RPSBLAST alignment of GI: 254780152 and MMDB domain: 3hg7_A_1-97_282-324

>3hg7_A (A:1-97,A:282-324) D-isomer specific 2-hydroxyacid dehydrogenase family protein; structural genomics, protein structure initiative; 1.80A {Aeromonas salmonicida subsp}Length = 140
 Score = 47.5 bits (113), Expect = 6e-07
 Identities = 7/53 (13%), Positives = 17/53 (32%), Gaps = 3/53 (5%)

Query: 1   MLSHAKKMKVVGRAGIGTDNVDLVVASRAGIVVMNTPFGNSITTAEHAISLML 53
           +L+ A K+        G D +      R    + N     + +  +    + +
Sbjct: 61  LLAKANKLSWFQSTYAGVDVLL-DARCRRDYQLTNVR--GAYSFPDDVAQIFV 110