RPSBLAST alignment of GI: 254780152 and MMDB domain: 1mx3_A_117-311

>1mx3_A (A:117-311) CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens}Length = 195
 Score = 42.7 bits (99), Expect = 2e-05
 Identities = 5/33 (15%), Positives = 15/33 (45%)

Query: 40 NSITTAEHAISLMLAIARQIPVANESTHKGKWE 72
          +   TA+  +  +L + R+    +++  +G   
Sbjct: 2  SVEETADSTLCHILNLYRRATWLHQALREGTRV 34