RPSBLAST alignment of GI: 254780152 and MMDB domain: 2ekl_A_1-99_286-313

>2ekl_A (A:1-99,A:286-313) D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}Length = 127
 Score = 46.1 bits (109), Expect = 2e-06
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNS 41
           ++   KK+K++ RAGIG DN+D   A +  I V+  P   +
Sbjct: 62  VIEKGKKLKIIARAGIGLDNIDTEEAEKRNIKVVYAPGAQT 102