RPSBLAST alignment of GI: 254780152 and MMDB domain: 3evt_A_1-91_282-324

>3evt_A (A:1-91,A:282-324) Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum}Length = 134
 Score = 48.7 bits (116), Expect = 3e-07
 Identities = 11/37 (29%), Positives = 16/37 (43%)

Query: 1  MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTP 37
          +     ++K V     G D + L     AG+VV NT 
Sbjct: 55 LARPTNQLKFVQVISAGVDYLPLKALQAAGVVVANTS 91