  ANESTHKGKWEKFN 75
           A +   +G+W+ + 
Sbjct: 122 AEKYVQEGQWKSWG 135


>gi|206559368|ref|YP_002230129.1| putative 2-ketogluconate reductase [Burkholderia cenocepacia J2315]
 gi|206561230|ref|YP_002231995.1| putative 2-ketogluconate reductase [Burkholderia cenocepacia J2315]
 gi|198035406|emb|CAR51282.1| putative 2-ketogluconate reductase [Burkholderia cenocepacia J2315]
 gi|198037272|emb|CAR53194.1| putative 2-ketogluconate reductase [Burkholderia cenocepacia J2315]
          Length = 329

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVANMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIAE 118

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G W+K+ + G   G
Sbjct: 119 SEHWLRAGHWQKWAYDGF-LG 138


>gi|290968084|ref|ZP_06559633.1| 4-phosphoerythronate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781990|gb|EFD94569.1| 4-phosphoerythronate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 315

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   K +K +  A  G D+VDL  A   G+ V N    +++  AE  +++ML + R IP
Sbjct: 63  VIRACKNLKFIDVAFTGVDHVDLETAKACGVKVSNASGYSTVAVAELTLAMMLNLLRNIP 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ +   G   K   +G E 
Sbjct: 123 QADAACRAGG-TKNGLVGREL 142


>gi|52429164|gb|AAU49757.1| glyoxylate reductase [Burkholderia mallei ATCC 23344]
          Length = 342

 Score = 74.1 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 71  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 130

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 131 ESEHWLRAGQWRKWSYDSFLGADI 154


>gi|126662898|ref|ZP_01733897.1| phosphoglycerate dehydrogenase [Flavobacteria bacterium BAL38]
 gi|126626277|gb|EAZ96966.1| phosphoglycerate dehydrogenase [Flavobacteria bacterium BAL38]
          Length = 322

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  ++ + R G G +++D   A+  GI ++  P GN+    E A+ ++L++   + 
Sbjct: 62  FLDKATNLQFIARVGAGLESIDCDYATAKGIHLIAAPEGNANAVGEQALGMLLSLFNNLN 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN     G W++    G E 
Sbjct: 122 KANNEVKSGHWKREANRGHEL 142


>gi|307152340|ref|YP_003887724.1| glyoxylate reductase [Cyanothece sp. PCC 7822]
 gi|306982568|gb|ADN14449.1| Glyoxylate reductase [Cyanothece sp. PCC 7822]
          Length = 326

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++  K +KV+ +  +G DN+D+  A+   I V NTP   +  TA+   +L++  AR+I 
Sbjct: 62  LINTGKSLKVISQMAVGYDNIDIKAATNRKIPVGNTPGVLTDATADLTWALLMCAARRII 121

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            + +    G W+ +     +G + 
Sbjct: 122 ESEQYVRAGSWQTWEPTLLLGTDL 145


>gi|317154382|ref|YP_004122430.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316944633|gb|ADU63684.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 343

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
               A K+K      +G DN+D+  A+R  I V NTP   +  TAE A +L+ A AR++ 
Sbjct: 62  FFDAAPKLKGYANYAVGYDNIDVAEATRRSIPVSNTPGVLTDATAECAWALIFATARRVA 121

Query: 61  VANESTHKGKWEKFN---FMG 78
            A+     G W+ +    F+G
Sbjct: 122 EADRVMRSGAWQGWGPLQFIG 142


>gi|161723179|ref|YP_442235.2| glyoxylate reductase [Burkholderia thailandensis E264]
 gi|257138428|ref|ZP_05586690.1| glyoxylate reductase [Burkholderia thailandensis E264]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGRWRKWSYDSFLGADI 141


>gi|162210063|ref|YP_334307.2| 2-hydroxyacid dehydrogenase [Burkholderia pseudomallei 1710b]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGQWRKWSYDSFLGADI 141


>gi|167619203|ref|ZP_02387834.1| glyoxylate reductase [Burkholderia thailandensis Bt4]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGQWRKWSYDSFLGADI 141


>gi|209966395|ref|YP_002299310.1| glyoxylate reductase [Rhodospirillum centenum SW]
 gi|209959861|gb|ACJ00498.1| glyoxylate reductase [Rhodospirillum centenum SW]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +++ A  ++K++   G G D++DL  A   GI V NTP   +  TA+  ++L+LA+AR++
Sbjct: 65  VIAAAGPRLKLIANFGNGVDHIDLKAARERGISVTNTPGVLTEDTADMTMALILAVARRL 124

Query: 60  PVANESTHKGKWEKF---NFMGVEAG 82
                    G+W  +   N +G   G
Sbjct: 125 TEGERLVRSGRWTGWGPTNMLGSRLG 150


>gi|167825193|ref|ZP_02456664.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 9]
 gi|226197944|ref|ZP_03793518.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237813226|ref|YP_002897677.1| glyoxylate reductase (Glycolate reductase) [Burkholderia
           pseudomallei MSHR346]
 gi|225930132|gb|EEH26145.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237504901|gb|ACQ97219.1| glyoxylate reductase (Glycolate reductase) [Burkholderia
           pseudomallei MSHR346]
          Length = 352

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 81  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 140

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 141 ESEHWLRAGQWRKWSYDSFLGADI 164


>gi|126454705|ref|YP_001067117.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1106a]
 gi|167846690|ref|ZP_02472198.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei B7210]
 gi|217420979|ref|ZP_03452484.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 576]
 gi|242316668|ref|ZP_04815684.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1106b]
 gi|254191216|ref|ZP_04897720.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254195793|ref|ZP_04902219.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei S13]
 gi|254260908|ref|ZP_04951962.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1710a]
 gi|254296842|ref|ZP_04964295.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 406e]
 gi|76579889|gb|ABA49364.1| glyoxylate reductase [Burkholderia pseudomallei 1710b]
 gi|126228347|gb|ABN91887.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1106a]
 gi|157807766|gb|EDO84936.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 406e]
 gi|157938888|gb|EDO94558.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|169652538|gb|EDS85231.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei S13]
 gi|217396391|gb|EEC36408.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 576]
 gi|242139907|gb|EES26309.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1106b]
 gi|254219597|gb|EET08981.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1710a]
          Length = 352

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 81  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 140

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 141 ESEHWLRAGQWRKWSYDSFLGADI 164


>gi|53720065|ref|YP_109051.1| 2-hydroxyacid dehydrogenase [Burkholderia pseudomallei K96243]
 gi|161579502|ref|YP_102310.2| 2-hydroxyacid dehydrogenase [Burkholderia mallei ATCC 23344]
 gi|52210479|emb|CAH36462.1| putative 2-ketogluconate reductase [Burkholderia pseudomallei
           K96243]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGQWRKWSYDSFLGADI 141


>gi|325684263|gb|EGD26436.1| glyoxylate reductase [Lactobacillus delbrueckii subsp. lactis DSM
           20072]
          Length = 319

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 44/71 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V   G+G D++D+  AS  GI+V N P      TAE A +L+LA++R++ 
Sbjct: 61  LLDAGKKLKIVSATGVGYDHIDVDYASSQGIIVSNCPASVMQPTAEMAFTLLLALSRKLA 120

Query: 61  VANESTHKGKW 71
           + N+   +G +
Sbjct: 121 LYNQEMRQGNF 131


>gi|325125551|gb|ADY84881.1| Glyoxylate reductase [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 316

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 44/71 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V   G+G D++D+  AS  GI+V N P      TAE A +L+LA++R++ 
Sbjct: 58  LLDAGKKLKIVSATGVGYDHIDVDYASSQGIIVSNCPASVMQPTAEMAFTLLLALSRKLA 117

Query: 61  VANESTHKGKW 71
           + N+   +G +
Sbjct: 118 LYNQEMRQGNF 128


>gi|313123504|ref|YP_004033763.1| d-isomer specific 2-hydroxyacid dehydrogenase [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
 gi|312280067|gb|ADQ60786.1| D-isomer specific 2-hydroxyacid dehydrogenase [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
          Length = 316

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 44/71 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   KK+K+V   G+G D++D+  AS  GI+V N P      TAE A +L+LA++R++ 
Sbjct: 58  LLDAGKKLKIVSATGVGYDHIDVDYASSQGIIVSNCPASVMQPTAEMAFTLLLALSRKLA 117

Query: 61  VANESTHKGKW 71
           + N+   +G +
Sbjct: 118 LYNQEMRQGNF 128


>gi|226502750|ref|NP_001148319.1| LOC100281928 [Zea mays]
 gi|195616328|gb|ACG29994.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195617508|gb|ACG30584.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 590

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 56/82 (68%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR I
Sbjct: 103 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAVARNI 162

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A+ S   GKW++  ++GV  
Sbjct: 163 APADASLKAGKWQRGKYVGVTL 184


>gi|194707240|gb|ACF87704.1| unknown [Zea mays]
          Length = 589

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/82 (43%), Positives = 56/82 (68%), Gaps = 1/82 (1%)

Query: 1   MLSHAK-KMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +   A+ +++VVGRAG+G DNVDL  A+ AG +V+N P  N++  AEHA++L+ A+AR I
Sbjct: 102 VFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAVALLAAVARNI 161

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
             A+ S   GKW++  ++GV  
Sbjct: 162 APADASLKAGKWQRGKYVGVTL 183


>gi|187251120|ref|YP_001875602.1| putative phosphoglycerate dehydrogenase [Elusimicrobium minutum
           Pei191]
 gi|186971280|gb|ACC98265.1| Putative phosphoglycerate dehydrogenase [Elusimicrobium minutum
           Pei191]
          Length = 315

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +  A  +K+V RAG G D +D+  A   G+ V N P  NSI  AE A+ L+L++ R+IP 
Sbjct: 59  IDAAPSLKLVIRAGAGYDTIDINHAKTKGVAVCNCPGTNSIAVAELAMGLILSLDRRIPD 118

Query: 62  ANESTHKGKWEK------FNFMGVEAG 82
                  GKW K          G   G
Sbjct: 119 NIIDLKAGKWNKTEYSKAKGLYGRTLG 145


>gi|167739583|ref|ZP_02412357.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 14]
 gi|167919907|ref|ZP_02506998.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei BCC215]
 gi|254184183|ref|ZP_04890773.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1655]
 gi|184214714|gb|EDU11757.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 1655]
          Length = 346

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 75  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 134

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 135 ESEHWLRAGQWRKWSYDSFLGADI 158


>gi|124383679|ref|YP_001028734.1| glyoxylate reductase [Burkholderia mallei NCTC 10229]
 gi|134277497|ref|ZP_01764212.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 305]
 gi|167816786|ref|ZP_02448466.1| glyoxylate reductase [Burkholderia pseudomallei 91]
 gi|254177943|ref|ZP_04884598.1| glyoxylate reductase [Burkholderia mallei ATCC 10399]
 gi|254357676|ref|ZP_04973949.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei 2002721280]
 gi|134251147|gb|EBA51226.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 305]
 gi|148026803|gb|EDK84824.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei 2002721280]
 gi|160698982|gb|EDP88952.1| glyoxylate reductase [Burkholderia mallei ATCC 10399]
          Length = 352

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 81  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 140

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 141 ESEHWLRAGQWRKWSYDSFLGADI 164


>gi|167720594|ref|ZP_02403830.1| glyoxylate reductase [Burkholderia pseudomallei DM98]
          Length = 352

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 81  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 140

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 141 ESEHWLRAGQWRKWSYDSFLGADI 164


>gi|161525370|ref|YP_001580382.1| D-isomer specific 2-hydroxyacid dehydrogenase [Burkholderia
           multivorans ATCC 17616]
 gi|189349893|ref|YP_001945521.1| glyoxylate reductase [Burkholderia multivorans ATCC 17616]
 gi|221201320|ref|ZP_03574359.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD2M]
 gi|221208800|ref|ZP_03581798.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD2]
 gi|221214120|ref|ZP_03587093.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD1]
 gi|160342799|gb|ABX15885.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia multivorans ATCC 17616]
 gi|189333915|dbj|BAG42985.1| glyoxylate reductase [Burkholderia multivorans ATCC 17616]
 gi|221166297|gb|EED98770.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD1]
 gi|221171256|gb|EEE03705.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD2]
 gi|221178588|gb|EEE10996.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia multivorans CGD2M]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVSNMAVGYNNFDMAAFNAANVLATNTPDVLNESTADFGWALMMAAARRIAE 118

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G W+K+ + G   G
Sbjct: 119 SEHWLRAGHWQKWAYDGF-LG 138


>gi|78065688|ref|YP_368457.1| 2-hydroxyacid dehydrogenase [Burkholderia sp. 383]
 gi|77966433|gb|ABB07813.1| D-isomer specific 2-hydroxyacid dehydrogenase [Burkholderia sp.
           383]
          Length = 329

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVANMAVGYNNFDMAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRIAE 118

Query: 62  ANESTHKGKWEKFNFMGVEAG 82
           +      G W+K+ + G   G
Sbjct: 119 SEHWLRAGHWQKWAYDGF-LG 138


>gi|160900170|ref|YP_001565752.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase [Delftia
           acidovorans SPH-1]
 gi|160365754|gb|ABX37367.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Delftia
           acidovorans SPH-1]
          Length = 335

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++KVV    +G +N D+   + AG+   N P   + TTA+   +L++A AR++ 
Sbjct: 63  LLAACPRLKVVANMAVGYNNFDVPAMTAAGVQGTNAPDVLTETTADFGFALLMATARRVT 122

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            +      GKW  +    F G E 
Sbjct: 123 ESEHYLRAGKWNSWRYDLFAGSEV 146


>gi|121599909|ref|YP_993802.1| glyoxylate reductase [Burkholderia mallei SAVP1]
 gi|167903665|ref|ZP_02490870.1| glyoxylate reductase [Burkholderia pseudomallei NCTC 13177]
 gi|238563899|ref|ZP_00438075.2| glyoxylate reductase [Burkholderia mallei GB8 horse 4]
 gi|251767839|ref|ZP_04820278.1| glyoxylate reductase [Burkholderia mallei PRL-20]
 gi|254199204|ref|ZP_04905570.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei FMH]
 gi|254205509|ref|ZP_04911861.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei JHU]
 gi|262193275|ref|YP_001081360.2| glyoxylate reductase [Burkholderia mallei NCTC 10247]
 gi|121228719|gb|ABM51237.1| glyoxylate reductase [Burkholderia mallei SAVP1]
 gi|147748800|gb|EDK55874.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei FMH]
 gi|147752952|gb|EDK60017.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia mallei JHU]
 gi|238519730|gb|EEP83198.1| glyoxylate reductase [Burkholderia mallei GB8 horse 4]
 gi|243061602|gb|EES43788.1| glyoxylate reductase [Burkholderia mallei PRL-20]
 gi|261825970|gb|ABN00968.2| glyoxylate reductase [Burkholderia mallei NCTC 10229]
 gi|261835077|gb|ABO06411.2| glyoxylate reductase [Burkholderia mallei NCTC 10247]
          Length = 346

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 75  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 134

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 135 ESEHWLRAGQWRKWSYDSFLGADI 158


>gi|90580794|ref|ZP_01236597.1| D-lactate dehydrogenase [Vibrio angustum S14]
 gi|90438062|gb|EAS63250.1| D-lactate dehydrogenase [Vibrio angustum S14]
          Length = 317

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 35/73 (47%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS    +K +     GT+NVDL    R  I V N     + +  EH ++++ A+ R + 
Sbjct: 59  ILSQLPNLKFIAIGATGTNNVDLDYCHRHNIPVSNIRGYATRSVPEHVLAMIFALKRNLI 118

Query: 61  VANESTHKGKWEK 73
              +    G+W+K
Sbjct: 119 GYQQDIIAGEWQK 131


>gi|126440742|ref|YP_001059830.1| glyoxylate reductase [Burkholderia pseudomallei 668]
 gi|126220235|gb|ABN83741.1| glyoxylate reductase [Burkholderia pseudomallei 668]
          Length = 348

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 81  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 140

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 141 ESEHWLRAGQWRKWSYDSFLGADI 164


>gi|307326898|ref|ZP_07606089.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Streptomyces violaceusniger Tu 4113]
 gi|306887434|gb|EFN18429.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Streptomyces violaceusniger Tu 4113]
          Length = 326

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  + VV + G+GTDN+DL  A+  G+ V+N P  N+   A+  ++L+LA  R+I 
Sbjct: 75  VLDAAPGLNVVAKHGVGTDNIDLAAAAAHGVRVVNAPGSNTTAVADMTMALLLAAVRRIV 134

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+ S   G+W++  F G E 
Sbjct: 135 PAHASVTGGRWDR--FFGPEL 153


>gi|239828219|ref|YP_002950843.1| glyoxylate reductase [Geobacillus sp. WCH70]
 gi|239808512|gb|ACS25577.1| Glyoxylate reductase [Geobacillus sp. WCH70]
          Length = 327

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L   K +KVV   G+G DN+D+  A++ GI V NTP   + TTA+   +L+LA AR+I 
Sbjct: 63  VLKAGKSLKVVANMGVGFDNIDVPAATKYGIAVCNTPDVLTDTTADLTFALLLATARRIV 122

Query: 61  VANESTHKGKWEKFN 75
            A +   +GKW+ ++
Sbjct: 123 EAAQFIKEGKWKSWS 137


>gi|229020138|ref|ZP_04176914.1| 2-ketogluconate reductase [Bacillus cereus AH1273]
 gi|229026366|ref|ZP_04182723.1| 2-ketogluconate reductase [Bacillus cereus AH1272]
 gi|228734829|gb|EEL85467.1| 2-ketogluconate reductase [Bacillus cereus AH1272]
 gi|228741147|gb|EEL91369.1| 2-ketogluconate reductase [Bacillus cereus AH1273]
          Length = 330

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+ +R++ 
Sbjct: 70  LLDVAPNLKVVSNISVGYDNFDLTAMEKRNVIGTNTPYVLDDTVADLVFALMLSASRRVC 129

Query: 61  VANESTHKGKWE---KFNFMGVEA 81
             +     G+W    +    G++ 
Sbjct: 130 ELDSYVKNGEWNAEIRKEHFGLDV 153


>gi|111025673|ref|YP_708093.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110824652|gb|ABG99935.1| probable phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 163

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 43/71 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+    +KV+ R G G D++D+  A+R G+VV N P  NS   A H + L LA  R++P
Sbjct: 35  VLAALPHLKVISRLGTGVDSIDVPAANRHGVVVTNVPDANSEEVATHTMGLALAAHRRLP 94

Query: 61  VANESTHKGKW 71
             ++S  +G+W
Sbjct: 95  SFDKSVRQGQW 105


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L   ++M+ + RAG+GTDN+D   A+R GIVVMNTP GN+++TAEH  +LMLA++R++  
Sbjct: 60  LEGNRRMRAIARAGVGTDNIDKNAATRLGIVVMNTPTGNTLSTAEHTFTLMLALSRRVAE 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           A      GKW++  FMG + 
Sbjct: 120 AYHKLIGGKWDRKTFMGTQL 139


>gi|167041591|gb|ABZ06338.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_009A22]
          Length = 318

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 42/75 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A K+K++ R G+G DNVD+    +  I +  T   N+ + AEH   +ML I+R I 
Sbjct: 58  LIEAATKLKIISRHGVGYDNVDIETVKKKNITLAITAKANAGSVAEHVFFMMLNISRGID 117

Query: 61  VANESTHKGKWEKFN 75
           + ++   +G + K N
Sbjct: 118 IYDKCVREGNFSKRN 132


>gi|291296834|ref|YP_003508232.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Meiothermus ruber DSM 1279]
 gi|290471793|gb|ADD29212.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Meiothermus ruber DSM 1279]
          Length = 308

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VVGR G+G DN++      AG+ +      N+   AE+ ++ ML +AR I 
Sbjct: 58  LLAAAPRLRVVGRLGVGLDNINQPDLKAAGVQLYFARGINANGVAEYVMAAMLHLARNIA 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A     +G W +  F G E 
Sbjct: 118 GAAAHVAEGGWNRTAFGGFEL 138


>gi|167911913|ref|ZP_02499004.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Burkholderia pseudomallei 112]
          Length = 346

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+     A ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 75  VLAAAPRLRVVSNMAVGYNNFDIGAFDAAHVLGTNTPDVLTETTADFGWALMMAAARRIT 134

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 135 ESEHWLRAGQWRKWSYDSFLGADI 158


>gi|167581120|ref|ZP_02373994.1| glyoxylate reductase [Burkholderia thailandensis TXDOH]
          Length = 329

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A +++VV    +G +N D+       ++  NTP   + TTA+   +LM+A AR+I 
Sbjct: 58  VLAAAPRLRVVSNMAVGYNNFDIGAFDAVHVLGTNTPDVLTETTADFGWALMMAAARRIA 117

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
            +      G+W K+   +F+G + 
Sbjct: 118 ESEHWLRAGQWRKWSYDSFLGADI 141


>gi|297182555|gb|ADI18715.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [uncultured Rhizobiales bacterium HF4000_32B18]
          Length = 312

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++ A  +K + R G G D+VDL  A   GI V NTP   ++  AE A+  +L   R+I 
Sbjct: 66  VMAAAPSLKAIARCGTGLDSVDLEAARARGIAVSNTPGAPALAVAELAVGHILGALRRIA 125

Query: 61  VANESTHKGKW 71
            A+    +G W
Sbjct: 126 EADRLIREGNW 136


>gi|226357846|ref|YP_002787586.1| D-isomer specific 2-hydroxyacid dehydrogenase family,
           phosphoglycerate dehydrogenase (D-3-phosphoglycerate
           dehydrogenase) [Deinococcus deserti VCD115]
 gi|226320089|gb|ACO48082.1| putative D-isomer specific 2-hydroxyacid dehydrogenase family,
           putative phosphoglycerate dehydrogenase
           (D-3-phosphoglycerate dehydrogenase) [Deinococcus
           deserti VCD115]
          Length = 331

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KV+ R G+G D++D+  A++ G+VV NTP  N    AE  +++ML  AR   
Sbjct: 64  VLAAAPDLKVISRTGVGFDSIDVAAATQRGVVVCNTPNVNRYAVAEWTLAMMLGCARHAV 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                 + G +++  F G E 
Sbjct: 124 KNWTEMNAGGFKR--FEGTEL 142


>gi|116871498|ref|YP_848279.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116740376|emb|CAK19494.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 318

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V   G G DN+D+  A + GI V NTP  ++  TAE  + L+LA+AR+I 
Sbjct: 60  VLESAKNLKIVANIGAGFDNIDVKKAQKLGIAVTNTPDVSTEATAELTLGLILAVARRIS 119

Query: 61  VANESTHK-----GKWEKFNFMGVEA 81
             +    +       W    F+G E 
Sbjct: 120 EGDRLCRETPEQFKGWAPTFFLGTEL 145


>gi|332042063|gb|EGI78401.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Hylemonella gracilis ATCC 19624]
          Length = 325

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 40/76 (52%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++K+     +G +N DL   +  G++  NTP   + TTA+   +L++A AR+I 
Sbjct: 62  VLQACPRLKICANMAVGYNNFDLDAMTAHGVLGTNTPDVLTDTTADFGFALLMATARRIA 121

Query: 61  VANESTHKGKWEKFNF 76
            +      GKW K+ +
Sbjct: 122 ESEHYLRAGKWHKWAY 137


>gi|77459210|ref|YP_348717.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Pseudomonas fluorescens Pf0-1]
 gi|77383213|gb|ABA74726.1| putative hydroxyacid dehydrogenase [Pseudomonas fluorescens Pf0-1]
          Length = 324

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ + K+++V R G G DNVD   A+  G+ V NTP  N  +  EH  +L+L I+R++ 
Sbjct: 56  MIAASPKLRIVARHGAGYDNVDYKAAAELGVWVTNTPGANRRSVVEHVFALLLGISRKVQ 115

Query: 61  VANESTHKGKW--EKFNFMGVEA 81
           +A + T    W  ++ +  G+E 
Sbjct: 116 LATDQTRNNIWAQDRLSLTGIEL 138


>gi|225012227|ref|ZP_03702664.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-2A]
 gi|225003782|gb|EEG41755.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Flavobacteria bacterium MS024-2A]
          Length = 313

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A+ ++ + R G G +N+D+  A    I ++  P GN     EHAI L+L +  ++ 
Sbjct: 60  FIDTAQNLRFIARVGAGLENIDVKYAQSKNIHLIAAPEGNRNAVGEHAIGLLLGLMNKLR 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
           + + S  +GKW +    G E 
Sbjct: 120 LGHHSIQQGKWLREVHRGFEL 140


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            LS A K++ V RAG+G DNVD+  +S+ G+VVMN P  N+I   E   + +L+  R  P
Sbjct: 61  FLSLATKLRAVVRAGVGVDNVDIEASSKRGVVVMNVPTANTIAAVELTCAHILSAIRNFP 120

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            AN     +  W++ ++ G E 
Sbjct: 121 GANAQLKVERVWKREDWYGTEL 142


>gi|325956626|ref|YP_004292038.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Lactobacillus acidophilus 30SC]
 gi|325333191|gb|ADZ07099.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Lactobacillus acidophilus 30SC]
 gi|327183451|gb|AEA31898.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Lactobacillus amylovorus GRL 1118]
          Length = 321

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 41/71 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  AK +K++   G+G D+VD+  A   GIVV N P      TAE  +++++A AR++ 
Sbjct: 63  MIDAAKNLKIISTYGVGFDHVDVEYAKEKGIVVSNCPKSVLRPTAELTLTMIMASARRLR 122

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 123 YYDHALREGVF 133


>gi|325576992|ref|ZP_08147563.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160950|gb|EGC73069.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 419

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 79  MIEAAPKLIAIGCFCIGTNQVDLNAAKMRGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 138

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      E 
Sbjct: 139 QANADVHRGLWNKSAVGSHEV 159


>gi|315038174|ref|YP_004031742.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Lactobacillus amylovorus GRL 1112]
 gi|312276307|gb|ADQ58947.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Lactobacillus amylovorus GRL 1112]
          Length = 321

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 41/71 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  AK +K++   G+G D+VD+  A   GIVV N P      TAE  +++++A AR++ 
Sbjct: 63  MIDAAKNLKIISTYGVGFDHVDVEYAKEKGIVVSNCPKSVLRPTAELTLTMIMASARRLR 122

Query: 61  VANESTHKGKW 71
             + +  +G +
Sbjct: 123 YYDHALREGVF 133


>gi|301155286|emb|CBW14752.1| D-3-phosphoglycerate dehydrogenase [Haemophilus parainfluenzae
           T3T1]
          Length = 410

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+  A K+  +G   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIEAAPKLIAIGCFCIGTNQVDLNAAKMRGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      E 
Sbjct: 130 QANADVHRGLWNKSAVGSHEV 150


>gi|241662371|ref|YP_002980731.1| gluconate 2-dehydrogenase [Ralstonia pickettii 12D]
 gi|240864398|gb|ACS62059.1| Gluconate 2-dehydrogenase [Ralstonia pickettii 12D]
          Length = 324

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML HA ++K      +G DN D+   +R GIV+ +TP   + +TA+   +L+LA AR++ 
Sbjct: 55  MLDHAPRLKAWSTISVGYDNFDVPDLTRRGIVLAHTPDVLTESTADTVFALILASARRVV 114

Query: 61  VANESTHKGKWEKFNFMGVEA 81
              E    G W++   +G E 
Sbjct: 115 ELAEWVRAGNWQRS--IGPEL 133


>gi|291165895|gb|EFE27942.1| D-3-phosphoglycerate dehydrogenase [Filifactor alocis ATCC 35896]
          Length = 303

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M+    K+K +G AGIG +++D   A   GI V N   G+  + AE A++LML + R++ 
Sbjct: 56  MIDAGVKLKAIGMAGIGLNHIDTKYAEEKGIKVFNVKDGSIDSVAELALTLMLTVMRKVN 115

Query: 61  VANESTHKGKWEKFNFMGV 79
            AN +  +GKW+K  F G 
Sbjct: 116 PANNAVKQGKWDKMGFTGN 134


>gi|315230491|ref|YP_004070927.1| dehydrogenase [Thermococcus barophilus MP]
 gi|315183519|gb|ADT83704.1| dehydrogenase [Thermococcus barophilus MP]
          Length = 333

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+++KV+     G D+VD+  A++ GI V       S   AE AI LM+A+ R+I 
Sbjct: 58  IIEKAERLKVISCHSAGYDHVDINAATKKGIYVTKVSGVLSEVVAEFAIGLMIALLRKIA 117

Query: 61  VANESTHKGKWEKFNFM 77
            +++   +GKWE    +
Sbjct: 118 YSDKFIRQGKWESPKLV 134


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            ++HAK MK + RAG+G DNVD+   S+ GI+VMN P  N+I   E  ++ ML+  R  P
Sbjct: 61  FIAHAKNMKAIVRAGVGVDNVDIAGCSKEGIIVMNVPTANTIAAVELTMAHMLSCMRMFP 120

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            ++        W++  + G E 
Sbjct: 121 YSHNHLKLDRVWKREKWYGYEL 142


>gi|311069975|ref|YP_003974898.1| putative 2-hydroxyacid dehydrogenase [Bacillus atrophaeus 1942]
 gi|310870492|gb|ADP33967.1| putative 2-hydroxyacid dehydrogenase [Bacillus atrophaeus 1942]
          Length = 324

 Score = 73.7 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+       IV  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 62  LLEHAPKLKVVSNQSVGYDNFDIEAMKARNIVGTHTPYTLDDTVADLAFSLILSSARRVA 121

Query: 61  VANESTHKGKW 71
             +     GKW
Sbjct: 122 ELDRFVRAGKW 132


>gi|317125479|ref|YP_004099591.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
 gi|315589567|gb|ADU48864.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
          Length = 527

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 55/80 (68%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++  +++KV+ RAG+G DNVD+  A++AG++V+N P  N  + AE AI+L+LA AR I  
Sbjct: 60  IAAGRRLKVIARAGVGLDNVDVQAATQAGVMVVNAPTSNITSAAELAIALLLATARNIAP 119

Query: 62  ANESTHKGKWEKFNFMGVEA 81
           AN++   G W++  + GVE 
Sbjct: 120 ANQALKGGAWKRSKYSGVEL 139


>gi|313107586|ref|ZP_07793771.1| hypothetical protein PA39016_001030035 [Pseudomonas aeruginosa
           39016]
 gi|310880273|gb|EFQ38867.1| hypothetical protein PA39016_001030035 [Pseudomonas aeruginosa
           39016]
          Length = 343

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L    ++++V     G D++DL    R GI V + P   S + AEHA +L+L +AR + 
Sbjct: 65  VLRLLPRVRLVATRSAGFDHIDLQACRRRGIAVCHVPDYGSASVAEHAFALLLGVARHLT 124

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+E   +G +      G E 
Sbjct: 125 QAHERARQGSFAYRGLTGFEL 145


>gi|291486015|dbj|BAI87090.1| gluconate 2-dehydrogenase [Bacillus subtilis subsp. natto BEST195]
          Length = 324

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 39/71 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+      G++  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 62  LLEHAPKLKVVSNQSVGYDNFDIEAMKERGVIGTHTPYTLDDTVADLAFSLILSSARRVA 121

Query: 61  VANESTHKGKW 71
             +     GKW
Sbjct: 122 ELDRFVRAGKW 132


>gi|239636548|ref|ZP_04677550.1| glyoxylate reductase [Staphylococcus warneri L37603]
 gi|239597903|gb|EEQ80398.1| glyoxylate reductase [Staphylococcus warneri L37603]
          Length = 320

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 47/74 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L++A  +KV+    +G DN+D+ +A + GI+V NTP   + TTAE A +LMLA AR+I  
Sbjct: 62  LANAPHLKVIANMAVGYDNIDVNIAKQKGIIVTNTPEVLTETTAELAFTLMLATARRIVE 121

Query: 62  ANESTHKGKWEKFN 75
           A +    G+W+ + 
Sbjct: 122 AEKYVQDGQWKSWG 135


>gi|293415019|ref|ZP_06657662.1| 2-hydroxyacid dehydrogenase/reductase [Escherichia coli B185]
 gi|291432667|gb|EFF05646.1| 2-hydroxyacid dehydrogenase/reductase [Escherichia coli B185]
          Length = 319

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 41/72 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++   G+G D +D+V A   G++V NTP   +   A+  ++L+L +AR+I 
Sbjct: 65  LIEKFPNLKIIASNGVGYDPIDIVAAREHGVIVTNTPGVLNDCVADIGMALLLNVARRIN 124

Query: 61  VANESTHKGKWE 72
           +A+     G+W 
Sbjct: 125 IADRYVRDGRWP 136


>gi|160901744|ref|YP_001567325.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Petrotoga mobilis SJ95]
 gi|160359388|gb|ABX31002.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Petrotoga mobilis SJ95]
          Length = 310

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 46/81 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+K+V RAG+G DN+D+  A   GI V+NTP  NS++ AE  I ++L I R I 
Sbjct: 58  ILEHADKLKIVARAGMGLDNIDVDTAKLKGITVLNTPGQNSLSVAELVIGMVLDIYRHIT 117

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                    +WEK    G E 
Sbjct: 118 RGTIGLKNEQWEKKQLEGFEL 138


>gi|167038355|ref|YP_001665933.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116759|ref|YP_004186918.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166857189|gb|ABY95597.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929850|gb|ADV80535.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 332

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K KV+ R GIG D +D+  A+  GI V+N P       ++HA++L+L  AR++ 
Sbjct: 62  VIEALDKCKVIARYGIGVDTIDIKAATARGICVVNVPDYCMDEVSDHALALLLGCARKVV 121

Query: 61  VANESTHKGKWE 72
           + N +   G W+
Sbjct: 122 LMNNAVKAGTWD 133


>gi|218662979|ref|ZP_03518909.1| putative phosphoglycerate dehydrogenase protein [Rhizobium etli
           IE4771]
          Length = 320

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 37/71 (52%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ +  +K+V R G+G DN+ +  A+  GI V N P       ++HA+   +A AR +  
Sbjct: 66  IAASPNLKIVARLGVGLDNIAVDAATERGIWVTNVPDYCVAEVSDHAVGFAIAWARGLVH 125

Query: 62  ANESTHKGKWE 72
            +     G+W+
Sbjct: 126 FDREVRDGRWD 136


>gi|197285803|ref|YP_002151675.1| 2-ketogluconate reductase [Proteus mirabilis HI4320]
 gi|194683290|emb|CAR43997.1| 2-ketogluconate reductase (2-ketoaldonate reductase) [Proteus
           mirabilis HI4320]
          Length = 319

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A K+K V    +G DNVD+   +   I +M+TP   + T A+  ++L+LA++R+IP
Sbjct: 59  FIEKAPKLKAVSTISVGYDNVDVAALTERHIKLMHTPTVLTDTVADTMMALVLAVSRRIP 118

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
              ++  +G W K    ++ G + 
Sbjct: 119 ELADNIKQGLWVKSITPDWYGTDV 142


>gi|187924905|ref|YP_001896547.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia phytofirmans PsJN]
 gi|187716099|gb|ACD17323.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Burkholderia phytofirmans PsJN]
          Length = 329

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A +++VV    +G +N D+   + A ++  NTP   + +TA+   +LM+A AR+I  
Sbjct: 59  LAAAPRLRVVSNMAVGYNNFDVAAFNAANVLGTNTPDVLNESTADFGWALMMAAARRITE 118

Query: 62  ANESTHKGKWEKF---NFMGVEA 81
           +      G+W+K+    F+G + 
Sbjct: 119 SEHWLRGGQWQKWAYDAFLGSDL 141


>gi|77463745|ref|YP_353249.1| lactate dehydrogenase and related dehydrogenase [Rhodobacter
           sphaeroides 2.4.1]
 gi|77388163|gb|ABA79348.1| Lactate dehydrogenase and related dehydrogenases [Rhodobacter
           sphaeroides 2.4.1]
          Length = 313

 Score = 73.7 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +     + ++   G+G D +D+  A   GI V NTP   +   A+ A+++MLA+ R+IP 
Sbjct: 62  MDLLPALGIIANFGVGFDAIDVEAARARGIRVTNTPDVLNDDVADTALAMMLALCRRIPE 121

Query: 62  ANESTHKGKWEKFNF 76
            +    +G+W K +F
Sbjct: 122 GDRFVREGRWPKGDF 136


>gi|307594403|ref|YP_003900720.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
 gi|307549604|gb|ADN49669.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Vulcanisaeta distributa DSM 14429]
          Length = 318

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++   + +KV+G A +GTD++D+  A   GI V++    ++ + AE    L+L + ++IP
Sbjct: 60  VIDAGRNLKVIGTASVGTDHIDVEYAEGRGIKVVSAAGASTYSVAEFTFGLLLMMVKRIP 119

Query: 61  VANESTHKGKWEKFNFMGVEA 81
                   G+W      G+E 
Sbjct: 120 ENMGRVRNGEWSSLLTPGIEL 140


>gi|323143700|ref|ZP_08078371.1| putative glyoxylate reductase [Succinatimonas hippei YIT 12066]
 gi|322416533|gb|EFY07196.1| putative glyoxylate reductase [Succinatimonas hippei YIT 12066]
          Length = 319

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 38/71 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +   A+K K V R G+G DN+DL  A    I V N P   S   AEHA++L++   R+I 
Sbjct: 61  VFDAAEKCKAVVRYGVGVDNIDLAYAKSKNIKVANVPDYGSEDVAEHALALLMGATRRIV 120

Query: 61  VANESTHKGKW 71
             +E    GKW
Sbjct: 121 TRDEDVRNGKW 131


>gi|319648220|ref|ZP_08002437.1| YoaD protein [Bacillus sp. BT1B_CT2]
 gi|317389855|gb|EFV70665.1| YoaD protein [Bacillus sp. BT1B_CT2]
          Length = 312

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++ + + G G DN+D+  A+  GI+V N P  N+   A+ A  L+L+ AR IP
Sbjct: 61  LIDAAPGLRYIMKFGAGIDNIDVEYANEKGILVTNAPGQNASAVADLAFGLLLSGARSIP 120

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +N +   G W+    MG E 
Sbjct: 121 QSNAAVKAGLWQ--AAMGYEL 139


>gi|73661915|ref|YP_300696.1| putative dehydrogenase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123643222|sp|Q49ZM5|Y606_STAS1 RecName: Full=Putative 2-hydroxyacid dehydrogenase SSP0606
 gi|72494430|dbj|BAE17751.1| putative dehydrogenase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 318

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++   G G +NVD+  A +  I V NTP  ++ +TAE   +L+LA+AR+IP
Sbjct: 61  VIDAANNLKIITNYGAGFNNVDIDYARQQNIDVTNTPKASTNSTAELTFALVLAVARRIP 120

Query: 61  VANESTHK---GKWEKFNFMGVEA 81
             ++         W    F G E 
Sbjct: 121 EGDKLCRTTGFDGWAPLFFRGREV 144


>gi|321313018|ref|YP_004205305.1| putative 2-hydroxyacid dehydrogenase [Bacillus subtilis BSn5]
 gi|320019292|gb|ADV94278.1| putative 2-hydroxyacid dehydrogenase [Bacillus subtilis BSn5]
          Length = 324

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+      G+V  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 62  LLEHAPKLKVVSNQSVGYDNFDIEAMKERGVVGTHTPYTLDDTVADLAFSLILSSARRVA 121

Query: 61  VANESTHKGKW 71
             +     GKW
Sbjct: 122 ELDRFVRAGKW 132


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L+ AKKM+ + RAG+G DNVD+   S+ GIVVMN P  N+I   E  ++ MLA ARQ P
Sbjct: 62  FLARAKKMRAIVRAGVGVDNVDIPGCSKLGIVVMNVPTANTIAAVEMTMAHMLACARQFP 121

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+ +      W + ++ G E 
Sbjct: 122 YAHNNLKLDRVWRRQDWYGTEL 143


>gi|221311417|ref|ZP_03593264.1| gluconate 2-dehydrogenase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315744|ref|ZP_03597549.1| gluconate 2-dehydrogenase [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221320659|ref|ZP_03601953.1| gluconate 2-dehydrogenase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324944|ref|ZP_03606238.1| gluconate 2-dehydrogenase [Bacillus subtilis subsp. subtilis str.
           SMY]
          Length = 324

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+      G+V  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 62  LLEHAPKLKVVSNQSVGYDNFDIEAMKERGVVGTHTPYTLDDTVADLAFSLILSSARRVA 121

Query: 61  VANESTHKGKW 71
             +     GKW
Sbjct: 122 ELDRFVRAGKW 132


>gi|221639615|ref|YP_002525877.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
 gi|221160396|gb|ACM01376.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides KD131]
          Length = 313

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +     + ++   G+G D +D+  A   GI V NTP   +   A+ A+++MLA+ R+IP 
Sbjct: 62  MDLLPALGIIANFGVGFDAIDVEAARARGIRVTNTPDVLNDDVADTALAMMLALCRRIPE 121

Query: 62  ANESTHKGKWEKFNF 76
            +    +G+W K +F
Sbjct: 122 GDRFVREGRWPKGDF 136


>gi|118431608|ref|NP_148197.2| glyoxylate reductase [Aeropyrum pernix K1]
 gi|47116961|sp|Q9YAW4|GYAR_AERPE RecName: Full=Glyoxylate reductase
 gi|116062932|dbj|BAA80834.2| glyoxylate reductase [Aeropyrum pernix K1]
          Length = 335

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS A ++++V +  +G DN+D+  A+R GI V NTP   +  TAE   +L+LA AR++ 
Sbjct: 62  LLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRVV 121

Query: 61  VANESTHKGKWEKFN-------FMGVEA 81
            A+     G+W +          +GVE 
Sbjct: 122 EADHFVRWGEWWRLRTGWHPMMMLGVEL 149


>gi|1945659|emb|CAB08066.1| hypothetical protein [Bacillus subtilis]
          Length = 288

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
          +L HA K+KVV    +G DN D+      G+V  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 26 LLEHAPKLKVVSNQSVGYDNFDIEAMKERGVVGTHTPYTLDDTVADLAFSLILSSARRVA 85

Query: 61 VANESTHKGKW 71
            +     GKW
Sbjct: 86 ELDRFVRAGKW 96


>gi|16080521|ref|NP_391348.1| 2-hydroxyacid dehydrogenase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|13633974|sp|O32264|TKRA_BACSU RecName: Full=Probable 2-ketogluconate reductase; Short=2KR
 gi|2635981|emb|CAB15473.1| putative 2-hydroxyacid dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 325

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 39/71 (54%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN D+      G+V  +TP+    T A+ A SL+L+ AR++ 
Sbjct: 63  LLEHAPKLKVVSNQSVGYDNFDIEAMKERGVVGTHTPYTLDDTVADLAFSLILSSARRVA 122

Query: 61  VANESTHKGKW 71
             +     GKW
Sbjct: 123 ELDRFVRAGKW 133


>gi|314933142|ref|ZP_07840507.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus caprae C87]
 gi|313653292|gb|EFS17049.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Staphylococcus caprae C87]
          Length = 322

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K++    +G DN+D+  A+  GI V NTP   + TTAE   +LML +AR+I 
Sbjct: 61  VLKEASKLKIIANMAVGYDNIDVQKANDNGITVTNTPDILTETTAELGFTLMLTVARRIV 120

Query: 61  VANESTHKGKWEKFN 75
            A     +G+W+ + 
Sbjct: 121 EAERYVQEGQWQSWG 135


>gi|126462574|ref|YP_001043688.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126104238|gb|ABN76916.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 313

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 41/75 (54%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           +     + ++   G+G D +D+  A   GI V NTP   +   A+ A+++MLA+ R+IP 
Sbjct: 62  MDLLPALGIIANFGVGFDAIDIEAARARGIRVTNTPDVLNDDVADTALAMMLALCRRIPE 121

Query: 62  ANESTHKGKWEKFNF 76
            +    +G+W K +F
Sbjct: 122 GDRFVREGRWPKGDF 136


>gi|222824187|ref|YP_002575761.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
 gi|222539409|gb|ACM64510.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
          Length = 526

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            ++    +K + RAG+G DNVD+   S+ GI+VMN P  N+I   E  ++ +L  AR   
Sbjct: 59  FINACSNLKALVRAGVGVDNVDIDECSKKGIIVMNVPTANTIAAVELTMNHLLCSARSFV 118

Query: 61  VANESTH-KGKWEKFNFMGVEA 81
            A+     + +WE+  + GVE 
Sbjct: 119 NAHNFLKIQRRWEREKWYGVEL 140


>gi|170747197|ref|YP_001753457.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Methylobacterium radiotolerans JCM 2831]
 gi|170653719|gb|ACB22774.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Methylobacterium radiotolerans JCM 2831]
          Length = 321

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++++   G+G D VD   A + GIVV NTP   +   A+ A+ L+LA  R+IP
Sbjct: 61  LMDRLPNLELIANFGVGYDAVDAAGARQRGIVVTNTPDVLTDEVADLALGLVLATLRRIP 120

Query: 61  VANESTHKGKWEKFNF------MGVEAG 82
            A+     G W K  F       G   G
Sbjct: 121 QADRYLRDGHWPKAPFPLTASLRGRRVG 148


>gi|149369566|ref|ZP_01889418.1| phosphoglycerate dehydrogenase [unidentified eubacterium SCB49]
 gi|149356993|gb|EDM45548.1| phosphoglycerate dehydrogenase [unidentified eubacterium SCB49]
          Length = 311

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +K + R G G +++D   A++ GI ++++P GN     EH + ++L++   + 
Sbjct: 57  FIDKAVNLKFIARVGAGLESIDQEYATKKGITLISSPEGNRNAVGEHTLGMLLSLFNNLN 116

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            A+    KG W +    G+E 
Sbjct: 117 KADLEVKKGNWLREANRGLEV 137


>gi|302547107|ref|ZP_07299449.1| D-3-phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464725|gb|EFL27818.1| D-3-phosphoglycerate dehydrogenase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 317

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G D +D+  A    I V+  P  NS   AE+   L+L+  R + 
Sbjct: 64  VMDAAPRLKVIAKHGVGVDTIDVAAARARAIPVVCAPGSNSRAVAEYTFGLLLSATRSLA 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++ +   G W K    G E 
Sbjct: 124 ASHTAVAAGGWPK--LFGPEL 142


>gi|302347920|ref|YP_003815558.1| Glyoxylate reductase [Acidilobus saccharovorans 345-15]
 gi|302328332|gb|ADL18527.1| Glyoxylate reductase [Acidilobus saccharovorans 345-15]
          Length = 335

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 1   MLSHA-KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           ++     +++++ +  +G DN+DL  A++ G+ V NTP   +  TA+   +L+LA+AR+I
Sbjct: 62  VIEALSPELRIIAQYAVGFDNIDLECATKHGVYVTNTPDVLTDATADLTWALILAVARRI 121

Query: 60  PVANESTHKGKWEKFN 75
             ++     G W+   
Sbjct: 122 VESDAYVRSGGWKSSG 137


>gi|182679741|ref|YP_001833887.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635624|gb|ACB96398.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 331

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 44/71 (61%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A+K+K V R G+G D VD+   +R  I +      NS + AEHA+ LMLA+A+++ 
Sbjct: 58  VIDRAQKLKFVSRHGVGYDVVDVEALTRRNIPLAIVGDVNSRSVAEHAMMLMLAVAKRVC 117

Query: 61  VANESTHKGKW 71
           V + +T  GKW
Sbjct: 118 VYDAATRAGKW 128


>gi|150024178|ref|YP_001295004.1| putative phosphoglycerate dehydrogenase [Flavobacterium
           psychrophilum JIP02/86]
 gi|149770719|emb|CAL42183.1| Putative phosphoglycerate dehydrogenase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 328

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 39/81 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L  A  ++ + R G G ++++   A   GI ++  P GNS   AEH + ++L++   + 
Sbjct: 62  FLDKATNLQFIARVGAGLESINCDYALTKGIQLIAAPEGNSNAVAEHTLGMLLSLMNNLN 121

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN+    G W +    G E 
Sbjct: 122 KANKEIRSGHWNREANRGHEL 142


>gi|330686305|gb|EGG97913.1| glyoxylate reductase [Staphylococcus epidermidis VCU121]
          Length = 320

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  AK +K++   G G +NVD+  A    I V NTP  ++  TA+  I L+L++AR+I 
Sbjct: 60  VIDSAKNLKIIANYGAGFNNVDIDYAREKDIDVTNTPKASTNATADLTIGLILSVARRIV 119

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
             +E +    ++ +    F G E 
Sbjct: 120 EGDELSRTKGFDGWAPLFFRGREV 143


>gi|291615630|ref|YP_003518372.1| TkrA [Pantoea ananatis LMG 20103]
 gi|291150660|gb|ADD75244.1| TkrA [Pantoea ananatis LMG 20103]
          Length = 324

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 42/74 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   +++      +G DN D+   ++ G+V+M+TP   + T A+  ++L+L+ AR+IP
Sbjct: 60  LLAKMPRLRACSSVSVGYDNFDVDALNQRGVVLMHTPTVLTETVADTIMALVLSSARRIP 119

Query: 61  VANESTHKGKWEKF 74
             +     G W+K 
Sbjct: 120 ELDAWVKAGNWQKS 133


>gi|57168964|ref|ZP_00368093.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57019630|gb|EAL56319.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 317

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A  +K++ R GIG D +D  +  +  I V+ TP   ++  AE  + L+L ++R+I 
Sbjct: 63  VLRNAPNLKLISRVGIGLDGIDFELCRKYNIKVVYTPDAPTMAVAELCVGLILDLSRKIS 122

Query: 61  VANESTHKGKWEKFNFMGV 79
             + +  +G W +   MG+
Sbjct: 123 FTDANLKQGIWNR--HMGM 139


>gi|319787541|ref|YP_004147016.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317466053|gb|ADV27785.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 346

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 45/75 (60%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A K++ V   G+G +N+D+     AG++  NTP   + TTA+   +L++A AR+I  
Sbjct: 65  LAQAPKLRAVANVGVGYNNLDIAALDAAGVIATNTPDVLTETTADLGFALVMAAARRITE 124

Query: 62  ANESTHKGKWEKFNF 76
           +     +G+W +++F
Sbjct: 125 SERWLREGQWRQWSF 139


>gi|315297871|ref|ZP_07872265.1| glyoxylate reductase [Listeria ivanovii FSL F6-596]
 gi|313630744|gb|EFR98500.1| glyoxylate reductase [Listeria ivanovii FSL F6-596]
          Length = 314

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 46/87 (52%), Gaps = 7/87 (8%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V   G G DN+D+  A   GI V NTP  ++  TAE  + L+LAIAR+IP
Sbjct: 60  VLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILAIARRIP 119

Query: 61  VANESTHK------GKWEKFNFMGVEA 81
             +    +      G W    F+G E 
Sbjct: 120 EGDRLCRETPEEFTG-WAPTFFLGTEL 145


>gi|52082012|ref|YP_080803.1| 2-ketogluconate reductase YvcT [Bacillus licheniformis ATCC 14580]
 gi|52787399|ref|YP_093228.1| gluconate 2-dehydrogenase [Bacillus licheniformis ATCC 14580]
 gi|319647876|ref|ZP_08002094.1| YvcT protein [Bacillus sp. BT1B_CT2]
 gi|52005223|gb|AAU25165.1| probable 2-ketogluconate reductase YvcT [Bacillus licheniformis
           ATCC 14580]
 gi|52349901|gb|AAU42535.1| YvcT [Bacillus licheniformis ATCC 14580]
 gi|317390217|gb|EFV71026.1| YvcT protein [Bacillus sp. BT1B_CT2]
          Length = 323

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 40/75 (53%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +LS+A K+K+V    +G DN D+       ++  +TP+    T A+ A  L+L+ AR+I 
Sbjct: 60  LLSNALKLKIVSNNSVGYDNFDIEAMKEKSVIGTHTPYILDDTVADLAFGLILSSARRIA 119

Query: 61  VANESTHKGKWEKFN 75
             +    +GKW K  
Sbjct: 120 ELDRYVREGKWTKSE 134


>gi|283833145|ref|ZP_06352886.1| 2-ketogluconate 6-phosphate reductase [Citrobacter youngae ATCC
           29220]
 gi|291070774|gb|EFE08883.1| 2-ketogluconate 6-phosphate reductase [Citrobacter youngae ATCC
           29220]
          Length = 318

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 43/75 (57%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++   G+G D++D+  A+  GI+V NTP   +   A+  ++L+L +AR++ 
Sbjct: 65  LMEKCPNLKIIASNGVGYDSIDVAAANELGIIVTNTPGVLNDCVADIGMALLLNVARRVN 124

Query: 61  VANESTHKGKWEKFN 75
           +A+    +G+W    
Sbjct: 125 IADRYVREGRWPTEG 139


>gi|91788938|ref|YP_549890.1| D-isomer specific 2-hydroxyacid dehydrogenase [Polaromonas sp.
           JS666]
 gi|91698163|gb|ABE44992.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Polaromonas sp. JS666]
          Length = 328

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+   ++K+     +G +N D+   + A ++  N P   + TTA+   +L++A AR+I 
Sbjct: 62  VLAACPRLKICANMAVGYNNFDVDAMTAARVLATNAPDVLTETTADFGFALLMATARRIT 121

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            +      GKW K++   F G + 
Sbjct: 122 ESEHYLRAGKWTKWSYDMFAGSDI 145


>gi|152980390|ref|YP_001352411.1| 2-hydroxyacid dehydrogenase [Janthinobacterium sp. Marseille]
 gi|151280467|gb|ABR88877.1| 2-hydroxyacid dehydrogenase [Janthinobacterium sp. Marseille]
          Length = 327

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 46/76 (60%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K +    +G +N+D+  A+ AG++V NTP   + TTA++A +L++A AR++ 
Sbjct: 61  VIAANPQLKAICNVAVGYNNIDVAAATAAGVMVTNTPDVLNETTADYAWTLLMANARRVC 120

Query: 61  VANESTHKGKWEKFNF 76
            +      G W+ + F
Sbjct: 121 ESEHWLRAGNWKHWRF 136


>gi|330815956|ref|YP_004359661.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Burkholderia gladioli BSR3]
 gi|327368349|gb|AEA59705.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein
           [Burkholderia gladioli BSR3]
          Length = 329

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A K++VV    +G +N D+   + A ++  NTP   + TTA+   +LM+A AR+I  
Sbjct: 59  LAAAPKLRVVANMAVGYNNFDMAAFNAANVLGTNTPDVLNETTADFGWALMMATARRIAE 118

Query: 62  ANESTHKGKWEKFNF 76
           +      G+W K++F
Sbjct: 119 SEHWLRAGQWRKWSF 133


>gi|218283017|ref|ZP_03489119.1| hypothetical protein EUBIFOR_01705 [Eubacterium biforme DSM 3989]
 gi|218216211|gb|EEC89749.1| hypothetical protein EUBIFOR_01705 [Eubacterium biforme DSM 3989]
          Length = 310

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++    +K V + G+GTDN+DL  A    I V     GNS + AEH ++LM A ++ + 
Sbjct: 63  MMAGCPNLKAVCKFGVGTDNIDLEYAKEHDIYVGRCVGGNSRSVAEHVMALMFAESKNLY 122

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            + +     KW K    G+E 
Sbjct: 123 YSIDEVKDHKWAK--PTGLEI 141


>gi|239617273|ref|YP_002940595.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
 gi|239506104|gb|ACR79591.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
          Length = 317

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++   ++K++    +G +N+D+  A   G++V NTP   +  +A+ A++L+LA AR+I 
Sbjct: 59  IINALPRLKIIANYAVGFNNIDIEAAKAKGVIVTNTPDILTDASADLAMALLLATARRIV 118

Query: 61  VANESTHKG---KWEKFNFMGVEA 81
            A++   KG    W+   F+G+E 
Sbjct: 119 EADKFVRKGLFEGWKPELFLGIEL 142


>gi|254473853|ref|ZP_05087247.1| glyoxylate reductase [Pseudovibrio sp. JE062]
 gi|211956963|gb|EEA92169.1| glyoxylate reductase [Pseudovibrio sp. JE062]
          Length = 314

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 6/88 (6%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +++    ++++   G G D +DL  A    I++  TP   +   A+H ++L LA +R+I 
Sbjct: 60  LMASLPNLELITVYGAGYDKIDLDQARNRNIIITTTPDALTEAVADHVVALALASSRRIA 119

Query: 61  VANESTHKGKWEKFN------FMGVEAG 82
             +     G W +          G   G
Sbjct: 120 EGDRFIRNGDWLRGKLGIGYSLRGKTLG 147


>gi|307720842|ref|YP_003891982.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978935|gb|ADN08970.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
          Length = 528

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            + HA  MK + RAG+G DNV++   S+ GI+VMN P  N+I   E  ++ ML+  R  P
Sbjct: 62  FIEHATNMKAIVRAGVGVDNVNIPECSKKGIIVMNVPTANTIAAVELTMTHMLSCMRMFP 121

Query: 61  VANESTHKGK-WEKFNFMGVEA 81
            +++     + W++  + G E 
Sbjct: 122 YSHDHLKNQRIWKREKWYGYEL 143


>gi|262373002|ref|ZP_06066281.1| 2-ketogluconate reductase [Acinetobacter junii SH205]
 gi|262313027|gb|EEY94112.1| 2-ketogluconate reductase [Acinetobacter junii SH205]
          Length = 321

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 46/73 (63%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A+K+K++    +G DN D+   ++  I + NTP   + TTA+ A SL+L+ AR+IP 
Sbjct: 60  LATAQKLKIISTVSVGYDNYDVNYLNQRKIWLANTPHVLTETTADLAFSLLLSAARKIPQ 119

Query: 62  ANESTHKGKWEKF 74
            +  T +G+W++ 
Sbjct: 120 LDAWTKQGQWKRT 132


>gi|218708392|ref|YP_002416013.1| putative 2-hydroxyacid dehydrogenase family protein [Vibrio
           splendidus LGP32]
 gi|218321411|emb|CAV17361.1| putative 2-hydroxyacid dehydrogenase family protein [Vibrio
           splendidus LGP32]
          Length = 320

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 37/74 (50%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L+ A+++K++  +  G +NVD+       I V N     + +  EH I+++  + R +  
Sbjct: 62  LAQAQQLKLIAVSATGVNNVDVGYCKSNNIAVTNVQGYATQSVPEHVIAMLFTLKRNLVG 121

Query: 62  ANESTHKGKWEKFN 75
            ++    G+W+K  
Sbjct: 122 YHQDIKAGEWQKDK 135


>gi|300770914|ref|ZP_07080791.1| D-3-phosphoglycerate dehydrogenase [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300762187|gb|EFK59006.1| D-3-phosphoglycerate dehydrogenase [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 309

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 37/81 (45%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A  +  + R+G G DN+D   A+   I ++N P GN     EH   ++L++   + 
Sbjct: 59  FMDLAPGLSFIARSGAGMDNIDEAYAASRNITLINAPEGNRDAVGEHMTGMLLSLMNHLN 118

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            +++     +W +    G E 
Sbjct: 119 RSHQQIKNRQWLREENRGYEL 139


>gi|218699732|ref|YP_002407361.1| putative 2-hydroxyacid dehydrogenase/reductase [Escherichia coli
           IAI39]
 gi|300938970|ref|ZP_07153669.1| 4-phosphoerythronate dehydrogenase [Escherichia coli MS 21-1]
 gi|218369718|emb|CAR17487.1| putative 2-hydroxyacid dehydrogenase/reductase [Escherichia coli
           IAI39]
 gi|300456108|gb|EFK19601.1| 4-phosphoerythronate dehydrogenase [Escherichia coli MS 21-1]
          Length = 319

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 41/72 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++   G+G D +D+V A   G++V NTP   +   A+  I+L+L +AR+I 
Sbjct: 65  LIEKFPNLKIIASNGVGYDPIDIVAAREHGVIVTNTPGVLNDCVADIGIALLLNVARRIN 124

Query: 61  VANESTHKGKWE 72
           +A+     G+W 
Sbjct: 125 IADRYVRDGRWP 136


>gi|124268444|ref|YP_001022448.1| putative 2-hydroxyacid dehydrogenase family protein [Methylibium
           petroleiphilum PM1]
 gi|124261219|gb|ABM96213.1| putative 2-hydroxyacid dehydrogenase family protein [Methylibium
           petroleiphilum PM1]
          Length = 320

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 34/74 (45%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L    ++K++  A  G D +D+      GI V N       T  EHA +L+LA+ R I  
Sbjct: 63  LKQLPQLKMIAVAATGYDVIDVPYCKEHGIAVANIRNYAVHTVPEHAFALILALRRNILA 122

Query: 62  ANESTHKGKWEKFN 75
             +    G W+K +
Sbjct: 123 YRQDVEAGVWQKSD 136


>gi|296272566|ref|YP_003655197.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Arcobacter nitrofigilis DSM 7299]
 gi|296096740|gb|ADG92690.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Arcobacter nitrofigilis DSM 7299]
          Length = 309

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 42/76 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++    K++V+   G+G D++DL  A + GIVV NTP   +   A+ A   ++AI+R+I 
Sbjct: 55  LIEKLPKLEVIFTRGVGFDHIDLETAFKRGIVVSNTPDVLTDCVADFAFGALIAISRKIV 114

Query: 61  VANESTHKGKWEKFNF 76
            A+     GKW    F
Sbjct: 115 QADSFVRSGKWLNNKF 130


>gi|261868183|ref|YP_003256105.1| D-3-phosphoglycerate dehydrogenase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413515|gb|ACX82886.1| D-3-phosphoglycerate dehydrogenase (pgdh) [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 410

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 42/81 (51%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           M++ A K+  VG   IGT+ VDL  A   GI V N PF N+ + AE  +  +L + R IP
Sbjct: 70  MIAAAPKLIAVGCFCIGTNQVDLNAAKARGIPVFNAPFSNTRSVAELVLGEILLLMRNIP 129

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            AN   H+G W K      E 
Sbjct: 130 QANAEVHRGLWNKSAMGSHEV 150


>gi|118575511|ref|YP_875254.1| 2 lactate dehydrogenase [Cenarchaeum symbiosum A]
 gi|118194032|gb|ABK76950.1| 2 lactate dehydrogenase [Cenarchaeum symbiosum A]
          Length = 348

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  ++ +    +G D++D+  A   GI V  TP   +  TA+  ++LML + R++ 
Sbjct: 95  VMDAAPDLETIATYSVGYDHIDVAHARGRGITVGYTPDVLTDATADLTMALMLDLLRRVT 154

Query: 61  VANESTHKGKWEK----FNFMGVEAG 82
             +     G+W +     +++G + G
Sbjct: 155 EGDRIIRAGRWRQIYGADDYLGTDVG 180


>gi|124266166|ref|YP_001020170.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [Methylibium
           petroleiphilum PM1]
 gi|124258941|gb|ABM93935.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [Methylibium
           petroleiphilum PM1]
          Length = 321

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 40/71 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     ++V+   G+G D +DL  A+R GI V  TP   +   A+ A++L+L +AR+ P
Sbjct: 64  LIDALPSLRVISSFGVGLDKIDLAAAARRGIAVGYTPDVLNDCVADLAMALLLDVARRTP 123

Query: 61  VANESTHKGKW 71
            A+     G+W
Sbjct: 124 EADRYVRAGRW 134


>gi|297581351|ref|ZP_06943274.1| 2-hydroxyacid dehydrogenase [Vibrio cholerae RC385]
 gi|297534189|gb|EFH73027.1| 2-hydroxyacid dehydrogenase [Vibrio cholerae RC385]
          Length = 325

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 36/75 (48%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ML    K+K++  +  GT+NVDL       I V N     + +  EH +++M A+ R + 
Sbjct: 66  MLVQLPKLKLIAISATGTNNVDLPACRDLNIAVCNVQGYATCSVPEHVVAMMFALRRNLI 125

Query: 61  VANESTHKGKWEKFN 75
             +     G+W++  
Sbjct: 126 GYHNDIAAGEWQRHK 140


>gi|302392584|ref|YP_003828404.1| phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM 5501]
 gi|302204661|gb|ADL13339.1| Phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM 5501]
          Length = 317

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++     +K++  A  G D++DL    + G+ V N P  ++ + AE AI  M+ + R + 
Sbjct: 64  VIEACSNLKLISVAFTGVDHIDLEACQKQGVTVCNAPGYSTHSVAELAIGFMITVMRNMV 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + +T KGK  +   +G E 
Sbjct: 124 PCDVATRKGK-TRTGLIGNEL 143


>gi|121535408|ref|ZP_01667219.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosinus carboxydivorans Nor1]
 gi|121306007|gb|EAX46938.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermosinus carboxydivorans Nor1]
          Length = 317

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 1   MLSH-AKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +++     +K++ + G+G + +D+  A+  GI V  TP  N+I+ AE AI LMLA+AR I
Sbjct: 63  VIAAGLPTLKIIAKHGVGYNTIDVAAAAAYGIPVTITPGANNISVAELAIGLMLAVARHI 122

Query: 60  PVANESTHKGKWEKFNFMGVEA 81
           P  +    +G W +    G E 
Sbjct: 123 PQMDGIVRRGGWSR--MTGSEL 142


>gi|229032546|ref|ZP_04188511.1| 2-ketogluconate reductase [Bacillus cereus AH1271]
 gi|228728731|gb|EEL79742.1| 2-ketogluconate reductase [Bacillus cereus AH1271]
          Length = 320

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L+ A  +KVV    +G DN DL    +  ++  NTP+    T A+   +LML+  R++ 
Sbjct: 60  LLTAAPNLKVVSNISVGYDNFDLQAMEKRNVIGTNTPYVLDDTVADLVFALMLSAGRRVC 119

Query: 61  VANESTHKGKWEKFNFMGVEAG 82
             +     G+W        E G
Sbjct: 120 ELDSYVKNGEWN------AEIG 135


>gi|315923896|ref|ZP_07920124.1| D-lactate dehydrogenase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622736|gb|EFV02689.1| D-lactate dehydrogenase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 316

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A  +K++  A +G D+VD+    R GIV+ NT        AE AI L LA  R I 
Sbjct: 64  VIDAAPNLKMISVAFVGIDHVDVAACKRRGIVIANTGGYCDDAVAELAIGLTLACLRNIT 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
             + +   G   K +  G E 
Sbjct: 124 CCDAAVQAGA-GKGDLAGFEL 143


>gi|14521727|ref|NP_127203.1| 2-hydroxyacid dehydrogenase [Pyrococcus abyssi GE5]
 gi|5458946|emb|CAB50433.1| D-isomer specific 2-hydroxyacid dehydrogenase [Pyrococcus abyssi
           GE5]
          Length = 333

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A+++KV+     G D+VD+  A++ GI V       S   AE A+ L++++ R+I 
Sbjct: 58  ILERAERLKVISCQSAGYDHVDVEEATKRGIYVTKVSGLLSEAVAEFALGLLISLMRKIH 117

Query: 61  VANESTHKGKWEKFNFM-----------GVEAG 82
            A+    +GKWE   F+           G E G
Sbjct: 118 YADSFIREGKWESHTFVWREFKEVETLYGKEVG 150


>gi|297153838|gb|ADI03550.1| D-3-phosphoglycerate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 317

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++  A ++KV+ + G+G D +D+  A    I V+  P  NS   AE+   L+L+  R + 
Sbjct: 64  VMDAAPRLKVIAKHGVGVDTIDVAAARARAIPVVCAPGSNSRAVAEYTFGLLLSATRSLT 123

Query: 61  VANESTHKGKWEKFNFMGVEA 81
            ++ +   G W K    G E 
Sbjct: 124 ASHTAVAAGGWPK--LFGPEL 142


>gi|218780137|ref|YP_002431455.1| glyoxylate reductase [Desulfatibacillum alkenivorans AK-01]
 gi|218761521|gb|ACL03987.1| Glyoxylate reductase [Desulfatibacillum alkenivorans AK-01]
          Length = 326

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
             + A K+K      +G DN+D+  A+R G+ V NTP   +I TAE A +L+ ++ R IP
Sbjct: 62  FFNAAPKLKGYANYAVGFDNIDVEEATRRGVPVSNTPDVLTIATAEMAWALLFSVCRHIP 121

Query: 61  VANESTHKGKWEKFN---FMGVEA 81
            +++      W+ ++   F+G E 
Sbjct: 122 ASDKLVRNDSWKGWSPLQFIGAEV 145


>gi|123433117|ref|XP_001308553.1| D-isomer specific 2-hydroxyacid dehydrogenase [Trichomonas
           vaginalis G3]
 gi|121890239|gb|EAX95623.1| D-isomer specific 2-hydroxyacid dehydrogenase, putative
           [Trichomonas vaginalis G3]
          Length = 322

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +  K+K++     G DN+D+  A++  I+V NT    + T A+   SL++A AR++ 
Sbjct: 69  ILDN-PKLKLITVCAAGYDNIDINYATKRKIIVANTHKSLADTCADTIWSLIMACARRVV 127

Query: 61  VANESTHKGKWEKFN 75
            A++    G WEK +
Sbjct: 128 EADQFVKNGDWEKTS 142


>gi|121609852|ref|YP_997659.1| D-isomer specific 2-hydroxyacid dehydrogenase [Verminephrobacter
           eiseniae EF01-2]
 gi|121554492|gb|ABM58641.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Verminephrobacter eiseniae EF01-2]
          Length = 323

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++    +KV+ + G+G  N+D+  A+R GI V  TP  N+ + AE  + LM A AR+I  
Sbjct: 62  IASCPALKVISKHGVGVGNIDVDAATRRGIPVYITPGANAQSVAELTLGLMFAAARRIGW 121

Query: 62  ANESTHKGKWEKFN 75
            +   H G+W +  
Sbjct: 122 MDAELHAGRWSRAQ 135


>gi|89896188|ref|YP_519675.1| hypothetical protein DSY3442 [Desulfitobacterium hafniense Y51]
 gi|89335636|dbj|BAE85231.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 330

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 34/72 (47%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+V    +G +N D+       ++  +TP     T A+    LML+ AR++ 
Sbjct: 64  LLDAAPKLKIVANISVGYNNFDIGEMQARKVLGTHTPNVLDDTVADLVFGLMLSTARRLC 123

Query: 61  VANESTHKGKWE 72
             +     G+W 
Sbjct: 124 ELDRYVKAGRWN 135


>gi|23100274|ref|NP_693741.1| dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22778506|dbj|BAC14775.1| dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 329

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +   +K+V R G+G DNVD+  A+  G+ V N P       A+ A+++ML   R I 
Sbjct: 62  VIENLPDLKLVVRYGVGVDNVDIAAATEHGVQVCNVPDYGMNEVADQALAMMLNFTRSIS 121

Query: 61  VANESTHKGKWEKFNFM 77
             N    KG W+    M
Sbjct: 122 RMNSFVRKGVWDYQKSM 138


>gi|52842885|ref|YP_096684.1| D-isomer specific 2-hydroxyacid dehydrogenase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148358586|ref|YP_001249793.1| D-isomer specific 2-hydroxyacid dehydrogenase [Legionella
           pneumophila str. Corby]
 gi|52629996|gb|AAU28737.1| D-isomer specific 2-hydroxyacid dehydrogenase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148280359|gb|ABQ54447.1| D-isomer specific 2-hydroxyacid dehydrogenase [Legionella
           pneumophila str. Corby]
          Length = 314

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            L     +K++   GIGTDN+D+    +  I++ + P      TAE AI+L+L ++R++ 
Sbjct: 55  FLMQFPNLKIISHLGIGTDNIDINFLKQNHIILHSQPNAGVHDTAELAIALLLTLSRRVI 114

Query: 61  VANESTHKGKW--EKFNFMGVEA 81
           + +  T   +W  +K  F+G   
Sbjct: 115 LNDRYTRNNEWVEKKPRFLGNHL 137


>gi|219668021|ref|YP_002458456.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfitobacterium hafniense DCB-2]
 gi|219538281|gb|ACL20020.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Desulfitobacterium hafniense DCB-2]
          Length = 337

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 34/72 (47%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A K+K+V    +G +N D+       ++  +TP     T A+    LML+ AR++ 
Sbjct: 71  LLDAAPKLKIVANISVGYNNFDIGEMQARKVLGTHTPNVLDDTVADLVFGLMLSTARRLC 130

Query: 61  VANESTHKGKWE 72
             +     G+W 
Sbjct: 131 ELDRYVKAGRWN 142


>gi|317128752|ref|YP_004095034.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Bacillus cellulosilyticus DSM 2522]
 gi|315473700|gb|ADU30303.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Bacillus cellulosilyticus DSM 2522]
          Length = 326

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 40/72 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L HA K+KVV    +G DN+D+   ++  I+  NTP     TTA+    L++A AR+IP
Sbjct: 61  LLQHAPKLKVVSNVSVGYDNLDIEEMTKRNIMATNTPGVLDDTTADAIFGLLIATARRIP 120

Query: 61  VANESTHKGKWE 72
             +    +G W 
Sbjct: 121 ELDSFVKEGNWN 132


>gi|295705633|ref|YP_003598708.1| glyoxylate reductase [Bacillus megaterium DSM 319]
 gi|294803292|gb|ADF40358.1| glyoxylate reductase [Bacillus megaterium DSM 319]
          Length = 321

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 40/72 (55%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  A  ++V+ ++G+G D+VD+   ++ G+   NTP      TA+    L+L+ AR+I 
Sbjct: 62  LLEAASNLRVISQSGVGYDSVDVEACTKKGVPFSNTPGVLVEATADLTFGLLLSAARRIH 121

Query: 61  VANESTHKGKWE 72
              E   +G WE
Sbjct: 122 EGYEKVKQGNWE 133


>gi|262275058|ref|ZP_06052869.1| D-lactate dehydrogenase [Grimontia hollisae CIP 101886]
 gi|262221621|gb|EEY72935.1| D-lactate dehydrogenase [Grimontia hollisae CIP 101886]
          Length = 317

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 33/75 (44%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L     +K++  A  G +NVDL       + V N     + +  EH ++L  A+ R + 
Sbjct: 59  ILKQLPALKLIAVAATGYNNVDLEWCKAHNLPVCNIRGYATRSVPEHVMALAFALRRNLN 118

Query: 61  VANESTHKGKWEKFN 75
             +     G W++ N
Sbjct: 119 AYHRDIELGVWKEKN 133


>gi|227356332|ref|ZP_03840720.1| 2-ketogluconate reductase (2-ketoaldonate reductase) [Proteus
           mirabilis ATCC 29906]
 gi|227163442|gb|EEI48363.1| 2-ketogluconate reductase (2-ketoaldonate reductase) [Proteus
           mirabilis ATCC 29906]
          Length = 319

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
            +  A K+K V    +G DNVD+   +   I +M+TP   + T A+  ++L+L ++R+IP
Sbjct: 59  FIEKAPKLKAVSTISVGYDNVDVAALTERHIKLMHTPTVLTDTVADTMMALVLTVSRRIP 118

Query: 61  VANESTHKGKWEKF---NFMGVEA 81
              ++  +G W K    ++ G + 
Sbjct: 119 ELADNIKQGLWVKSITPDWYGTDV 142


>gi|196014685|ref|XP_002117201.1| hypothetical protein TRIADDRAFT_63420 [Trichoplax adhaerens]
 gi|190580166|gb|EDV20251.1| hypothetical protein TRIADDRAFT_63420 [Trichoplax adhaerens]
          Length = 324

 Score = 72.6 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 15/96 (15%)

Query: 1   MLSHA------------KKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHA 48
           +L  A              +KV+    +G D++DL    +  IVV NTP  ++   AE  
Sbjct: 61  VLDAAGKHDTKLNHLTSPSLKVIATVSVGFDHIDLDECKKRNIVVSNTPRVSTDAVAELT 120

Query: 49  ISLMLAIARQIPVANESTHKGKWEKFNFM---GVEA 81
           ++L+LA +R++     +   G W+ +  +   G E 
Sbjct: 121 VALLLATSRRLMECANAVKNGDWKSWGLLWMCGTEL 156


>gi|14590422|ref|NP_142488.1| 2-hydroxyacid dehydrogenase [Pyrococcus horikoshii OT3]
 gi|90109156|pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus
           Horikoshii Ot3
 gi|90109157|pdb|2D0I|B Chain B, Crystal Structure Ph0520 Protein From Pyrococcus
           Horikoshii Ot3
 gi|90109158|pdb|2D0I|C Chain C, Crystal Structure Ph0520 Protein From Pyrococcus
           Horikoshii Ot3
 gi|90109159|pdb|2D0I|D Chain D, Crystal Structure Ph0520 Protein From Pyrococcus
           Horikoshii Ot3
 gi|3256925|dbj|BAA29608.1| 333aa long hypothetical dehydrogenase [Pyrococcus horikoshii OT3]
          Length = 333

 Score = 72.6 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L +A+++KV+     G DN+DL  A++ GI V       S   AE  + L++ + R+I 
Sbjct: 58  VLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINLMRKIH 117

Query: 61  VANESTHKGKWE 72
            A++   +G+WE
Sbjct: 118 YADKFIRRGEWE 129


>gi|302391720|ref|YP_003827540.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acetohalobium arabaticum DSM 5501]
 gi|302203797|gb|ADL12475.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Acetohalobium arabaticum DSM 5501]
          Length = 318

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           ++ +A +++VV + G+G DN+D+  A++ G+VV+N P  N  + AEH ++++L IA+   
Sbjct: 56  VIKNAPQLEVVAKHGVGVDNIDIETATKEGVVVVNAPESNIYSVAEHTLTMILTIAKNFV 115

Query: 61  VANESTHKGKW-EKFNFMGVEA 81
           V ++   +G++  +   +G E 
Sbjct: 116 VMDKEVREGRFHSRDKIIGTEL 137


>gi|218679505|ref|ZP_03527402.1| putative phosphoglycerate dehydrogenase protein [Rhizobium etli
           CIAT 894]
          Length = 140

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 37/71 (52%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           ++ +  +K+V R G+G DN+ +  A+  GI V N P       ++HA+   +A AR +  
Sbjct: 60  IAASPNLKIVARLGVGLDNIAVDAATERGIWVTNVPDYCVTEVSDHAVGFAIAWARGLVH 119

Query: 62  ANESTHKGKWE 72
            +     G+W+
Sbjct: 120 FDREVRDGRWD 130


>gi|315284306|ref|ZP_07872134.1| glyoxylate reductase [Listeria marthii FSL S4-120]
 gi|313612050|gb|EFR86364.1| glyoxylate reductase [Listeria marthii FSL S4-120]
          Length = 275

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V   G G DN+D+  A   GI V NTP  ++  TAE  + L+L +AR+I 
Sbjct: 17  VLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRIS 76

Query: 61  VANESTHK-----GKWEKFNFMGVEA 81
             +    +       W    F+G E 
Sbjct: 77  EGDRLCRETPEQFKGWAPTFFLGTEL 102


>gi|313611668|gb|EFR86227.1| glyoxylate reductase [Listeria monocytogenes FSL F2-208]
          Length = 181

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V   G G DN+D+  A   GI V NTP  ++  TAE  + L+L +AR+I 
Sbjct: 63  VLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRIS 122

Query: 61  VANESTHK-----GKWEKFNFMGVEA 81
             +    +       W    F+G E 
Sbjct: 123 EGDRLCRETPEQFKGWAPTFFLGTEL 148


>gi|255519897|ref|ZP_05387134.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Listeria monocytogenes FSL J1-175]
          Length = 318

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIP 60
           +L  AK +K+V   G G DN+D+  A   GI V NTP  ++  TAE  + L+L +AR+I 
Sbjct: 60  VLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRIS 119

Query: 61  VANESTHK-----GKWEKFNFMGVEA 81
             +    +       W    F+G E 
Sbjct: 120 EGDRLCRETPEQFKGWAPTFFLGTEL 145


>gi|255026552|ref|ZP_05298538.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein
           [Listeria monocytogenes FSL J