RPSBLAST alignment for GI: 254780152 and conserved domain: PRK13581

>gnl|CDD|184162 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional. Length = 526
 Score =  141 bits (359), Expect = 3e-35
 Identities = 47/79 (59%), Positives = 60/79 (75%)

Query: 2   LSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQIPV 61
           L  AK +KV+GRAG+G DNVD+  A+R GI+V+N P GN+I+ AEH I+LMLA+AR IP 
Sbjct: 59  LEAAKNLKVIGRAGVGVDNVDVPAATRRGIIVVNAPTGNTISAAEHTIALMLALARNIPQ 118

Query: 62  ANESTHKGKWEKFNFMGVE 80
           A+ S   GKWE+  FMGVE
Sbjct: 119 AHASLKAGKWERKKFMGVE 137