RPSBLAST alignment of GI: 254780152 and MMDB domain: 1dxy_A_101-297

>1dxy_A (A:101-297) D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei}Length = 197
 Score = 40.7 bits (94), Expect = 8e-05
 Identities = 8/37 (21%), Positives = 13/37 (35%)

Query: 41 SITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFM 77
              AE A++  L + R +         G +EK    
Sbjct: 2  PAAIAEFALTDTLYLLRNMGKVQAQLQAGDYEKAGTF 38