RPSBLAST alignment of GI: 254780152 and MMDB domain: 2g76_A_121-305

>2g76_A (A:121-305) 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, serine metabolism; HET: NAD; 1.70A {Homo sapiens}Length = 185
 Score = 46.1 bits (108), Expect = 2e-06
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 39 GNSITTAEHAISLMLAIARQIPVANESTHKGKWEKFNFMGVE 80
          GNS++ AE    +++ +ARQIP A  S   GKWE+  FMG E
Sbjct: 1  GNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTE 42