RPSBLAST alignment of GI: 254780152 and MMDB domain: 2g76_A_1-120_306-335

>2g76_A (A:1-120,A:306-335) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}Length = 150
 Score = 49.2 bits (117), Expect = 2e-07
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLMLAIARQI 59
           +++ A+K++VVGRAG G DNVDL  A+R GI+VMNTP  +   T E        IA Q 
Sbjct: 83  VINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNAS---TKEAQSRCGEEIAVQF 138